Glycine amidinotransferase, mitochondrial

Overview
NameGlycine amidinotransferase, mitochondrial
Smed IDSMED30009513
Length (bp)1650
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine amidinotransferase, mitochondrial (SMED30009513) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30009513) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine amidinotransferase, mitochondrial (SMED30009513) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30009513) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009513

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30009513SMESG000051953.1 SmedASXL_018741SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30009513SMESG000051953.1 dd_Smed_v4_899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009513SMESG000051953.1 dd_Smed_v4_899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009513SMESG000051953.1 dd_Smed_v4_899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009513SMESG000051953.1 dd_Smed_v4_899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009513SMESG000051953.1 dd_Smed_v4_899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009513SMESG000051953.1 dd_Smed_v4_899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009513SMESG000051953.1 Contig42437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009513SMESG000051953.1 Contig42437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009513SMESG000051964.1 SMESG000051953.1 Contig12725newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009513SMESG000051964.1 SMESG000051953.1 Contig12725uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30009513SMESG000051953.1 SMED30009513smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30009513SMESG000051953.1 SMED30009513smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30009513SMESG000051953.1 dd_Smed_v6_899_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30009513SMESG000051953.1 dd_Smed_v6_899_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30009513SMESG000051953.1 dd_Smed_v4_899_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30009513SMESG000051953.1 H.56.4hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 3 cellSMED30009513SMESG000051953.1 H.56.4hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 353.214 bits (905), Expect = 1.362e-116
Identity = 193/392 (49.23%), Postives = 251/392 (64.03%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFD 1242
            S  AA    RN C+          ++ PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +K GG Y+    PK+     + E +E CNILK EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WRSRF+EY  YR ++ DY+ RGA + +APKP  ++E + +D+ I      +K    G +VTTEFEP FDAADF+RAGRDIF Q+S VTN  GIEWMRRHLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW I+  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +G+  IKV+  +  ++GGG HCWT DVRR+GTL++Y D
Sbjct:   38 STQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWP-FYQKQGGHYF----PKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 310.071 bits (793), Expect = 2.641e-100
Identity = 175/357 (49.02%), Postives = 225/357 (63.03%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGM 1137
            S  AA    RN C+          ++ PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +K GG Y+    PK+     + E +E CNILK EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WRSRF+EY  YR ++ DY+ RGA + +APKP  ++E + +D+ I      +K    G +VTTEFEP FDAADF+RAGRDIF Q+S VTN  GIEWMRRHLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW I+  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +GM
Sbjct:   38 STQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWP-FYQKQGGHYF----PKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLA-PDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGM 388          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 126.716 bits (317), Expect = 1.557e-33
Identity = 62/128 (48.44%), Postives = 86/128 (67.19%), Query Frame = 1
Query:  289 FMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDI 672
            F +K GG Y+    PK+     + E +E CNILK EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WRSRF+EY  YR ++ DY+ RGA + +APKP  ++E + +D+ I
Sbjct:   33 FYQKQGGHYF----PKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPI 156          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 46.2098 bits (108), Expect = 6.404e-6
Identity = 23/52 (44.23%), Postives = 29/52 (55.77%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVP 237
            S  AA    RN C+          ++ PV S+NEWDPLEEVIVG  ++  VP
Sbjct:   38 STQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVP 89          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 348.591 bits (893), Expect = 4.818e-115
Identity = 180/364 (49.45%), Postives = 243/364 (66.76%), Query Frame = 1
Query:  163 PVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYF 1239
            PV + NEWDPLEEVIVG  ++  VP    E  A   E+    F ++YGG+ +    PKE     + E +E CNIL+ EGVTV  P P+D   EY TP F S G+  A PRDI++VVG+EI+E  M WR+RF+EY  YRPL+ +Y++RGA + +APKP  +++ + +D+ I      +K    G +VTTEFEP FDAADF+RAG DIFVQ+S VTN  GIEWMRRHL+    ++H+++F DP  MHIDATF  + PG ++ NP+      +  KKAGW +V  P P    +    MS KWLSMNVL+LD+KRV+V+  E  + KMFES+G++ +KV   H  ++GGG HCWT+DVRR+GTL++YF
Sbjct:   64 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWP-FYQQYGGQTF----PKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPT-YKIHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 212.616 bits (540), Expect = 1.886e-64
Identity = 119/263 (45.25%), Postives = 157/263 (59.70%), Query Frame = 1
Query:   55 LPLNSVYKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLA 828
            LPL++  ++  PAA                      PV + NEWDPLEEVIVG  ++  VP P+                 KYGG+ +    PKE     + E +E CNIL+ EGVTV  P P+D   EY TP F S G+  A PRDI++VVG+EI+E  M WR+RF+EY  YRPL+ +Y++RGA + +APKP  +++ + +D+ I      +K    G +VTTEFEP FDAADF+RAG DIFVQ+S VTN  GIEWMRRHL+
Sbjct:   47 LPLSAHEQVPEPAAE-------------------ECPVCAHNEWDPLEEVIVGRAENACVP-PF-------------TVEVKYGGQTF----PKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLS 272          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 188.734 bits (478), Expect = 1.180e-55
Identity = 108/248 (43.55%), Postives = 146/248 (58.87%), Query Frame = 1
Query:   55 LPLNSVYKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSH 783
            LPL++  ++  PAA                      PV + NEWDPLEEVIVG  ++  VP   P T            +K+YGG+ +    PKE     + E +E CNIL+ EGVTV  P P+D   EY TP F S G+  A PRDI++VVG+EI+E  M WR+RF+EY  YRPL+ +Y++RGA + +APKP  +++ + +D+ I      +K    G +VTTEFEP FDAADF+RAG DIFVQ+S 
Sbjct:   47 LPLSAHEQVPEPAAE-------------------ECPVCAHNEWDPLEEVIVGRAENACVP---PFTVE----------VKQYGGQTF----PKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQ 258          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 352.443 bits (903), Expect = 1.656e-116
Identity = 186/391 (47.57%), Postives = 252/391 (64.45%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYF 1239
            S  AA +  + C +       T  +  PV S+NEWDPLEEVIVG P++  VP    E  A   E+    F +K+GG+ +    P E      +E +E CN+L+ EGV V  P  +D   +Y+TP F+S G+  A PRDI+LVVG+EI+E  M WR+RF+EY  YRPL+ DY++RGA + +APKP  ++E + +D+ I      +K   +G +VTTEFEP FDAADFMRAGRDIF Q+S VTN  GIEWMRRHLA    ++H+++F DP  MHIDATF  + PG ++ NP+      +  KKAGW +V  P P    +    MS KWLSMNVL+LD+KRV+V+  E  + KMFE +G+  IKV+  H  ++GGG HCWT D+RR+GTL++YF
Sbjct:   26 STQAAAVSEKPCAADEKVSD-TAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWP-FYQKHGGQSF----PVEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLA-PDYKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 409          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 352.058 bits (902), Expect = 2.492e-116
Identity = 186/391 (47.57%), Postives = 252/391 (64.45%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYF 1239
            S  AA +  + C +       T  +  PV S+NEWDPLEEVIVG P++  VP    E  A   E+    F +K+GG+ +    P E      +E +E CN+L+ EGV V  P  +D   +Y+TP F+S G+  A PRDI+LVVG+EI+E  M WR+RF+EY  YRPL+ DY++RGA + +APKP  ++E + +D+ I      +K   +G +VTTEFEP FDAADFMRAGRDIF Q+S VTN  GIEWMRRHLA    ++H+++F DP  MHIDATF  + PG ++ NP+      +  KKAGW +V  P P    +    MS KWLSMNVL+LD+KRV+V+  E  + KMFE +G+  IKV+  H  ++GGG HCWT D+RR+GTL++YF
Sbjct:   38 STQAAAVSEKPCAADEKVSD-TAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWP-FYQKHGGQSF----PVEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLA-PDYKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 359.762 bits (922), Expect = 2.321e-119
Identity = 193/392 (49.23%), Postives = 251/392 (64.03%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFD 1242
            S  AA    RN C+          ++ PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +K GG Y+    PK+     + E +E CNIL  EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WRSRF+EY  YR ++ DY+ RGA + +APKP  ++E + +++ I      +K    G +VTTEFEP FDAADF+RAGRDIF Q+S VTN  GIEWMRRHLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW IV  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +G+  IKV+  +  ++GGG HCWT DVRR+GTL++YFD
Sbjct:   38 STQAATASSRNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWP-FYQKNGGLYF----PKDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 359.762 bits (922), Expect = 2.321e-119
Identity = 193/392 (49.23%), Postives = 251/392 (64.03%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFD 1242
            S  AA    RN C+          ++ PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +K GG Y+    PK+     + E +E CNIL  EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WRSRF+EY  YR ++ DY+ RGA + +APKP  ++E + +++ I      +K    G +VTTEFEP FDAADF+RAGRDIF Q+S VTN  GIEWMRRHLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW IV  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +G+  IKV+  +  ++GGG HCWT DVRR+GTL++YFD
Sbjct:   38 STQAATASSRNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWP-FYQKNGGLYF----PKDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q2HJ74|GATM_BOVIN (Glycine amidinotransferase, mitochondrial OS=Bos taurus OX=9913 GN=GATM PE=2 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 3.136e-120
Identity = 194/394 (49.24%), Postives = 254/394 (64.47%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTEN--FMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFD 1242
            S  AA    RN C+          ++ PV S+NEWDPLEEVIVG  ++  VP   P T         ++  F +KYGG Y+    PK+     + E +E CNILK EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WR+RF+EY  YR ++ DY++RGA + +APKP  ++E + +D+ I      +K    G +VTTEFEP FDAADF+RAGRDIFVQ+S VTN  GIEWMR+HLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW IV  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +G+  IKV   +  ++GGG HCWT DVRR+GTL++YFD
Sbjct:   38 STQAATASSRNSCAADDKATDPLPKDCPVSSFNEWDPLEEVIVGRAENACVP---PFTVEVKANTYDKHWPFYQKYGGSYF----PKDHLQKAVAEIEEMCNILKMEGVTVRRPDPIDWSLKYKTPDFESTGLYGAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRTIIKDYFRRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFVQRSQVTNYMGIEWMRKHLAPD-YRVHIVSFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVSIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|P50441|GATM_PIG (Glycine amidinotransferase, mitochondrial OS=Sus scrofa OX=9823 GN=GATM PE=1 SV=2)

HSP 1 Score: 359.762 bits (922), Expect = 1.442e-118
Identity = 192/392 (48.98%), Postives = 252/392 (64.29%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFD 1242
            S  AA     N C+          ++ PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +KYGG Y+    PK+     + E +E CNILK EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WR+RF+EY  YR ++ DY++RGA + +APKP  ++E + +D+ I      +K    G +VTTEFEP FDAADF+RAGRDIF Q+S VTN  GIEWMR+HLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW IV  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +G+  IK+   +  ++GGG HCWT DVRR+GTL++YFD
Sbjct:   38 STQAATASSGNSCAADDKATDPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWP-FYQKYGGHYF----PKDHLKKAVAEIEEMCNILKMEGVTVRRPDPIDWSVKYKTPDFESTGLYGAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRSIIKDYFRRGAKWTTAPKPTMADELYDQDYPIYSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYMGIEWMRKHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPIPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKISIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|P50442|GATM_RAT (Glycine amidinotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gatm PE=1 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 1.606e-118
Identity = 193/392 (49.23%), Postives = 251/392 (64.03%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFD 1242
            S  AA    +N C+          ++ PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +K GG Y+    PK+     + E +E CNIL  EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WRSRF+EY  YR ++ DY+ RGA + +APKP  ++E + +D+ I      +K    G +VTTEFEP FDAADF+RAGRDIF Q+S VTN  GIEWMRRHLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW IV  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +G+  IKV+  +  ++GGG HCWT DVRR+GTL++YFD
Sbjct:   38 STQAATASSQNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWP-FYQKNGGLYF----PKDHLKKAVAEVEEMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9D964|GATM_MOUSE (Glycine amidinotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Gatm PE=1 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 1.624e-118
Identity = 193/392 (49.23%), Postives = 251/392 (64.03%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFD 1242
            S  AA    RN C+          ++ PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +K GG Y+    PK+     + E +E CNIL  EGVTV  P P+D   +Y+TP F+S GL  A PRDI++VVG+EI+E  M WRSRF+EY  YR ++ DY+ RGA + +APKP  ++E + +++ I      +K    G +VTTEFEP FDAADF+RAGRDIF Q+S VTN  GIEWMRRHLA    R+H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW IV  P P    D    MS KWLSMNVL+LD+KRV+V+  EV + KMFE +G+  IKV+  +  ++GGG HCWT DVRR+GTL++YFD
Sbjct:   38 STQAATASSRNSCAAEDKATHPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWP-FYQKNGGLYF----PKDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9IAJ6|GATM_XENLA (Glycine amidinotransferase, mitochondrial OS=Xenopus laevis OX=8355 GN=gatm PE=2 SV=2)

HSP 1 Score: 355.14 bits (910), Expect = 1.148e-116
Identity = 186/391 (47.57%), Postives = 254/391 (64.96%), Query Frame = 1
Query:   82 SAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYF 1239
            S  AA +  + C +     + T  +  PV S+NEWDPLEEVIVG P++  VP    E  A   E+    F +K+GG+ +    P +     ++E +E C +LK EGV V  P  +D   +Y+TP F+S G+  A PRDI+LVVG+EI+E  M WR+RF+EY  YRPL+ DY++RGA + +APKP  ++E + +D+ I      +K   +G +VTTEFEP FDAADFMRAGRDIF Q+S VTN  GIEWMRRHLA    ++H+++F DP  MHIDATF  + PG ++ NP+      +  KKAGW +V  P P    +    MS KWLSMNVL+LD+KRV+V+  E  +HKMFE +G+  IKV+  H  ++GGG HCWT D+RR+GTL++YF
Sbjct:   38 STQAAAVSEKPCAADEKV-RDTAAQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWP-FYQKHGGQSF----PVDHVKKAIEEIEEMCKVLKHEGVIVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLA-PDYKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIHKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A1S6KMF4 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 3.849e-147
Identity = 216/419 (51.55%), Postives = 284/419 (67.78%), Query Frame = 1
Query:   31 MLSKFNRIL----PLNSVYKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDF---DISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEK 1266
            ML+K  R L     +N V K+SA          CS +    P NK++SPVW+WNEWDPLEE+++G+PD    P   PE  AC  E    +F+ K+ GKYW D++  E +  +L EHK F  IL+GEGV VVHP P+D  K   TP F + G+D A PRD +L+VG+E++E+TMTWRSR++E++CY+ L+ DYW RGA + +APKP+C E  FK+++   + S   FDE   + TE EP+FDAADF+R GRDIF   S V+N  GIEW+RRHLA KGIR+H +NF DP  MHID T FT +PG  I  PE        LKKAGW +V  P P    +    +S +WLS+NV++LD+ RVLVEK E+G+ K+FE  G+ P+KV F HCF++GGG+HCWTSDVRR+G L+NYFDWPQE+LEK
Sbjct:    1 MLTKIARSLHDQISINVVNKLSA--------RLCSYT----PGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISEN-KFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEK 406          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A3Q0KNU0 (Glycine amidinotransferase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 5.932e-132
Identity = 193/402 (48.01%), Postives = 264/402 (65.67%), Query Frame = 1
Query:   73 YKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKD---FDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKV 1269
            Y  +  +  IK  +    +  +   NK  SPV SWNEWDPLEE+IVG P++  VPY  PE   C       NF  + GGKYW+D++PKE W  + K+ ++F  IL+ EG+ VV P P+D +K Y+    ++ G   A PRD +L+VGDEI+E TMTWRSR++EYL YRPL L+YWK+GA +  APKP    +  + +     +S     + G VTTE EP FDAADF+RAGRDIF Q+S VTN +GIEW+RRHL  +GI++H L+F DP  MHIDATF  VKPG  ++NP+      D ++KAGW+IV  P P  + D    +   WLSMNVL+LDQ RV+VE  E G+ +M++S+G++PI V F +  ++GGG HCWT D+RR+G LE+YFDW +  + ++
Sbjct:   16 YVQNVTSVPIKTTSSLYSTDVELKQNKLKSPVNSWNEWDPLEEIIVGTPEYATVPYLLPEVKTC-AASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKILELEGIKVVRPDPVDHRKSYKLLDIETQGFYAAMPRDFLLIVGDEIIEATMTWRSRYFEYLAYRPLALNYWKQGAKWTIAPKPTNFSKLIRDEPINVGLSDEHNPDYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLSFVDPRPMHIDATFTLVKPGIAVQNPDRPCHQFDIIRKAGWQIVNAPYPLMKKDHEMWLGSNWLSMNVLMLDQNRVVVESEETGIQEMYKSMGIKPINVKFKYANSIGGGFHCWTCDIRRQGKLESYFDWSKGEIPRI 416          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A095AQE5 (Glycine amidinotransferase, mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_04855 PE=4 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 1.214e-131
Identity = 189/393 (48.09%), Postives = 262/393 (66.67%), Query Frame = 1
Query:  100 IKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKD---FDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKV 1269
            IK  +    +  +   NK  SPV SWNEWDPLEE+IVG P++  VP+  PE   C       NF  + GGKYW+D++PKE W  + K+ ++F  +L+ EG+ VV P P+D +K Y+   F++ G   A PRD +L+VGDEI+E TMTWRSR++EYL YRPL L+YWK+GA +   PKP    +  + +     +S     + G VTTE EP FDAADF+RAGRDIF Q+S VTN +GIEW+RRHL  +GI++H L+F DP  MHIDATF  VKPG  I+NP+      D+++KAGW+++  P+P  + D    +   WLSMNVL+LDQ RV+VE  E G+ +M++SIG++PI V F +  ++GGG HCWT D+RR+  LE+YFDW +  + ++
Sbjct:   25 IKTVSSFYSTDVEPKQNKLTSPVNSWNEWDPLEEIIVGTPEYATVPHLLPEVKTC-AASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKMLELEGIKVVRPDPVDHRKSYKLLDFETQGFYAAMPRDFLLIVGDEIIEATMTWRSRYFEYLAYRPLALNYWKQGAKWTIGPKPTNFSKLIRDEPINVGLSDEHNPDYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLSFVDPRPMHIDATFTLVKPGIAIQNPDRPCHQVDFIRKAGWQVINAPQPLMKKDHEMWLGSNWLSMNVLMLDQNRVIVESEETGIQEMYKSIGIKPINVKFKYANSIGGGFHCWTCDIRRQSKLESYFDWSKGEIPRI 416          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: Q5DBC6 (SJCHGC09313 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 2.030e-131
Identity = 190/365 (52.05%), Postives = 247/365 (67.67%), Query Frame = 1
Query:  160 SPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKD---FDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDW 1245
            SPV SWNEWD LEE+IVG P++ VVP+  PE   C       NF  + GGKYW+D++PKE W  + K+ ++F  IL+ EG+ VV P P+D K  Y+   F++ G   A PRD +L+VGDE++E TMTWRSR++E+L YRPL L+YW+ GA +  APKP    +  K +    DI+       G VTTE EP FDAADF+RAGRDIF Q+S VTN +GIEW+RRHL  +GI++H L F DP  MHIDATF  VKPG  I+NPE     AD L+KAGWKI+  P+P  + D    +   WLSMNVL+LD  RV+VE  E GM ++++S+G+QPI V   H  ++GGG HCWT D+RR+  LE+YFDW
Sbjct:   28 SPVNSWNEWDSLEEIIVGTPEYSVVPHLLPEVKPCVAS-AKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKILELEGIKVVRPVPIDHKNSYKILDFETQGFYAAMPRDFLLIVGDEMIEATMTWRSRYFEFLAYRPLTLNYWRHGAKWTIAPKPTNFSKLIKDNPINGDIANKSSSYYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLTFTDPRPMHIDATFTLVKPGIAIQNPERPCHQADILRKAGWKIIDAPEPLIKKDHEMWLGSNWLSMNVLMLDPNRVIVESEETGMQELYKSLGIQPIPVKLRHANSIGGGFHCWTCDIRRRSKLESYFDW 391          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: A0A430QEY0 (Glycine amidinotransferase (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0008220 PE=4 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 3.798e-131
Identity = 188/393 (47.84%), Postives = 262/393 (66.67%), Query Frame = 1
Query:  100 IKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKD---FDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKV 1269
            IK  +    +  +   NK  SPV SWNEWDPLEE+IVG P++  VP+  PE   C       NF  + GGKYW+D++PKE W  + K+ ++F  +L+ EG+ VV P P+D +K Y+   F++ G   A PRD +L+VGDEI+E TMTWRSR++EYL YRPL L+YW++GA +   PKP    +  + +     +S     + G VTTE EP FDAADF+RAGRDIF Q+S VTN +GIEW+RRHL  +GI++H L+F DP  MHIDATF  VKPG  I+NP+      D+++KAGW+++  P+P  + D    +   WLSMNVL+LDQ RV+VE  E G+ +M++SIG++PI V F +  ++GGG HCWT D+RR+  LE+YFDW +  + ++
Sbjct:   27 IKTVSSLYSTDVELKQNKLKSPVNSWNEWDPLEEIIVGTPEYATVPHLLPEVKTC-AASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKMLELEGIKVVRPDPVDHRKSYKLLDFETQGFYAAMPRDFLLIVGDEIIEATMTWRSRYFEYLAYRPLALNYWRQGAKWTIGPKPTNFSKLIRDEPINVGLSDEHNPDYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLSFVDPRPMHIDATFTLVKPGIAIQNPDRPCHQVDFIRKAGWQVIDAPQPLMKKDHEMWLGSNWLSMNVLMLDQNRVIVESEETGIQEMYKSIGIKPINVKFKYANSIGGGFHCWTCDIRRQSKLESYFDWSKGEIPRI 418          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Cavefish
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:103044592])

HSP 1 Score: 348.977 bits (894), Expect = 2.235e-115
Identity = 181/364 (49.73%), Postives = 245/364 (67.31%), Query Frame = 1
Query:  163 PVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYF 1239
            PV ++NEWDPLEEVIVG  ++  VP    E  A   E+    F +KYGG+ +    P+E     + E +E CNIL+ EGVTV  P P+D   EY+TP F S G+  A PRDI++VVG+EI+E  M WR+RF+EY  YRPL+ +Y++RGA + +APKP  ++E + +++ I      +K    G +VTTE EP FDAADF+RAG D+FVQ+S VTN  GIEWMRRHLA    ++H+++F DP  MHIDATF  + PG ++ NP+      +  KKAGW +VK P P    D    MS KWLSMNVL+LD+KRV+V+  E  + KMFE++G++ IKV   H  ++GGG HCWT+DVRR+GTL++YF
Sbjct:   57 PVCAYNEWDPLEEVIVGRAENARVPPFTVEVKANTYEKYWP-FYQKYGGQTF----PEEHLKKAIAEIEEMCNILRHEGVTVQRPEPIDWSVEYKTPDFTSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGAKWTTAPKPTMADELYDQEYPIRTVEDRHKLAAEGKFVTTEHEPCFDAADFIRAGTDLFVQRSQVTNFLGIEWMRRHLAPH-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFENLGIKTIKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 414          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO35968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK04])

HSP 1 Score: 340.887 bits (873), Expect = 1.503e-112
Identity = 186/370 (50.27%), Postives = 234/370 (63.24%), Query Frame = 1
Query:  145 TNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYF 1239
            T   + PV S NEWD LEEVIVG  +   VP   PE  A    +    F + YGG+ +    P E       E +EFCNIL  EGVTV  P P+D  +  +TP F+S GL  A PRDI+LVVGDEI+E+ M WRSRF+EY  YRPL+ +Y++RGA + +APKP  S+E +  D+ I      +K    G +VTTEFEP FDAADFMRAGRDIFVQ+S VTN  GIEWM+RHL  +  R+H L+F+DP  MHIDATF  + PG ++ NP+      D  KKAGW +V+ P+P         MS KWLSMNVL+LD  RV+ +K E    KMFE +G+ PI V      ++GGG HCWT DVRR+G LE+Y 
Sbjct:   65 TEIADCPVGSHNEWDLLEEVIVGNVEGATVPKFTPEVKANTSHK-NWKFFELYGGRPF----PAEHLKKAATEIEEFCNILHHEGVTVRRPEPIDFSEVCKTPDFESSGLYSAMPRDILLVVGDEIIESPMAWRSRFFEYRAYRPLIKEYFRRGARWTTAPKPQMSDELYDLDYPIRSVEDRHKLSSEGKFVTTEFEPCFDAADFMRAGRDIFVQRSQVTNYMGIEWMKRHLGNQ-YRIHTLSFDDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDMFKKAGWTVVQPPEPLIPDSHPLWMSSKWLSMNVLMLDPTRVVCDKNETTTIKMFEKLGITPIPVSIRFANSLGGGFHCWTCDVRRRGKLESYL 428          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Medaka
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:101156236])

HSP 1 Score: 353.214 bits (905), Expect = 7.063e-117
Identity = 183/367 (49.86%), Postives = 246/367 (67.03%), Query Frame = 1
Query:  154 RNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISG----NKFDELG-YVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYF 1239
            +  PV S+NEWDPLEEVIVG  ++  VP    E  A   E+    F +K+GG+ +    P +     + E +E CNIL+ EGV V  P P+D   EY+TP F S G+  A PRDI++VVG+EI+E  M WR+RF+EY  YRPL+ +Y+++GA + +APKP  ++E + +D+ I      +K    G +VTTE EP FDAADF+RAGRD+FVQ+S VTN  GIEWMRRHLA    ++H+++F DP  MHIDATF  + PG ++ NP+      D  KKAGW +VK P P    D    MS KWLSMNVL+LD+KRV+V+  E  + KMFES+G+Q IKV+  H  ++GGG HCWT+DVRR+GTL++YF
Sbjct:   62 QECPVCSYNEWDPLEEVIVGRAENAHVPPFTVEVKANTYEKYWP-FYQKHGGQSF----PADHLKKAVAEIEEMCNILRHEGVVVRRPEPIDWSLEYKTPDFSSTGMYAAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRKGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAQGKFVTTEHEPCFDAADFIRAGRDLFVQRSQVTNYMGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQVDMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIQTIKVNIRHANSLGGGFHCWTTDVRRRGTLQSYF 422          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051953.1 (SMESG000051953.1)

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 416/417 (99.76%), Postives = 417/417 (100.00%), Query Frame = 1
Query:   31 MLSKFNRILPLNSVYKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKVSLDK 1281
            MLSKFNRILPLNS+YKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKVSLDK
Sbjct:    1 MLSKFNRILPLNSLYKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKVSLDK 417          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051964.1 (SMESG000051964.1)

HSP 1 Score: 440.654 bits (1132), Expect = 2.141e-151
Identity = 217/419 (51.79%), Postives = 285/419 (68.02%), Query Frame = 1
Query:   31 MLSKFNRIL----PLNSVYKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDF---DISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEK 1266
            ML+K  R L     +N V K+SA          CS +    P NK++SPVW+WNEWDPLEE+++G+PD    P   PE  AC  E    +F+ K+ GKYW D++  E +  +L EHK F  IL+GEGV VVHP P+D  K   TP F + G+D A PRD +L+VG+E++E+TMTWRSR++E++CY+ L+ DYW RGA + +APKP+C E  FK+++   + S   FDE   + TE EP+FDAADF+R GRDIF   S V+N  GIEW+RRHLA KGIR+H +NF DP  MHID T FT +PG  I  PE        LKKAGW +V  P P    +    +S +WLS+NV++LD+KRVLVEK E+G+ K+FE  G+ P+KV F HCF++GGG+HCWTSDVRR+G L+NYFDWPQE+LEK
Sbjct:    1 MLTKIARSLHDQISINVVNKLSA--------RLCSYT----PGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISEN-KFDFLLKHKGKYWKDVIEPEHYKLMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDEKRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEK 406          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000068402.1 (SMESG000068402.1)

HSP 1 Score: 380.178 bits (975), Expect = 1.178e-127
Identity = 193/416 (46.39%), Postives = 262/416 (62.98%), Query Frame = 1
Query:   49 RILPLNSVYKISAPAANIKYRNCCSKSSTDKP-TN-------KRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKVS 1272
            + L +N    + +     +   C S S  + P TN       K+ SPVWSWNEWD LEE +VG+PD+ VVP   PE  AC    L + F+   GGKYWSDI+P   W  +  E +EF  +L+GEGV VV P   D  K +    F S G+  A PRD++LVVGDE++E+TMTW+SR++E++ YR L+  Y+ +GA +  APKP+  +E  +KD+D  G   ++L  +TTE E  FDAADF R G+DIF Q+S VTN+  I WMRRHLA +GIR+H LNF D + MH+DAT   VKPG  ++NP+      D     GW+ V  P P   S+    MS  +L+MN L++D  RV +EK E G  K+FESIG++ I V   HCF++GGG HCWTSD++R+GTLENYF+W +  L+K +
Sbjct:    5 KCLFVNCFSLLKSKPNGYQLTRCMSNSLANNPFTNPTALAERKKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWD-FLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDYDFYGT--NKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPL-LSEERLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKYT 416          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000043142.1 (SMESG000043142.1)

HSP 1 Score: 372.089 bits (954), Expect = 1.426e-124
Identity = 184/375 (49.07%), Postives = 248/375 (66.13%), Query Frame = 1
Query:  151 KRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGE-RLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEKVS 1272
            K+ SPVW+WNEWDPLEEV+VGVP++  +P+P  E AA FG  RL   F +K+GGK +S++M +E+W  +  E KE   +L+GEGV VV P  +D  +++ TP F S GL  A PRD +L+VGDEI+E+ M WR R++EY  YRPL+  Y+  GA + SAPK    +  +  +FD++  K     YVTTE EP FDAADF R GRDIF Q+SHVTN   I+W+RRHLA  G+R+H + F+  Y+MHID  FF VKPG  +    +     D LKK+ W IV  PK   R + Y+ M+Y  L  N+L +D +RVLVEK E  M K  + IG +PI V       +GGG HCWT+D+RR+G LE+YF+WP E+LE+++
Sbjct:   38 KQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLP--FFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEK--PYVYVTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRQGKLESYFEWPDEILERLT 408          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051929.1 (SMESG000051929.1)

HSP 1 Score: 342.428 bits (877), Expect = 2.392e-113
Identity = 161/363 (44.35%), Postives = 241/363 (66.39%), Query Frame = 1
Query:  175 WNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLE 1263
            WNEWDPLEE++VG+PD+ V+P    ET  C    +   F K+  GKYWSD++ +  W+ +LKEHK F + LK EGV VV+P   + + +Y+    ++ G+  A PRDI+L +G+EI+E  MTWRSR++E   YR L++DYWKRGA++ +APKP     ++   F+ S NK D + +VT+E EP FDAADF+RAG DIF Q+S VTN  GI+W+R H+  K IR+  L+F+DP  MHIDATF  +KPG ++ NP+           AGWK++ G    + +     +S  W++MNVL++++ +V+V+  ++ M  +F ++ ++ I V F HC ++GGG HCW+ D+RRKG L++YF+W   V++
Sbjct:   25 WNEWDPLEEIVVGIPDNAVIPPITIETKPCIHNSMWP-FFKENSGKYWSDVLGQRFWSALLKEHKSFSDALKNEGVKVVNPETQNFENKYKIRDHETTGMYCAMPRDILLPIGNEIIEAPMTWRSRYFEINSYRKLIIDYWKRGASWVAAPKP-----TYNNLFEES-NKSDLISFVTSEAEPTFDAADFVRAGTDIFAQRSQVTNNLGIQWVRNHVKSKNIRVWTLSFDDPRPMHIDATFMPLKPGIILSNPDRKCHQIQNFLDAGWKVIYGIPRTNNNGHPYYLSSPWITMNVLMVNENKVIVDADDLEMQNLFRTLNIEVIPVKFRHCNSIGGGFHCWSVDIRRKGDLQSYFNWKSSVID 380          
The following BLAST results are available for this feature:
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GATM1.362e-11649.23glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM2.641e-10049.02glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM1.557e-3348.44glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM6.404e-644.23glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gatm4.818e-11549.45glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm1.886e-6445.25glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm1.180e-5543.55glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2221.656e-11647.57transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
tmem2222.492e-11647.57transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gatm2.321e-11949.23glycine amidinotransferase (L-arginine:glycine ami... [more]
Gatm2.321e-11949.23glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HJ74|GATM_BOVIN3.136e-12049.24Glycine amidinotransferase, mitochondrial OS=Bos t... [more]
sp|P50441|GATM_PIG1.442e-11848.98Glycine amidinotransferase, mitochondrial OS=Sus s... [more]
sp|P50442|GATM_RAT1.606e-11849.23Glycine amidinotransferase, mitochondrial OS=Rattu... [more]
sp|Q9D964|GATM_MOUSE1.624e-11849.23Glycine amidinotransferase, mitochondrial OS=Mus m... [more]
sp|Q9IAJ6|GATM_XENLA1.148e-11647.57Glycine amidinotransferase, mitochondrial OS=Xenop... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMF43.849e-14751.55Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A3Q0KNU05.932e-13248.01Glycine amidinotransferase OS=Schistosoma mansoni ... [more]
A0A095AQE51.214e-13148.09Glycine amidinotransferase, mitochondrial OS=Schis... [more]
Q5DBC62.030e-13152.05SJCHGC09313 protein OS=Schistosoma japonicum OX=61... [more]
A0A430QEY03.798e-13147.84Glycine amidinotransferase (Fragment) OS=Schistoso... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm2.235e-11549.73glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO359681.503e-11250.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm7.063e-11749.86glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051953.10.000e+099.76SMESG000051953.1[more]
SMESG000051964.12.141e-15151.79SMESG000051964.1[more]
SMESG000068402.11.178e-12746.39SMESG000068402.1[more]
SMESG000043142.11.426e-12449.07SMESG000043142.1[more]
SMESG000051929.12.392e-11344.35SMESG000051929.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009513 ID=SMED30009513|Name=Glycine amidinotransferase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1650bp
AAATCTATATAAATCTTATATGATCCTTTGATGCTTTCAAAATTCAACCG
AATCCTTCCATTAAACAGTGTTTATAAAATTAGCGCTCCAGCAGCCAACA
TCAAATATAGAAATTGTTGTAGCAAATCCTCAACAGATAAACCAACAAAT
AAGCGTAACAGTCCCGTATGGAGCTGGAATGAATGGGATCCTTTGGAAGA
AGTAATTGTTGGTGTACCTGATCATGGTGTAGTTCCATATCCTTATCCAG
AAACAGCGGCATGCTTTGGAGAACGTTTAACAGAAAACTTTATGAAAAAA
TATGGAGGAAAATACTGGAGTGACATCATGCCTAAAGAAGTTTGGAATAA
CGTTTTGAAGGAACATAAAGAATTCTGTAACATCCTAAAAGGCGAAGGTG
TGACTGTGGTTCATCCAACACCAATGGATATGAAAAAAGAATACGAAACT
CCATATTTCAAATCTGTCGGTTTGGATGTTGCATTTCCAAGAGATATAAT
TCTCGTAGTTGGCGATGAAATTATGGAAACAACGATGACTTGGAGGTCAA
GATTTTGGGAATATCTTTGCTACAGACCATTGATGCTAGATTATTGGAAA
CGGGGAGCAAATTTTCAATCAGCACCAAAACCAGTGTGTAGCGAAGAAAG
TTTTAAAAAGGATTTTGACATTTCAGGCAATAAATTCGATGAGTTGGGAT
ATGTAACAACTGAATTCGAACCGATGTTTGATGCCGCAGATTTCATGAGG
GCTGGCCGAGATATTTTTGTTCAACAAAGTCACGTAACAAATGCCACTGG
AATTGAATGGATGCGTCGCCATTTAGCTGAAAAAGGAATTCGGTTACACT
TGTTGAATTTCAATGATCCATATGCCATGCATATCGATGCTACATTTTTC
ACAGTGAAACCCGGATACTTAATAGAGAATCCTGAAGTCATAAATCCGTA
TGCTGATTATTTGAAGAAGGCCGGTTGGAAGATTGTGAAGGGTCCAAAAC
CAGCAGATAGATCAGACATGTATGAAGGCATGAGTTACAAGTGGCTATCT
ATGAACGTTTTAGTTCTTGATCAAAAACGAGTGTTAGTTGAAAAGCGAGA
GGTTGGAATGCACAAAATGTTTGAGTCAATCGGCATGCAACCGATCAAAG
TTGATTTCGGACATTGTTTCGCTGTTGGCGGAGGGTTGCATTGTTGGACT
TCCGATGTTCGAAGAAAAGGAACTCTGGAAAATTACTTTGATTGGCCACA
AGAAGTATTGGAAAAAGTATCATTGGATAAATAAACAATAATAGTTGAAC
AAGCTCCTATACTATCAGCAAAATCGACACTATCGCTGATTATATATAAA
TATTTATATATTTTGATAAAATATGTATTTATAATTTTCTCTTATTTTAT
TGTTATGATAATTTATAAATTTGAATTTTACTTTGTTTGAATCATAAACA
TTTATTAAAGTTATTTGTCAAAAGATGAAAATTAAAACAAAACGTGTAAT
CATTGCTATCTTCAATCATGTAACAAGAAATAATTGCAATTTATCTTTAT
GTTGAGATAGCTCTTAGAACGCTTGGACCGATAGCGCTAAACTGTATGTT
TTATGCTTCATTTAATTACTTGAATGATAAAGGAAATTTGTTTATTGTAC
back to top

protein sequence of SMED30009513-orf-1

>SMED30009513-orf-1 ID=SMED30009513-orf-1|Name=SMED30009513-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MLSKFNRILPLNSVYKISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWN
EWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIM
PKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDV
AFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPK
PVCSEESFKKDFDISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQS
HVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIEN
PEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKR
VLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLE
NYFDWPQEVLEKVSLDK*
back to top
Aliases
The feature 'Glycine amidinotransferase, mitochondrial' has the following synonyms
Synonym
H.56.4h
AGAT-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR033195AmidinoTrfase
Vocabulary: molecular function
TermDefinition
GO:0015067amidinotransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.75.10.10coord: 47..407
e-value: 1.7E-99
score: 335.3
NoneNo IPR availableSUPERFAMILYSSF55909Penteincoord: 47..407
IPR033195Glycine/inosamine-phosphate amidinotransferasePANTHERPTHR10488GLYCINE AMIDINOTRANSFERASE, MITOCHONDRIALcoord: 36..407