intraflagellar transport protein 80 homolog

Overview
Nameintraflagellar transport protein 80 homolog
Smed IDSMED30009510
Length (bp)2373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of intraflagellar transport protein 80 homolog (SMED30009510) t-SNE clustered cells

Violin plots show distribution of expression levels for intraflagellar transport protein 80 homolog (SMED30009510) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of intraflagellar transport protein 80 homolog (SMED30009510) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for intraflagellar transport protein 80 homolog (SMED30009510) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009510

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009510h1SMcG0019331 SmedASXL_006384SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009510h1SMcG0019331 dd_Smed_v4_9110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009510h1SMcG0019331 dd_Smed_v4_9110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009510h1SMcG0019331 dd_Smed_v4_9110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009510h1SMcG0019331 dd_Smed_v4_9110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009510h1SMcG0019331 dd_Smed_v6_9110_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009510h1SMcG0019331 dd_Smed_v4_9110_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Human
Match: IFT80 (intraflagellar transport 80 [Source:HGNC Symbol;Acc:HGNC:29262])

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 372/764 (48.69%), Postives = 559/764 (73.17%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKR 2322
            MRLK++  KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E  ++++ P+  YP + HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG +K+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG  LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV     EW+NF V L   R + V NV  ++V+ LEFRDRV+K S  + +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DG ++ +Y+YEGR + SPK   ++ ++++A   S+SNDT+++RDK D+K+I LF++ +GKP GDGK L HK  I+E+ALDQ G   DRKIA IDKNRDL + SV+ +G+  + +KLGTMV+ + W+D    L  +   + ++W YPN  ++D+ +L +++ E+ +++F   P I +F GN VT R+ +GS++   + PY A+LH+  +++K  +A+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV+YI  IK +P KE++ A +LL SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FL++  + E NK +L Y      +WE+++  I E E  ++R
Sbjct:    1 MRLKISLLKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPIDFHWFPKS--LGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQIKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRPLYNSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQHWEWKNFQVTLTKRRAMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVSTSLQCYVFSTKNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIAFIDKNRDLCITSVKRFGKEEQIIKLGTMVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYVDRDILPKTLYERDASEFSKNPHIVSFVGNQVTIRRADGSLVHISITPYPAILHEYVSSSKWEDAVRLCRFVKEQTMWACLAAMAVANRDMTTAEIAYAAIGEIDKVQYINSIKNLPSKESKMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYLHYAEGLQIDWEKIKAKI-EMEITKER 761          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Human
Match: IFT80 (intraflagellar transport 80 [Source:HGNC Symbol;Acc:HGNC:29262])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 306/625 (48.96%), Postives = 459/625 (73.44%), Query Frame = 1
Query:  448 MLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKR 2322
            MLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG  LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV     EW+NF V L   R + V NV  ++V+ LEFRDRV+K S  + +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DG ++ +Y+YEGR + SPK   ++ ++++A   S+SNDT+++RDK D+K+I LF++ +GKP GDGK L HK  I+E+ALDQ G   DRKIA IDKNRDL + SV+ +G+  + +KLGTMV+ + W+D    L  +   + ++W YPN  ++D+ +L +++ E+ +++F   P I +F GN VT R+ +GS++   + PY A+LH+  +++K  +A+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV+YI  IK +P KE++ A +LL SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FL++  + E NK +L Y      +WE+++  I E E  ++R
Sbjct:    1 MLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRPLYNSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQHWEWKNFQVTLTKRRAMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVSTSLQCYVFSTKNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIAFIDKNRDLCITSVKRFGKEEQIIKLGTMVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYVDRDILPKTLYERDASEFSKNPHIVSFVGNQVTIRRADGSLVHISITPYPAILHEYVSSSKWEDAVRLCRFVKEQTMWACLAAMAVANRDMTTAEIAYAAIGEIDKVQYINSIKNLPSKESKMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYLHYAEGLQIDWEKIKAKI-EMEITKER 624          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Human
Match: IFT80 (intraflagellar transport 80 [Source:HGNC Symbol;Acc:HGNC:29262])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 306/625 (48.96%), Postives = 459/625 (73.44%), Query Frame = 1
Query:  448 MLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKR 2322
            MLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG  LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV     EW+NF V L   R + V NV  ++V+ LEFRDRV+K S  + +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DG ++ +Y+YEGR + SPK   ++ ++++A   S+SNDT+++RDK D+K+I LF++ +GKP GDGK L HK  I+E+ALDQ G   DRKIA IDKNRDL + SV+ +G+  + +KLGTMV+ + W+D    L  +   + ++W YPN  ++D+ +L +++ E+ +++F   P I +F GN VT R+ +GS++   + PY A+LH+  +++K  +A+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV+YI  IK +P KE++ A +LL SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FL++  + E NK +L Y      +WE+++  I E E  ++R
Sbjct:    1 MLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRPLYNSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQHWEWKNFQVTLTKRRAMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVSTSLQCYVFSTKNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIAFIDKNRDLCITSVKRFGKEEQIIKLGTMVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYVDRDILPKTLYERDASEFSKNPHIVSFVGNQVTIRRADGSLVHISITPYPAILHEYVSSSKWEDAVRLCRFVKEQTMWACLAAMAVANRDMTTAEIAYAAIGEIDKVQYINSIKNLPSKESKMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYLHYAEGLQIDWEKIKAKI-EMEITKER 624          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Human
Match: AC079594.2 (TRIM59 and iFT80 readthrough)

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 298/614 (48.53%), Postives = 449/614 (73.13%), Query Frame = 1
Query:  454 RSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLI 2295
            R S +    PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG  LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV     EW+NF V L   R + V NV  ++V+ LEFRDRV+K S  + +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DG ++ +Y+YEGR + SPK   ++ ++++A   S+SNDT+++RDK D+K+I LF++ +GKP GDGK L HK  I+E+ALDQ G   DRKIA IDKNRDL + SV+ +G+  + +KLGTMV+ + W+D    L  +   + ++W YPN  ++D+ +L +++ E+ +++F   P I +F GN VT R+ +GS++   + PY A+LH+  +++K  +A+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV+YI  IK +P KE++ A +LL SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FL++  + E NK +L Y      +WE+++  I
Sbjct:  311 RMSCSWPGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRPLYNSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQHWEWKNFQVTLTKRRAMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVSTSLQCYVFSTKNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIAFIDKNRDLCITSVKRFGKEEQIIKLGTMVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYVDRDILPKTLYERDASEFSKNPHIVSFVGNQVTIRRADGSLVHISITPYPAILHEYVSSSKWEDAVRLCRFVKEQTMWACLAAMAVANRDMTTAEIAYAAIGEIDKVQYINSIKNLPSKESKMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYLHYAEGLQIDWEKIKAKI 924          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Human
Match: IFT80 (intraflagellar transport 80 [Source:HGNC Symbol;Acc:HGNC:29262])

HSP 1 Score: 211.46 bits (537), Expect = 2.194e-63
Identity = 93/180 (51.67%), Postives = 134/180 (74.44%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQAN 570
            MRLK++  KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E  ++++ P+  YP + HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG +K+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N
Sbjct:    1 MRLKISLLKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPIDFHWFPKS--LGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQIKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPN 178          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Celegans
Match: che-2 (CHE-2 protein [Source:UniProtKB/TrEMBL;Acc:G5EGF0])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 304/756 (40.21%), Postives = 483/756 (63.89%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXX-XXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLI 2295
            M+LKL+ +++  H ++   VGW   E + S ADDH+ L  N  T E  +++  PE+F+PT++H +PRS   T G ++  D+ A++++DGK   +SRNG++E  V+AH GA L  RW+ DG  L + GEDG VK+WSR+GMLRS LAQ    VY  AW   S  +LY +     IKSL+  V PI WKAH+G+IL  DW+  + LIV+GGED K+KVW+ +G IL+ S  HDYPIT+++W+ +G +FAVGS++ LRLCDK+GWS+SL+K   G +++L+WS D TQLA    +G V   H+ + RL +  F ++   + +I V    +E S E LE ++R+ K++  + YL+V TSS  YIYS++NWNTP +I+  E  V +I+Q EK+FL+ DG  + I+TYEGR L +         ++      ++NDTL VRD+ D+KV+H FD  +GK  GDG  L H+  I+EL ++Q G   DR +A  D+   +++  V+++G S+R VK+G++V  + ++D    L  ++  K+ +W  PN+AF D++LL +S+I+K     G  P +  F+GN++  RK +G ++   + P+   L  + + +K ++A+ LCRS+  + +W   A +A L K +   +IAYAAL D +KV  I  IK   +KE RQA  ++++G + DA+ +L ++GL FR++M+++++F W RALEL    +++L +V+ +R ++L +  + E +  FLK+++E   +W  + +LI
Sbjct:    1 MKLKLSASRKTRHTEMVCGVGWIGTEAILSAADDHVFLLTNTATNESQQILNMPETFFPTSLHIFPRSQ--TKGGQN--DVFAVSTSDGKINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGFGQILFNSSVHDYPITSISWNTDGTLFAVGSHNILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTYEEFEIVQTQKTVIEVRDVSSEVSRETLETKERISKIAILYKYLIVVTSSHIYIYSSKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEGRKLINLNPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGN-LKHEHDIVELTVNQCGPLNDRNVAFRDQIGAVHIAMVKTFGVSQRMVKIGSLVEQLVFNDVTNMLCGISEGKIAVWPLPNVAFHDRNLLQKSLIQKNIGSVGKFPQLANFAGNTIVIRKSDGCLLPTGILPFYGTLITMASQSKWDQAIRLCRSIGNDTMWATFAGLAVLHKNMIVMEIAYAALEDDEKVSLINEIKDKTDKETRQAMQVVLTGKLADADVLLERSGLSFRSLMLNIQMFKWKRALELGLKNKQWLEIVMGYREKYLKNCGQKETDPLFLKHMSEVEIDWVHIRELI 751          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Celegans
Match: che-2 (CHE-2 protein [Source:UniProtKB/TrEMBL;Acc:G5EGF0])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 304/756 (40.21%), Postives = 483/756 (63.89%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXX-XXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLI 2295
            M+LKL+ +++  H ++   VGW   E + S ADDH+ L  N  T E  +++  PE+F+PT++H +PRS   T G ++  D+ A++++DGK   +SRNG++E  V+AH GA L  RW+ DG  L + GEDG VK+WSR+GMLRS LAQ    VY  AW   S  +LY +     IKSL+  V PI WKAH+G+IL  DW+  + LIV+GGED K+KVW+ +G IL+ S  HDYPIT+++W+ +G +FAVGS++ LRLCDK+GWS+SL+K   G +++L+WS D TQLA    +G V   H+ + RL +  F ++   + +I V    +E S E LE ++R+ K++  + YL+V TSS  YIYS++NWNTP +I+  E  V +I+Q EK+FL+ DG  + I+TYEGR L +         ++      ++NDTL VRD+ D+KV+H FD  +GK  GDG  L H+  I+EL ++Q G   DR +A  D+   +++  V+++G S+R VK+G++V  + ++D    L  ++  K+ +W  PN+AF D++LL +S+I+K     G  P +  F+GN++  RK +G ++   + P+   L  + + +K ++A+ LCRS+  + +W   A +A L K +   +IAYAAL D +KV  I  IK   +KE RQA  ++++G + DA+ +L ++GL FR++M+++++F W RALEL    +++L +V+ +R ++L +  + E +  FLK+++E   +W  + +LI
Sbjct:    1 MKLKLSASRKTRHTEMVCGVGWIGTEAILSAADDHVFLLTNTATNESQQILNMPETFFPTSLHIFPRSQ--TKGGQN--DVFAVSTSDGKINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGFGQILFNSSVHDYPITSISWNTDGTLFAVGSHNILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTYEEFEIVQTQKTVIEVRDVSSEVSRETLETKERISKIAILYKYLIVVTSSHIYIYSSKNWNTPTMIEYNERTVNIIVQCEKIFLVSDGMTITIFTYEGRKLINLNPPGQVMALLDERKIDLANDTLVVRDRADNKVLHFFDPTTGKAQGDGN-LKHEHDIVELTVNQCGPLNDRNVAFRDQIGAVHIAMVKTFGVSQRMVKIGSLVEQLVFNDVTNMLCGISEGKIAVWPLPNVAFHDRNLLQKSLIQKNIGSVGKFPQLANFAGNTIVIRKSDGCLLPTGILPFYGTLITMASQSKWDQAIRLCRSIGNDTMWATFAGLAVLHKNMIVMEIAYAALEDDEKVSLINEIKDKTDKETRQAMQVVLTGKLADADVLLERSGLSFRSLMLNIQMFKWKRALELGLKNKQWLEIVMGYREKYLKNCGQKETDPLFLKHMSEVEIDWVHIRELI 751          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 65.4698 bits (158), Expect = 6.371e-11
Identity = 45/161 (27.95%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  319 NGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGML-RSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGI-LYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            N ++  ++E HT ++   ++SP G  L T   D  VK+W+ + M+   +L  + + V   AW  +S  ++  S  K L I  +  +      K H   +   +++  + L+VSG  D   ++W+   G+ + T  AH  P++AV+++ +G++ A GSYD L
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGL 236          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 65.4698 bits (158), Expect = 6.371e-11
Identity = 45/161 (27.95%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  319 NGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGML-RSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGI-LYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            N ++  ++E HT ++   ++SP G  L T   D  VK+W+ + M+   +L  + + V   AW  +S  ++  S  K L I  +  +      K H   +   +++  + L+VSG  D   ++W+   G+ + T  AH  P++AV+++ +G++ A GSYD L
Sbjct:   76 NYKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGL 236          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Celegans
Match: wdr-5.3 (WD repeat-containing protein wdr-5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q23256])

HSP 1 Score: 58.9214 bits (141), Expect = 8.771e-9
Identity = 50/178 (28.09%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  268 DIVALASTDGKYQFISRNGRIE--KSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLR-SSLAQNPVPVYSGAWGGNSDQILYTSGKQLV-IKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSV-AHDYPITAVAWSCNGNMFAVGSYD 786
            D VA  ++         NG     K++  HT +V VI++S  G  L TG  D  +KVW+   M    +LA + + +   +W  NS  I   S    V I  + +       + H   +    ++  + LI S G D   +VW+   G+    + AH  PIT+++++ +GN  A  SYD
Sbjct:  183 DPVAPTTSSSGITKKPENGEFSLVKTISGHTKSVSVIKFSYCGKYLGTGSADKQIKVWNTVDMTYLQTLASHQLGINDFSWSSNSQFIASASDDTTVKIFDVISGACLRTMRGHTNYVFCCSFNPQSSLIASAGFDETVRVWDFKTGLCVKCIPAHSDPITSISYNHDGNTMATSSYD 360          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Fly
Match: Oseg5 (gene:FBgn0032891 transcript:FBtr0290042)

HSP 1 Score: 457.603 bits (1176), Expect = 1.153e-149
Identity = 254/754 (33.69%), Postives = 427/754 (56.63%), Query Frame = 1
Query:   25 IKMRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYS---LDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLK-EARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAE--MMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSG-DGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSR--RSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQ-AEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELT----ATKQKYLPLVLAHRRRFLDSLSRLENNKNFL 2244
            I+   K+ E+ +       SCV WSS EE++  +DDH + KW++ + + V+V + P+ F PT+MHW       +SG    SD + + S DG++  ++++ R+E+S+ AH  A+   RWSPDG  L T GEDG++K+WSR+GMLRS++ QN   +    W  NS+ I++  G  + IK L AN K I W+AH+G++L++ WS+ + +I SGGED ++K+W++ G  L+TS A +Y IT+VA++   +   VG+++ L+LC  NGWSY+      P+ G I +L+WS D TQ      +G++I  +    +L   N        + IT+ ++   + + L+F  RVV     +G+L+VAT++  +IY+ +  NTP++ID + + RV  I   +K F+I+D  ++ +YTY GRL  +P+    QA+  ++     S+  D L++RD  D  V+HLFD   G     D   L  K  ++++A  ++G+  D+ +A ID NR+L++   R+    R     K+GT +  I W      L  V      IW  P     D ++++ + I   + +FG   TI++F  + +TFR   G+++   V  Y  +LH+     +  +AL +CR  +   LW  LAA+AT   ++  ++ AY+A   +DKV Y++ +K +    A Q AE  L+ G + +AE +L+    + +AV + LR+ +W RALE++      + + +P VL  RR++L +L R E +  +L
Sbjct:   13 IRNSEKVEESSKSTTNCPLSCVDWSSNEEIYFVSDDHQIFKWSDVSRDSVEVAKLPDDFVPTDMHWL-LLGGRSSGGGKGSDTLLICSNDGRFVILNKSARVERSISAHAAAISSGRWSPDGAGLLTAGEDGVIKIWSRSGMLRSTVVQNEESIRCARWAPNSNSIVFCQGGHISIKPLAANSKIIRWRAHDGLVLSLSWSTQSNIIASGGEDFRFKIWDAQGANLFTSAAEEYAITSVAFNPEKDYLLVGTFNLLKLCHSNGWSYNTARFSSPRVGSIFNLSWSADGTQATCGTSTGQLIVAYAIEQQLVSGNLKATSKSRKSITLKDIATGTQDILDFPQRVVSFGLGYGHLVVATTNQVHIYNEKYINTPIIIDGRNDTRV--IEVGKKYFMILDALSIWVYTYTGRLHLNPRYPGSQAQIPLLTWRSLSLGLDVLAIRDNSDPTVLHLFDLIPGASRQYDPHSLRAKQQLVQIAACRAGSPEDQFVAFIDSNRELFVSESRNLNSERIDEIYKIGTQLTAIMWASETNILVGVHDSCYSIWYCPGEGASDPTIIALTTITLDTTEFGKHITIESFEESVLTFRS-AGALLPVNVNMYCEILHRALLEGQWQQALKICRMGQHSSLWATLAAVATRKHQLQISEEAYSAALQIDKVSYLQHLKALTPSSAEQMAENSLMLGRMLEAETILLHGKKIEQAVGLALRMHNWRRALEISQKHKGEQPELVPRVLQERRKYLKALQREEWDPLYL 762          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 62.7734 bits (151), Expect = 4.227e-10
Identity = 45/166 (27.11%), Postives = 83/166 (50.00%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSG---KQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT AV  +++SP+G  L +   D ++K+W + +G    +++ + + +   AW  +SD  L  SG   K L +  L         K H   +   +++  + LIVSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   58 VKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAW--SSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 221          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 62.7734 bits (151), Expect = 4.227e-10
Identity = 45/166 (27.11%), Postives = 83/166 (50.00%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSG---KQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT AV  +++SP+G  L +   D ++K+W + +G    +++ + + +   AW  +SD  L  SG   K L +  L         K H   +   +++  + LIVSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   58 VKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAW--SSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 221          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0321318)

HSP 1 Score: 60.8474 bits (146), Expect = 2.484e-9
Identity = 52/227 (22.91%), Postives = 97/227 (42.73%), Query Frame = 1
Query:  304 QFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRS-SLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIF--WKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYP-ITAVAWSCNGNMFAVGSYD-TLRLCDKNGWSYSLDKPQC--------GGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRL 945
            Q + R+  +E+    H+G +  +R+ PDG  + T   D  V +W+ N   R    A +  PV   AW    + ++ ++G    +K  +  ++ +   + AH   + +VD+ S   L+++  +D   K+W        +S A     + +  +S NG + A  S D ++R+       Y +D  +C             LAW      LA A G  ++    V+  +L
Sbjct:    2 QGLFRDPALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGN-LVASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRI-------YDVDSGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQL 220          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Fly
Match: Poc1 (gene:FBgn0036354 transcript:FBtr0075863)

HSP 1 Score: 60.4622 bits (145), Expect = 2.686e-9
Identity = 52/227 (22.91%), Postives = 97/227 (42.73%), Query Frame = 1
Query:  304 QFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRS-SLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIF--WKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYP-ITAVAWSCNGNMFAVGSYD-TLRLCDKNGWSYSLDKPQC--------GGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRL 945
            Q + R+  +E+    H+G +  +R+ PDG  + T   D  V +W+ N   R    A +  PV   AW    + ++ ++G    +K  +  ++ +   + AH   + +VD+ S   L+++  +D   K+W        +S A     + +  +S NG + A  S D ++R+       Y +D  +C             LAW      LA A G  ++    V+  +L
Sbjct:    2 QGLFRDPALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGN-LVASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATASDDKSVRI-------YDVDSGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQL 220          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Zebrafish
Match: ift80 (intraflagellar transport 80 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-041212-50])

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 374/765 (48.89%), Postives = 557/765 (72.81%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MRLK +  KE +H++L SCVGW+S +E++SC+DDH +LKWN  + +   V++  +  YP ++HW+P++  ++   ++ ++I AL S+DGK   +S++GRIEKSVEAH GAVL  RW+ DG AL T GEDG +K+WS++GMLRS+LAQ  +PVYS AW  +S ++LYTSG+QLV+K LQ N K + WKAH+GVIL VDWS++N LI+SGGEDCKYKVW+SYG +L++S  HDYPIT+VAW+ +G +FA+GS+ TLRLCDK GWSYSL+KP  G +LSL WS D TQLA ACG+G V+F H+   R EW+NF + L   R + V NV  ++V+ LEFRDRV+K S   G+L+V TS  CY+YS +NWNTP++ DLKE  V+LI+Q+E+ FL++DG  + +Y+YEGRL+ SPKS  ++ +++++   S+SNDT+++RD  D++V+ LF++ +GK  GDGKPLIHKI ++ +ALDQ G++ DR+IA+IDKNRDLYL SVR  G++    K+G+MV+ + W+D+   L  +   +  +W YP++ F+DK LL ++I  K S++F   P + ++ G+ VT R+ +GS++   V+PY  +LH+  ++ +  +AL +CR  K++ LW CLA +A  ++E+ TA++AYAA+ ++DKV+YI  IK +P K++  A +LL SG+VQ+AE  L+QA L++ A+ +H+ L++WDRALEL    + ++  VLAHR +FL    + E NK FL+Y      +WE+++ K+  E+ +E +R
Sbjct:    1 MRLKTSLLKEPKHRELVSCVGWTSADELYSCSDDHQILKWNLLSNDTSVVVKLQDEIYPIDLHWFPKT--VSGKKQAAAEIFALTSSDGKLHLVSKSGRIEKSVEAHRGAVLAGRWNYDGTALITAGEDGQLKIWSKSGMLRSTLAQQGMPVYSVAWAPDSGRVLYTSGRQLVVKPLQPNSKVLQWKAHDGVILKVDWSAVNDLILSGGEDCKYKVWDSYGRLLFSSAPHDYPITSVAWAPDGELFAMGSFHTLRLCDKTGWSYSLEKPSTGSLLSLCWSADGTQLAGACGNGHVLFAHIVEQRWEWKNFEITLTKRRTMQVRNVLNDAVDVLEFRDRVIKASLAHGHLVVTTSLQCYVYSAKNWNTPLIFDLKEGTVSLIVQAERHFLLVDGAEVYVYSYEGRLISSPKSPGMRMDILNSQSISLSNDTIAIRDTTDERVVFLFEAQTGKAIGDGKPLIHKIEVVLIALDQCGSSNDRRIALIDKNRDLYLTSVRKLGRAHSIYKIGSMVDTMAWNDSANILCGIQDNRFTVWYYPSVVFVDKDLLPKTIFTKDSSEFSRPPQMVSYVGSQVTVRRVDGSLVCTAVSPYPTLLHEYTSSARWEDALRICRFAKDQTLWSCLAGLAMANRELSTAEVAYAAIGEIDKVQYINFIKDLPSKDSCLAHILLFSGHVQEAEATLLQANLIYHAIQIHINLYNWDRALELAVKYKTHVDTVLAHRHKFLQDFGKQETNKRFLQYSEGVEVDWEKIQAKIEMEFAKERER 763          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Zebrafish
Match: ift80 (intraflagellar transport 80 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-041212-50])

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 374/765 (48.89%), Postives = 557/765 (72.81%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MRLK +  KE +H++L SCVGW+S +E++SC+DDH +LKWN  + +   V++  +  YP ++HW+P++  ++   ++ ++I AL S+DGK   +S++GRIEKSVEAH GAVL  RW+ DG AL T GEDG +K+WS++GMLRS+LAQ  +PVYS AW  +S ++LYTSG+QLV+K LQ N K + WKAH+GVIL VDWS++N LI+SGGEDCKYKVW+SYG +L++S  HDYPIT+VAW+ +G +FA+GS+ TLRLCDK GWSYSL+KP  G +LSL WS D TQLA ACG+G V+F H+   R EW+NF + L   R + V NV  ++V+ LEFRDRV+K S   G+L+V TS  CY+YS +NWNTP++ DLKE  V+LI+Q+E+ FL++DG  + +Y+YEGRL+ SPKS  ++ +++++   S+SNDT+++RD  D++V+ LF++ +GK  GDGKPLIHKI ++ +ALDQ G++ DR+IA+IDKNRDLYL SVR  G++    K+G+MV+ + W+D+   L  +   +  +W YP++ F+DK LL ++I  K S++F   P + ++ G+ VT R+ +GS++   V+PY  +LH+  ++ +  +AL +CR  K++ LW CLA +A  ++E+ TA++AYAA+ ++DKV+YI  IK +P K++  A +LL SG+VQ+AE  L+QA L++ A+ +H+ L++WDRALEL    + ++  VLAHR +FL    + E NK FL+Y      +WE+++ K+  E+ +E +R
Sbjct:    1 MRLKTSLLKEPKHRELVSCVGWTSADELYSCSDDHQILKWNLLSNDTSVVVKLQDEIYPIDLHWFPKT--VSGKKQAAAEIFALTSSDGKLHLVSKSGRIEKSVEAHRGAVLAGRWNYDGTALITAGEDGQLKIWSKSGMLRSTLAQQGMPVYSVAWAPDSGRVLYTSGRQLVVKPLQPNSKVLQWKAHDGVILKVDWSAVNDLILSGGEDCKYKVWDSYGRLLFSSAPHDYPITSVAWAPDGELFAMGSFHTLRLCDKTGWSYSLEKPSTGSLLSLCWSADGTQLAGACGNGHVLFAHIVEQRWEWKNFEITLTKRRTMQVRNVLNDAVDVLEFRDRVIKASLAHGHLVVTTSLQCYVYSAKNWNTPLIFDLKEGTVSLIVQAERHFLLVDGAEVYVYSYEGRLISSPKSPGMRMDILNSQSISLSNDTIAIRDTTDERVVFLFEAQTGKAIGDGKPLIHKIEVVLIALDQCGSSNDRRIALIDKNRDLYLTSVRKLGRAHSIYKIGSMVDTMAWNDSANILCGIQDNRFTVWYYPSVVFVDKDLLPKTIFTKDSSEFSRPPQMVSYVGSQVTVRRVDGSLVCTAVSPYPTLLHEYTSSARWEDALRICRFAKDQTLWSCLAGLAMANRELSTAEVAYAAIGEIDKVQYINFIKDLPSKDSCLAHILLFSGHVQEAEATLLQANLIYHAIQIHINLYNWDRALELAVKYKTHVDTVLAHRHKFLQDFGKQETNKRFLQYSEGVEVDWEKIQAKIEMEFAKERER 763          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 62.003 bits (149), Expect = 1.978e-10
Identity = 42/164 (25.61%), Postives = 83/164 (50.61%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT AV  +++SP G  L +   D ++K+W + +G    +++ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + LIVSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   31 VKPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 194          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 62.3882 bits (150), Expect = 7.512e-10
Identity = 42/164 (25.61%), Postives = 83/164 (50.61%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT AV  +++SP G  L +   D ++K+W + +G    +++ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + LIVSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   31 VKPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 194          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Zebrafish
Match: tbl1xr1b (transducin (beta)-like 1 X-linked receptor 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1192])

HSP 1 Score: 62.7734 bits (151), Expect = 9.974e-10
Identity = 54/210 (25.71%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  220 WYPRSNEMTSGNKSNSDIV---ALASTDGKYQFISRNGRIEKSVEAHTGA-VLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYD-TLRLCDKNGWSYSLD 831
            W P S+ + SG+  ++  +   + +ST G  Q + R+   E   +  +   V  + W+ +G  L TG  DG  ++W+++G L S+L Q+  P+++  W    + IL     K  +I           +  H    L VDW S N       + C +         + T   H   + A+ W   GN+ A  S D TL+L     WS   D
Sbjct:  173 WNPVSDLLASGSGDSTARIWNLSESSTGGSTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQERPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKL-----WSMKQD 377          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Xenopus
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:549947])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 376/767 (49.02%), Postives = 560/767 (73.01%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKRNS 2328
            M LK +  KE +HK+  SCVGW+S +E++SC+DDH +LKWN  T E   V++  +  YP ++HW+P++  + +  ++ +++  L S+DGK+  IS+ GR+EKSVEAH+GAVL  RW+ DG AL T GEDG VK+WS++GMLRS+LAQN  PVYS AWG +S+++LY  GKQL+IK LQ + K + WKAH+G+IL+VDW+S+N LI+S GEDC YK+W+  G  LY S +H+YPIT+V+W+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I S+AWSVD TQ+A ACG+G VIF H+     EW+NF V L   R + V NV  ++V+ LEFR+RV+K S  +G+L+V TS  CY++ST+NWNTP++ +LKE  V+LI+Q E+ FL++DGG+  +Y+YEGRL+ SPK   I+ ++++    S+SNDT++++DK D+K I+LFD+ SGK  GDGKPL H+  I+E+ALDQ G + +RKIA  DKN+DLY+  VR++G+ ++S+++G  V+ + W+D    L  +   +++IW YPN+ ++DK LL ++I+EK  ++F   P I +F GN VT R+ +GS+I   V+PY A+LH   +++K ++A+ LC SVKE+ +W CLAAMA  SKE+ TAQ AYAA+ ++DKV+YI  IK +P KE+R A + L+SG+VQ+A  +L+QAGL+++A+ +++  ++WDRALEL    + ++  VLA+R+++LD+ ++ E NK FL+Y      +WE++  K+  E  +E +R S
Sbjct:    1 MHLKTSILKEAKHKEFVSCVGWTSADELYSCSDDHQILKWNLLTNETTVVVKLSDDTYPIDLHWFPKN--VGNRKQAQAEMFVLTSSDGKFHLISKLGRLEKSVEAHSGAVLAGRWNYDGTALVTVGEDGHVKIWSKSGMLRSTLAQNGSPVYSVAWGPDSEKVLYPLGKQLIIKPLQPSSKVLQWKAHDGIILSVDWNSVNDLILSAGEDCIYKIWDRNGRNLYNSASHEYPITSVSWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFSIAWSVDGTQIAGACGNGHVIFAHIVEQHWEWKNFEVTLTKRRAMQVRNVINDAVDLLEFRERVIKASLNYGHLVVCTSLQCYVFSTKNWNTPLIFNLKEGTVSLILQCERHFLLVDGGSFWLYSYEGRLISSPKVPGIRTDILNEQSVSLSNDTIAIKDKADEKSIYLFDALSGKALGDGKPLTHEKEILEIALDQGGPSNERKIAFFDKNQDLYICPVRNFGREQKSIQIGASVHALAWNDTFNMLCGLQEYRVLIWYYPNVVYVDKDLLPKTILEKEGSEFSKSPQIVSFVGNRVTIRRSDGSLIHTNVSPYPAILHGYISSSKWDDAVRLCSSVKEQTMWSCLAAMAIGSKELTTAQAAYAAIGNLDKVQYINSIKDLPSKESRLANIQLLSGSVQEA--VLLQAGLIYQAIQLNIDSYNWDRALELAVKHKTHVDTVLAYRQKYLDNFNKKETNKRFLQYAEGVKVDWEKINAKIEMELLKERERAS 763          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Xenopus
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:549947])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 369/752 (49.07%), Postives = 550/752 (73.14%), Query Frame = 1
Query:   76 LASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKRNS 2328
              SCVGW+S +E++SC+DDH +LKWN  T E   V++  +  YP ++HW+P++  + +  ++ +++  L S+DGK+  IS+ GR+EKSVEAH+GAVL  RW+ DG AL T GEDG VK+WS++GMLRS+LAQN  PVYS AWG +S+++LY  GKQL+IK LQ + K + WKAH+G+IL+VDW+S+N LI+S GEDC YK+W+  G  LY S +H+YPIT+V+W+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I S+AWSVD TQ+A ACG+G VIF H+     EW+NF V L   R + V NV  ++V+ LEFR+RV+K S  +G+L+V TS  CY++ST+NWNTP++ +LKE  V+LI+Q E+ FL++DGG+  +Y+YEGRL+ SPK   I+ ++++    S+SNDT++++DK D+K I+LFD+ SGK  GDGKPL H+  I+E+ALDQ G + +RKIA  DKN+DLY+  VR++G+ ++S+++G  V+ + W+D    L  +   +++IW YPN+ ++DK LL ++I+EK  ++F   P I +F GN VT R+ +GS+I   V+PY A+LH   +++K ++A+ LC SVKE+ +W CLAAMA  SKE+ TAQ AYAA+ ++DKV+YI  IK +P KE+R A + L+SG+VQ+A  +L+QAGL+++A+ +++  ++WDRALEL    + ++  VLA+R+++LD+ ++ E NK FL+Y      +WE++  K+  E  +E +R S
Sbjct:   15 FVSCVGWTSADELYSCSDDHQILKWNLLTNETTVVVKLSDDTYPIDLHWFPKN--VGNRKQAQAEMFVLTSSDGKFHLISKLGRLEKSVEAHSGAVLAGRWNYDGTALVTVGEDGHVKIWSKSGMLRSTLAQNGSPVYSVAWGPDSEKVLYPLGKQLIIKPLQPSSKVLQWKAHDGIILSVDWNSVNDLILSAGEDCIYKIWDRNGRNLYNSASHEYPITSVSWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFSIAWSVDGTQIAGACGNGHVIFAHIVEQHWEWKNFEVTLTKRRAMQVRNVINDAVDLLEFRERVIKASLNYGHLVVCTSLQCYVFSTKNWNTPLIFNLKEGTVSLILQCERHFLLVDGGSFWLYSYEGRLISSPKVPGIRTDILNEQSVSLSNDTIAIKDKADEKSIYLFDALSGKALGDGKPLTHEKEILEIALDQGGPSNERKIAFFDKNQDLYICPVRNFGREQKSIQIGASVHALAWNDTFNMLCGLQEYRVLIWYYPNVVYVDKDLLPKTILEKEGSEFSKSPQIVSFVGNRVTIRRSDGSLIHTNVSPYPAILHGYISSSKWDDAVRLCSSVKEQTMWSCLAAMAIGSKELTTAQAAYAAIGNLDKVQYINSIKDLPSKESRLANIQLLSGSVQEA--VLLQAGLIYQAIQLNIDSYNWDRALELAVKHKTHVDTVLAYRQKYLDNFNKKETNKRFLQYAEGVSIDWEKINAKIEMELLKERERAS 762          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Xenopus
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:549947])

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 362/725 (49.93%), Postives = 537/725 (74.07%), Query Frame = 1
Query:   76 LASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKY 2250
              SCVGW+S +E++SC+DDH +LKWN  T E   V++  +  YP ++HW+P++  + +  ++ +++  L S+DGK+  IS+ GR+EKSVEAH+GAVL  RW+ DG AL T GEDG VK+WS++GMLRS+LAQN  PVYS AWG +S+++LY  GKQL+IK LQ + K + WKAH+G+IL+VDW+S+N LI+S GEDC YK+W+  G  LY S +H+YPIT+V+W+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I S+AWSVD TQ+A ACG+G VIF H+     EW+NF V L   R + V NV  ++V+ LEFR+RV+K S  +G+L+V TS  CY++ST+NWNTP++ +LKE  V+LI+Q E+ FL++DGG+  +Y+YEGRL+ SPK   I+ ++++    S+SNDT++++DK D+K I+LFD+ SGK  GDGKPL H+  I+E+ALDQ G + +RKIA  DKN+DLY+  VR++G+ ++S+++G  V+ + W+D    L  +   +++IW YPN+ ++DK LL ++I+EK  ++F   P I +F GN VT R+ +GS+I   V+PY A+LH   +++K ++A+ LC SVKE+ +W CLAAMA  SKE+ TAQ AYAA+ ++DKV+YI  IK +P KE+R A + L+SG+VQ+A  +L+QAGL+++A+ +++  ++WDRALEL    + ++  VLA+R+++LD+ ++ E NK FL+Y
Sbjct:   15 FVSCVGWTSADELYSCSDDHQILKWNLLTNETTVVVKLSDDTYPIDLHWFPKN--VGNRKQAQAEMFVLTSSDGKFHLISKLGRLEKSVEAHSGAVLAGRWNYDGTALVTVGEDGHVKIWSKSGMLRSTLAQNGSPVYSVAWGPDSEKVLYPLGKQLIIKPLQPSSKVLQWKAHDGIILSVDWNSVNDLILSAGEDCIYKIWDRNGRNLYNSASHEYPITSVSWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFSIAWSVDGTQIAGACGNGHVIFAHIVEQHWEWKNFEVTLTKRRAMQVRNVINDAVDLLEFRERVIKASLNYGHLVVCTSLQCYVFSTKNWNTPLIFNLKEGTVSLILQCERHFLLVDGGSFWLYSYEGRLISSPKVPGIRTDILNEQSVSLSNDTIAIKDKADEKSIYLFDALSGKALGDGKPLTHEKEILEIALDQGGPSNERKIAFFDKNQDLYICPVRNFGREQKSIQIGASVHALAWNDTFNMLCGLQEYRVLIWYYPNVVYVDKDLLPKTILEKEGSEFSKSPQIVSFVGNRVTIRRSDGSLIHTNVSPYPAILHGYISSSKWDDAVRLCSSVKEQTMWSCLAAMAIGSKELTTAQAAYAAIGNLDKVQYINSIKDLPSKESRLANIQLLSGSVQEA--VLLQAGLIYQAIQLNIDSYNWDRALELAVKHKTHVDTVLAYRQKYLDNFNKKETNKRFLQY 735          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Xenopus
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:549947])

HSP 1 Score: 786.949 bits (2031), Expect = 0.000e+0
Identity = 367/753 (48.74%), Postives = 550/753 (73.04%), Query Frame = 1
Query:   73 DLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKRNS 2328
            +  SCVGW+S +E++SC+DDH +LKWN  T E   V++  +  YP ++HW+P++  + +  ++ +++  L S+DGK+  IS+ GR+EKSVEAH+GAVL  RW+ DG AL T GEDG VK+WS++GMLRS+LAQN  PVYS AWG +S+++LY  GKQL+IK LQ + K + WKAH+G+IL+VDW+S+N LI+S GEDC YK+W+  G  LY S +H+YPIT+V+W+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I S+AWSVD TQ+A ACG+G VIF H+     EW+NF V L   R + V NV  ++V+ LEFR+RV+K S  +G+L+V TS  CY++ST+NWNTP++ +LKE  V+LI+Q E+ FL++DGG+  +Y+YEGRL+ SPK   I+ ++++    S+SNDT++++DK D+K I+LFD+ SGK  GDGKPL H+  ++ L+LDQ G + +RKIA  DKN+DLY+  VR++G+ ++S+++G  V+ + W+D    L  +   +++IW YPN+ ++DK LL ++I+EK  ++F   P I +F GN VT R+ +GS+I   V+PY A+LH   +++K ++A+ LC SVKE+ +W CLAAMA  SKE+ TAQ AYAA+ ++DKV+YI  IK +P KE+R A + L+SG+VQ+A  +L+QAGL+++A+ +++  ++WDRALEL    + ++  VLA+R+++LD+ ++ E NK FL+Y      +WE++  K+  E  +E +R S
Sbjct:   14 EFVSCVGWTSADELYSCSDDHQILKWNLLTNETTVVVKLSDDTYPIDLHWFPKN--VGNRKQAQAEMFVLTSSDGKFHLISKLGRLEKSVEAHSGAVLAGRWNYDGTALVTVGEDGHVKIWSKSGMLRSTLAQNGSPVYSVAWGPDSEKVLYPLGKQLIIKPLQPSSKVLQWKAHDGIILSVDWNSVNDLILSAGEDCIYKIWDRNGRNLYNSASHEYPITSVSWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFSIAWSVDGTQIAGACGNGHVIFAHIVEQHWEWKNFEVTLTKRRAMQVRNVINDAVDLLEFRERVIKASLNYGHLVVCTSLQCYVFSTKNWNTPLIFNLKEGTVSLILQCERHFLLVDGGSFWLYSYEGRLISSPKVPGIRTDILNEQSVSLSNDTIAIKDKADEKSIYLFDALSGKALGDGKPLTHE--VVLLSLDQGGPSNERKIAFFDKNQDLYICPVRNFGREQKSIQIGASVHALAWNDTFNMLCGLQEYRVLIWYYPNVVYVDKDLLPKTILEKEGSEFSKSPQIVSFVGNRVTIRRSDGSLIHTNVSPYPAILHGYISSSKWDDAVRLCSSVKEQTMWSCLAAMAIGSKELTTAQAAYAAIGNLDKVQYINSIKDLPSKESRLANIQLLSGSVQEA--VLLQAGLIYQAIQLNIDSYNWDRALELAVKHKTHVDTVLAYRQKYLDNFNKKETNKRFLQYAEGVKVDWEKINAKIEMELLKERERAS 760          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Xenopus
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:549947])

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 371/767 (48.37%), Postives = 551/767 (71.84%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKRNS 2328
            M LK +  KE +HK+  SCVGW+S +E++SC+DDH +LKWN  T E   V++  +  YP ++HW+P++  + +  ++ +++  L S+DGK+  IS+ GR+EKSVEAH+GAVL  RW+ DG AL T GEDG VK+WS++GMLRS+LAQN  PVYS AWG +S+++LY  GKQL+IK LQ + K + WKAH+G+IL+VDW+S+N LI+S GEDC YK+W+  G  LY S +H+YPIT+V+W+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I S+AWSVD TQ+A ACG+G VIF H+     EW+NF V L   R + V NV  ++V+ LEFR+RV+K S  +G+L+V TS  CY++ST+NWNTP++ +LKE  V+LI+Q E            +Y+YEGRL+ SPK   I+ ++++    S+SNDT++++DK D+K I+LFD+ SGK  GDGKPL H+  I+E+ALDQ G + +RKIA  DKN+DLY+  VR++G+ ++S+++G  V+ + W+D    L  +   +++IW YPN+ ++DK LL ++I+EK  ++F   P I +F GN VT R+ +GS+I   V+PY A+LH   +++K ++A+ LC SVKE+ +W CLAAMA  SKE+ TAQ AYAA+ ++DKV+YI  IK +P KE+R A + L+SG+VQ+A  +L+QAGL+++A+ +++  ++WDRALEL    + ++  VLA+R+++LD+ ++ E NK FL+Y      +WE++  K+  E  +E +R S
Sbjct:    1 MHLKTSILKEAKHKEFVSCVGWTSADELYSCSDDHQILKWNLLTNETTVVVKLSDDTYPIDLHWFPKN--VGNRKQAQAEMFVLTSSDGKFHLISKLGRLEKSVEAHSGAVLAGRWNYDGTALVTVGEDGHVKIWSKSGMLRSTLAQNGSPVYSVAWGPDSEKVLYPLGKQLIIKPLQPSSKVLQWKAHDGIILSVDWNSVNDLILSAGEDCIYKIWDRNGRNLYNSASHEYPITSVSWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFSIAWSVDGTQIAGACGNGHVIFAHIVEQHWEWKNFEVTLTKRRAMQVRNVINDAVDLLEFRERVIKASLNYGHLVVCTSLQCYVFSTKNWNTPLIFNLKEGTVSLILQCESFSFC-----FWLYSYEGRLISSPKVPGIRTDILNEQSVSLSNDTIAIKDKADEKSIYLFDALSGKALGDGKPLTHEKEILEIALDQGGPSNERKIAFFDKNQDLYICPVRNFGREQKSIQIGASVHALAWNDTFNMLCGLQEYRVLIWYYPNVVYVDKDLLPKTILEKEGSEFSKSPQIVSFVGNRVTIRRSDGSLIHTNVSPYPAILHGYISSSKWDDAVRLCSSVKEQTMWSCLAAMAIGSKELTTAQAAYAAIGNLDKVQYINSIKDLPSKESRLANIQLLSGSVQEA--VLLQAGLIYQAIQLNIDSYNWDRALELAVKHKTHVDTVLAYRQKYLDNFNKKETNKRFLQYAEGVKVDWEKINAKIEMELLKERERAS 758          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Mouse
Match: Ift80 (intraflagellar transport 80 [Source:MGI Symbol;Acc:MGI:1915509])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 373/765 (48.76%), Postives = 560/765 (73.20%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MRLK++ +KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E   +++ P+  YP ++HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG VK+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG +LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV   R EW+NF V L   R + V NV  ++V+ LEFRDRV+K S    +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DGG + +++YEGR + SPK   ++ ++++A   S+SNDT++++DK D+K+I LF++ +GKP GDGK L HK  I E+ALDQ G   DRKIA IDKNRDLY+ SV+ +G+  + +KLGTMV+ + W D    L  +   +  +W YPN  ++D+ +L +++ E+ ++++   P I +F GN VT R+ +GS++   ++PY A+LH+  +++K  EA+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV YI  IK +P +E++ A +L+ SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FLD+  + E NK +L+Y      +WE+++ K+  E  +E  R
Sbjct:    1 MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPIDLHWFPKS--LGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGIQDTRFTVWYYPNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHISISPYPAILHEYVSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAIKDLPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDR 763          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Mouse
Match: Ift80 (intraflagellar transport 80 [Source:MGI Symbol;Acc:MGI:1915509])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 373/765 (48.76%), Postives = 560/765 (73.20%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MRLK++ +KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E   +++ P+  YP ++HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG VK+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG +LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV   R EW+NF V L   R + V NV  ++V+ LEFRDRV+K S    +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DGG + +++YEGR + SPK   ++ ++++A   S+SNDT++++DK D+K+I LF++ +GKP GDGK L HK  I E+ALDQ G   DRKIA IDKNRDLY+ SV+ +G+  + +KLGTMV+ + W D    L  +   +  +W YPN  ++D+ +L +++ E+ ++++   P I +F GN VT R+ +GS++   ++PY A+LH+  +++K  EA+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV YI  IK +P +E++ A +L+ SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FLD+  + E NK +L+Y      +WE+++ K+  E  +E  R
Sbjct:    1 MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPIDLHWFPKS--LGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGIQDTRFTVWYYPNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHISISPYPAILHEYVSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAIKDLPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDR 763          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Mouse
Match: Ift80 (intraflagellar transport 80 [Source:MGI Symbol;Acc:MGI:1915509])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 373/765 (48.76%), Postives = 560/765 (73.20%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MRLK++ +KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E   +++ P+  YP ++HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG VK+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG +LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV   R EW+NF V L   R + V NV  ++V+ LEFRDRV+K S    +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DGG + +++YEGR + SPK   ++ ++++A   S+SNDT++++DK D+K+I LF++ +GKP GDGK L HK  I E+ALDQ G   DRKIA IDKNRDLY+ SV+ +G+  + +KLGTMV+ + W D    L  +   +  +W YPN  ++D+ +L +++ E+ ++++   P I +F GN VT R+ +GS++   ++PY A+LH+  +++K  EA+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV YI  IK +P +E++ A +L+ SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FLD+  + E NK +L+Y      +WE+++ K+  E  +E  R
Sbjct:    1 MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPIDLHWFPKS--LGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGIQDTRFTVWYYPNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHISISPYPAILHEYVSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAIKDLPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDR 763          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Mouse
Match: Ift80 (intraflagellar transport 80 [Source:MGI Symbol;Acc:MGI:1915509])

HSP 1 Score: 252.292 bits (643), Expect = 2.212e-78
Identity = 113/211 (53.55%), Postives = 160/211 (75.83%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGED 663
            MRLK++ +KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E   +++ P+  YP ++HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG VK+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GED
Sbjct:    1 MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPIDLHWFPKS--LGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGED 209          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Mouse
Match: Ift80 (intraflagellar transport 80 [Source:MGI Symbol;Acc:MGI:1915509])

HSP 1 Score: 183.341 bits (464), Expect = 2.005e-53
Identity = 81/160 (50.62%), Postives = 117/160 (73.12%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGN 510
            MRLK++ +KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E   +++ P+  YP ++HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG VK+WS+ GMLRS+LAQ   PVYS AWG +
Sbjct:    1 MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPIDLHWFPKS--LGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPD 158          
BLAST of intraflagellar transport protein 80 homolog vs. UniProt/SwissProt
Match: sp|Q8K057|IFT80_MOUSE (Intraflagellar transport protein 80 homolog OS=Mus musculus OX=10090 GN=Ift80 PE=1 SV=1)

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 373/765 (48.76%), Postives = 560/765 (73.20%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MRLK++ +KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E   +++ P+  YP ++HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG VK+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG +LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV   R EW+NF V L   R + V NV  ++V+ LEFRDRV+K S    +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DGG + +++YEGR + SPK   ++ ++++A   S+SNDT++++DK D+K+I LF++ +GKP GDGK L HK  I E+ALDQ G   DRKIA IDKNRDLY+ SV+ +G+  + +KLGTMV+ + W D    L  +   +  +W YPN  ++D+ +L +++ E+ ++++   P I +F GN VT R+ +GS++   ++PY A+LH+  +++K  EA+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV YI  IK +P +E++ A +L+ SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FLD+  + E NK +L+Y      +WE+++ K+  E  +E  R
Sbjct:    1 MRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPIDLHWFPKS--LGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGIQDTRFTVWYYPNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHISISPYPAILHEYVSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAIKDLPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDR 763          
BLAST of intraflagellar transport protein 80 homolog vs. UniProt/SwissProt
Match: sp|Q9P2H3|IFT80_HUMAN (Intraflagellar transport protein 80 homolog OS=Homo sapiens OX=9606 GN=IFT80 PE=1 SV=3)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 372/764 (48.69%), Postives = 559/764 (73.17%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKR 2322
            MRLK++  KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E  ++++ P+  YP + HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG +K+WS+ GMLRS+LAQ   PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG  LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV     EW+NF V L   R + V NV  ++V+ LEFRDRV+K S  + +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DG ++ +Y+YEGR + SPK   ++ ++++A   S+SNDT+++RDK D+K+I LF++ +GKP GDGK L HK  I+E+ALDQ G   DRKIA IDKNRDL + SV+ +G+  + +KLGTMV+ + W+D    L  +   + ++W YPN  ++D+ +L +++ E+ +++F   P I +F GN VT R+ +GS++   + PY A+LH+  +++K  +A+ LCR VKE+ +W CLAAMA  ++++ TA+IAYAA+ ++DKV+YI  IK +P KE++ A +LL SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FL++  + E NK +L Y      +WE+++  I E E  ++R
Sbjct:    1 MRLKISLLKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPIDFHWFPKS--LGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQIKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRPLYNSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQHWEWKNFQVTLTKRRAMQVRNVLNDAVDLLEFRDRVIKASLNYAHLVVSTSLQCYVFSTKNWNTPIIFDLKEGTVSLILQAERHFLLVDGSSIYLYSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIRDKADEKIIFLFEASTGKPLGDGKFLSHKNEILEIALDQKGLTNDRKIAFIDKNRDLCITSVKRFGKEEQIIKLGTMVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYVDRDILPKTLYERDASEFSKNPHIVSFVGNQVTIRRADGSLVHISITPYPAILHEYVSSSKWEDAVRLCRFVKEQTMWACLAAMAVANRDMTTAEIAYAAIGEIDKVQYINSIKNLPSKESKMAHILLFSGNIQEAEIVLLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYLHYAEGLQIDWEKIKAKI-EMEITKER 761          
BLAST of intraflagellar transport protein 80 homolog vs. UniProt/SwissProt
Match: sp|Q66HB3|IFT80_RAT (Intraflagellar transport protein 80 homolog OS=Rattus norvegicus OX=10116 GN=Ift80 PE=2 SV=1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 372/767 (48.50%), Postives = 562/767 (73.27%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKRNS 2328
            MRLK++  KE +H++L SCVGW++ EE++SC+DDH ++KWN  T E   +++ P+  YP ++HW+P+S  +    ++ ++   L S+DGK+  IS+ GR+EKSVEAH GAVL  RW+ +G AL T GEDG VK+WS+ GMLRS+LAQ  +PVYS AWG +S+++LYT+GKQL+IK LQ N K + WKAH+G+IL VDW+S+N LI+S GEDCKYKVW+SYG +LY S  H++PIT+VAW+ +G +FAVGS+ TLRLCDK GWSY+L+KP  G I ++AWS+D TQ+A ACG+G V+F HV   R EW+NF V L   R + V NV  ++V+ LEFRDRV+K S    +L+V+TS  CY++ST+NWNTP++ DLKE  V+LI+Q+E+ FL++DGG + +++YEGR + SPK   ++ ++++A   S+SNDT++++DK D+K+I LF++ +GKP GDGK L HK  I E+ALDQ G   DRKIA IDKNRDLY+ SV+ +G+  + +KLGTMV+ + W D    L  +   +  +W YPN  ++D+ +L +++ E+ ++++   P I +F GN VT R+ +GS++   ++PY A+LH+  +++K  +A+ LCR VKE+ LW CLAAMA  ++++ TA+IAYAA+ ++DKV YI  +K +P +E++ A +L+ SGN+Q+AE +L+QAGLV++A+ +++ L++W+RALEL    + ++  VLA+R++FL++  + E NK +L+Y      +WE+++ K+  E  +E  R+S
Sbjct:    1 MRLKISLLKEPKHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSETSLIVKLPDDIYPIDLHWFPKS--LGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGIPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEVALDQKGLTNDRKIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGLQDTRFTVWYYPNAVYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTVRRADGSLVHISISPYPAILHEYVSSSKWEDAVRLCRFVKEQSLWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAMKDLPSRESKMAHILMFSGNIQEAETILLQAGLVYQAIQININLYNWERALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDRSS 765          
BLAST of intraflagellar transport protein 80 homolog vs. UniProt/SwissProt
Match: sp|Q9D7H2|WDR5B_MOUSE (WD repeat-containing protein 5B OS=Mus musculus OX=10090 GN=Wdr5b PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.556e-12
Identity = 45/161 (27.95%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  319 NGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSG-KQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            N  +  ++  H+ A+  +++SP+G  L +   D ++ +W + +G  + +L  + + +   AW  +S +++  S  K L +  +++       K H   +   D++  + LIVSG  D   K+W    G  L T  AH  PI+AV ++CNG++   GSYD L
Sbjct:   28 NYALRLTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGL 188          
BLAST of intraflagellar transport protein 80 homolog vs. UniProt/SwissProt
Match: sp|Q4V8C4|WDR5B_RAT (WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.546e-12
Identity = 45/161 (27.95%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  319 NGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSG-KQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            N  +  ++  H+ A+  +++SP+G  L +   D ++ +W + +G  + +L  + + +   AW  +S +++  S  K L +  +++       K H   +   D++  + LIVSG  D   K+W    G  L T  AH  PI+AV + CNG++   GSYD L
Sbjct:   28 NYALRLTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGKCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVHFHCNGSLIVSGSYDGL 188          
BLAST of intraflagellar transport protein 80 homolog vs. TrEMBL
Match: A0A2C9JF99 (WD_REPEATS_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106055812 PE=4 SV=1)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 399/765 (52.16%), Postives = 570/765 (74.51%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MRLK +  KE +H +L SCVGW++ +EV+SCADDH++LKWN    E   ++E P+  YPT+MHW+P+S +     K+ SD+ AL STDGK+  ISR GR+EKSVEAH GAVL  RWS DG AL TGGEDG +K+WSR+GMLRS+L QN +PVYS AWG +SDQIL+T+G+QLVIK LQAN KP  WKAHEG+IL VDW+++N LI+SG ED +YKVW++YG  LY S +H+YPIT+V+W+ +G MFA+GS++TLRLCD++GWSY+L+KP  G I ++AWS D TQ+A ACG+G+VIF +V  +RLEW+NF   L   + I V NV  ++ E L+FRDRV+K+S   G+L+VATSS CYIY+T+NWNTP++ DLKE  VTLI Q+EK FL++DG  + +Y+Y+GRL+CSP+   ++AE+ +    ++ NDT+++RDK D+KVI++FD+ +GK   DGKP+ HK+ ++++ LDQ G   +R+I+++DKNRDL++ SVR +G  R+ +KL TM+    W+D +  LAA+   K+++W YPN  ++DK LL +++ EK S+ FG  P +  F G+ +  R+ EGS+IS  + PY +VLH    NNK ++A+ LCR VKE+ LW CLAAMAT +K+++TA+IAYA++ + DKV++I  IK IP KEAR AEM L+ GN QDAE +L+QAGL+FRA+M++++L++WDRALEL    + ++  VL +R++FL    + E NK FL+Y      +W+++  K+  EY++E ++
Sbjct:    1 MRLKTSLQKEPKHSELVSCVGWTTPDEVYSCADDHLILKWNLTNNETSTLLELPKECYPTSMHWFPKSAQAAGAKKTGSDVFALTSTDGKFILISRTGRVEKSVEAHKGAVLCGRWSYDGTALVTGGEDGQIKIWSRSGMLRSTLTQNSIPVYSVAWGPDSDQILFTNGRQLVIKPLQANAKPQLWKAHEGIILCVDWNAVNNLILSGAEDKRYKVWDTYGRQLYCSSSHEYPITSVSWTPDGEMFAIGSFNTLRLCDRSGWSYALEKPNTGSIFNIAWSSDGTQIAGACGNGQVIFANVIEIRLEWKNFEATLTASKQINVRNVMNDATEKLDFRDRVIKLSLGHGHLVVATSSQCYIYNTKNWNTPMIFDLKEGSVTLIKQAEKHFLLVDGSGVYVYSYDGRLVCSPRFQGMKAEIFNHQTIALCNDTVAIRDKTDEKVIYVFDAQTGKAMADGKPISHKVEVMDIGLDQCGVTSERRISLVDKNRDLFITSVRVFGAERKIIKLATMIQAHVWNDESNMLAAMTDGKILVWYYPNAIYVDKDLLPKTLYEKDSSPFGKAPQLVGFLGSHLILRRSEGSLISTSITPYPSVLHSYVMNNKWDDAVRLCRFVKEDNLWACLAAMATYAKDLNTAEIAYASIHEADKVQFIINIKDIPVKEARNAEMALLCGNHQDAEAILLQAGLIFRAIMLNVQLYNWDRALELAVKNKTHVDTVLGYRQKFLARFDKSETNKRFLQYKEGIEIDWDKINTKIEMEYQKEREK 765          
BLAST of intraflagellar transport protein 80 homolog vs. TrEMBL
Match: A0A210PXE8 (Intraflagellar transport protein 80-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT20631 PE=4 SV=1)

HSP 1 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 389/765 (50.85%), Postives = 572/765 (74.77%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MR+K N  +E +H +L SCVGW++ EE+FS ADDH++LKWN  + E   +++ P+  +PT+MHW+P++     G K+ SD+  L STDGK+  +++ GR+EKSVEAH GAVL  RWS DG+A  T GEDG VK+WSR+GMLRS+L QN + VY  AWG +SD +L+T+GKQLVIKS+QAN KP  W+AHEGV+L VDW+ +N LI+SGGEDC+YKVW++YG ++Y S  HDYPIT++AW+ +G +FAVGS++TLRLCD+ GWSYSL+KP  G +  LAWS D TQ+A A G+G+V+  HV   RLEW+NF   +   + I V NV  ++VE+LEFRDR++K+S +F +L+VATS+ CYIYS +NWNTP++ DLKE  V+LI+QSEK FL++D   + +++Y+GRL+CSP+   ++A++++    SISNDT+++RDK ++KV+++FD+ +GKP GDGKP+ HK+ ++E+ALDQ G A +R++AIIDKNRDLYL  VR +G  R+S KLG M+  + W+D +  L+A+A  K  +W YPN  ++D+ L +++I EK +++FG  P +  F+GN V  R+ EGS++S  ++P+  +LH    + + N+A+ LCR VK+E LW CLAAM+  +KE++TA+IAYAA+ + +KV++I  IK IP KEAR AEM L+ G+ QDAE +L+QAGL+FRA+M++++L++WDRALEL    + ++  VL +R+++L    + ENNK +L+Y+     +WE++E K+  EY++E +R
Sbjct:    1 MRMKTNIQREPKHSELVSCVGWTTPEELFSGADDHLVLKWNLNSNETTTLVKLPDDVFPTDMHWFPKA--AGGGKKAVSDLFVLTSTDGKFHLVNKTGRVEKSVEAHKGAVLAGRWSFDGSAFVTAGEDGAVKIWSRSGMLRSTLTQNSMSVYGVAWGPDSDSVLFTNGKQLVIKSMQANAKPTMWRAHEGVVLVVDWNPVNNLIISGGEDCRYKVWDTYGRVMYNSFQHDYPITSLAWTPDGELFAVGSFNTLRLCDQAGWSYSLEKPNTGSLFKLAWSSDGTQVAGAGGNGQVLIAHVIEKRLEWKNFEATVTGGKQIHVRNVINDAVESLEFRDRIIKLSLEFNHLVVATSTQCYIYSVKNWNTPMIFDLKEGNVSLILQSEKHFLLVDNAGIYVFSYDGRLVCSPRYTGMRADILNYQTVSISNDTIAIRDKANEKVVYVFDAQNGKPLGDGKPITHKLDVMEIALDQCGPATERRLAIIDKNRDLYLTPVRVFGTERKSYKLGNMIQSLAWNDASNMLSALADGKFTVWYYPNTIYVDRDLATKTIFEKEASEFGKNPQLLQFNGNHVIIRRAEGSIVSTSISPHPCILHSYVYSGRWNDAVRLCRFVKDEVLWSCLAAMSAYAKELNTAEIAYAAIKEAEKVQFIVNIKDIPVKEARNAEMALLCGSQQDAEAILLQAGLIFRAIMLNIQLYNWDRALELAVKHKTHVDTVLGYRQKYLTRFEKKENNKRYLQYMEGIEVDWEKIEAKMEMEYQKERER 763          
BLAST of intraflagellar transport protein 80 homolog vs. TrEMBL
Match: R7TDL0 (WD_REPEATS_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_169559 PE=4 SV=1)

HSP 1 Score: 869.766 bits (2246), Expect = 0.000e+0
Identity = 396/767 (51.63%), Postives = 571/767 (74.45%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKS--NSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MR K++ +K+ +H +L SCVGW++ +EV S  DDH LLKWN  + E  K+++ P+  YPT+MHW+PR   +  G K    SD+  L STDGK+  ISR+GR+EKSVEAH GAVL  RW+  G  L T GEDG+VK+WSR+GMLRS+L+QN  PVYS AWG +SDQ+LYT+GKQL+IK +Q N KP  WK H+G++L VDW+ +N L++SG EDCKYKVW+ YG I+Y S  H+YPIT+V+WS +G +FA+GS++TLRLCDK GWS++L+KP  G + +++WS DSTQ+AAACG+G VIF HV   RLEW+N+ V+++D+++I V NVT ++ +NL+FRDRV+K S  F +++VATSS CYIY+ +NWNTP++ DLKE  VTLI+QSE+ FL++D  ++ +YTYEGR++CSPK   ++ ++++    S+S+DT+++RDK D+KVIH+F+  +GKP GDGKP IHKI ++E+ LDQ G A +R++AI+DKNRDLYL  VR YG+ R++VKL TM+N + W+D    LAA++  KL++W YPN + +DK L+SR+  E+ +N+FG  P + +F G  ++ R+ EGS+++  V+PY ++LH   T  + ++A+ LCR VKEE LW CLAAMA   K++ TA++AYAA+ + DKV++I+ IK IP KEAR AEM L  G   DAEG+L+QA L+FRA+M+++ L +WDRALEL    +  +  VLAHR ++L++  + E NK F++Y      +WE+++ K+  E++ E +R
Sbjct:    1 MRYKVSLHKQPKHTELVSCVGWTTPDEVISSGDDHQLLKWNLLSNEASKLVQLPDEVYPTDMHWFPR---LGGGGKKAPGSDVFVLCSTDGKFLLISRSGRVEKSVEAHRGAVLSARWNHTGTDLLTAGEDGVVKIWSRSGMLRSTLSQNSSPVYSIAWGPDSDQVLYTNGKQLIIKPIQPNAKPSQWKGHDGMVLKVDWNPVNNLLLSGSEDCKYKVWDCYGRIMYVSSIHEYPITSVSWSPDGQLFAIGSFNTLRLCDKTGWSHALEKPATGSLFNISWSSDSTQVAAACGNGHVIFAHVIERRLEWKNYEVVVSDQKVIRVRNVTNDAKDNLDFRDRVIKASIAFKHMVVATSSQCYIYNVKNWNTPMIFDLKEGSVTLIIQSERHFLLVDNTSVYVYTYEGRMVCSPKFPGMRTDILNEQTVSLSDDTIAIRDKTDEKVIHMFELSTGKPLGDGKPYIHKIEVMEVYLDQCGTATERRLAIVDKNRDLYLTQVRVYGKDRKTVKLSTMINSLLWNDETNMLAALSEGKLLVWFYPNASSVDKDLISRTTYERETNEFGKSPQLLSFLGKQISVRRAEGSILTTSVSPYPSILHNCVTLGRWDDAVRLCRFVKEESLWACLAAMAAYGKQLGTAEVAYAAIDEADKVQFIQSIKEIPSKEARNAEMALFCGQSSDAEGILLQASLIFRAIMLNIELCNWDRALELAVKHKTNVDTVLAHRMKYLENFDKKETNKRFIQYSEGVDIDWEKIQAKMELEFKNERER 764          
BLAST of intraflagellar transport protein 80 homolog vs. TrEMBL
Match: V4B1Q1 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_225973 PE=4 SV=1)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 397/768 (51.69%), Postives = 568/768 (73.96%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWN-NKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKRNS 2328
            MRLK    KE +H DL SCVGW++ +EVFSCADDH +LKWN     E   ++  P+  YPT MHW+P+++      KS SD+  L STDGK++ ISR GR+EK+V+AH GAVL  +WS +G AL T GEDG VK+WSR+GMLRS+L QN +PVYS +WG + +Q+L+T+GKQLVIK LQAN KP  WK HEG+IL V W+ +N LI+SGGEDCKYKVW+ YG +L++S  HDYPIT+ AW+ +G MFAVGSY+TLRLCD++GWSY+L+KP  G I +LAWS D TQ+A A G+G+VI  +V   RLEW+NF   +   + I V NV  +++E L+FRDR+VK+S  F +L+VATSS CY+YS+RNWNTP++ DLKE  VTLI Q+EK F+++DG  + +++Y+GRL+CSP+   ++A++++    SISNDT+++RDK D+K++++FD+ +GK  GDGKP+ +K+ ++E+ALDQ G   +R++AIIDKNRDLYL SVR +G  R+S KLGTM+  + W+D    LA +   KLM+W YPN  ++D+ LL+++I  + S +FG +P + +F GN +  R+ EGS++S  V+PY+AVLH     ++  +A+ LCR VK++ LW CLAAMA+ +K+++TA++AYAA+ +V+KV++I  IK IP KEAR AEM L+ GN  DAE +L+QA L+FRA+M++++L++WDRALEL    + ++  V+ +R ++LD   + ENNK FL+Y      +WE++E K+  EY++E +R S
Sbjct:    1 MRLKTTLQKEPKHSDLVSCVGWTTPDEVFSCADDHQILKWNLIGNHETSNIMTLPKDCYPTGMHWFPKTSSGGGSKKSVSDVFVLTSTDGKFRLISRTGRVEKTVDAHKGAVLCGQWSSNGTALVTAGEDGQVKIWSRSGMLRSTLTQNSLPVYSVSWGPDGEQVLFTNGKQLVIKPLQANAKPTMWKGHEGIILVVHWNPVNNLIISGGEDCKYKVWDMYGRMLFSSGTHDYPITSAAWTPDGEMFAVGSYNTLRLCDRSGWSYALEKPNTGSIFNLAWSSDGTQVAGASGNGQVIIANVIERRLEWKNFEATVNASKQIIVKNVMNDTLEKLDFRDRIVKVSLDFNHLVVATSSQCYVYSSRNWNTPMIFDLKEGSVTLIKQTEKHFVMVDGVGVYVFSYDGRLVCSPRYQGMKADILNTQTISISNDTVAIRDKTDEKLVYVFDALTGKLMGDGKPITNKLEVMEIALDQCGPTTERRLAIIDKNRDLYLTSVRIFGTERKSAKLGTMIQSMAWNDETNMLAGMTDGKLMVWYYPNTLYVDRDLLTKTIFTRDSTEFGKDPQLLSFIGNHLILRRAEGSLVSTSVSPYIAVLHDYVNGSRWEDAVRLCRFVKDDSLWSCLAAMASYAKDLNTAEVAYAAIKEVNKVQFIMNIKDIPIKEARNAEMALLCGNPSDAEAILLQANLIFRAIMLNIQLYNWDRALELAVKHKTHVDTVMGYRLKYLDRFDKKENNKRFLQYKEGIEIDWEKIESKIEMEYQKERERPS 768          
BLAST of intraflagellar transport protein 80 homolog vs. TrEMBL
Match: A0A1S3JZ54 (intraflagellar transport protein 80 homolog OS=Lingula unguis OX=7574 GN=LOC106177200 PE=4 SV=1)

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 397/766 (51.83%), Postives = 565/766 (73.76%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNS-DIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIR-EYEQEEKR 2322
            MR K +  KE +H ++ +C GW++ +EV+S +DDH +L+WN    E   +++     YPT++HW+P+S        +   D+  L S+DGKY  +S+ GR+EKSVEAH GAVL  RWS DG A+ T GEDG+VK+WSR+GMLRS+L QN  PVYS  W  ++DQIL T+GKQLVIK +QAN KP+ WKAH+GVIL  DW++ N LI+SGGEDCKYKVW+ YG +LY+SV HDYPIT+VAW+ +G +FAVGS++TLRLCDK GWSY+L+KP  G I SL+WS D TQ+A ACG+G VIF H+   RLEW+NF V +   + I V NV +++ + L+FRDR++K S  F +L+V TSS CY+YSTRNWNTP++ DLKE  V LI+Q+EK FL+ D   + +Y+YEGRL+CSPK   ++ ++++A   +ISNDT+++RDK D+KVIHLF++ +GKP GDGKP+ HK+ ++E+ALDQ G + +R++AIIDKNRDLYL SVR++G  R++VKLGTM+    W+DN+  LAA+A  K  +W YPN+A++D+ LL +++ EK +++FG  P + +F G+ V+ R+ +GS++S  ++PY A+LH      +  +A+ LCR VK++ +W CLAAMA  +KE++TA++AYAA+++ DKV+YI  IK IP KEAR AEM L SGN QDAEG+L+QAGLVFRA+M +++L++W RALEL    + ++  VLA+R+++L    R E +K F +Y      +WE++E+ I  EY +E++R
Sbjct:    1 MRFKTSLQKEPKHTEIVTCTGWTTPDEVYSGSDDHQILRWNLLNNECTCLVKLGNDVYPTDLHWFPKSGAGGKKGGAGGADVFVLGSSDGKYHLVSKTGRVEKSVEAHRGAVLACRWSYDGTAMVTAGEDGLVKIWSRSGMLRSTLVQNSSPVYSVCWSPDNDQILLTNGKQLVIKPMQANAKPVMWKAHDGVILKADWNASNNLILSGGEDCKYKVWDHYGRLLYSSVTHDYPITSVAWTPDGELFAVGSFNTLRLCDKAGWSYALEKPNTGSIFSLSWSSDGTQVAGACGNGHVIFAHLVEKRLEWKNFEVTVTGAKTIDVRNVVDDTKDKLDFRDRIIKTSLGFNHLVVTTSSQCYVYSTRNWNTPMISDLKEGAVNLILQAEKHFLLADNVGVHVYSYEGRLVCSPKFQGMRTDVLNAQTVTISNDTVAIRDKTDEKVIHLFEATTGKPLGDGKPITHKLEVMEIALDQCGPSNERRLAIIDKNRDLYLTSVRTFGTERKTVKLGTMILSQVWNDNSNMLAAMADGKFTVWYYPNVAYVDRDLLPKTVCEKDASEFGKNPQLLSFLGSHVSLRRADGSLVSTGISPYPAMLHNFVMGARWEDAVRLCRFVKDDTMWSCLAAMAAYAKELNTAEVAYAAINEADKVQYILQIKEIPLKEARNAEMALFSGNPQDAEGILLQAGLVFRAIMQNIQLYNWSRALELAVKHKTHVDTVLAYRQKYLQVFDRTETDKRFEQYAKGVDIDWEKIEQKIEMEYSKEKER 766          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Cavefish
Match: ift80 (intraflagellar transport 80 homolog (Chlamydomonas) [Source:ZFIN;Acc:ZDB-GENE-041212-50])

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 371/773 (47.99%), Postives = 534/773 (69.08%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKL---GTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDR-----ALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVE-KLIREYEQEEKR 2322
            MR KL+  KE +H  + SCVGW++ +E+FSC++DH +LKWN  T E   V++  +  YP ++HW+P++  +    ++ ++   L STDGK+  IS+ GRIEKSVEAH GAVL  RW+ DG AL T GEDG +K+WS++GMLRS+LAQ   PVYS AWG +SD+ILYT G+QL+IK LQ + K + WKAH+G+IL VDW+S+N LI+SGGEDCKYKVW+SYG +LY+S ++DYP+T+VAW+ +G +FAVGS++TLRLCDK GWSY+L+KP  G + SLAWS D TQLA ACG+G VIF H+   R EWRNF + L   R + V NV+ ++V+ LEFRDRV+K S   G+L+VATS  C +YST+NWNTP++ DLKE  V+LI+Q+E+ FL++DGG + +Y+YEGRL+ +PK   ++ ++++A   S+SNDT++VRDK D+KV++LFD+ +GK  GDGKP  HK+ ++E+ALDQ G + DRKIA+IDKN DLYL SVR  G+     K+         + W   N S   +     +++   N+  L              ++F   P I  + G  V+ R+ +GS++   V+PY A+LH+   + +  +AL LCR  K++ LW CLA MA  ++E+ TA++AYAA+ +VDKV+YI  IK +P KE+  A  LL SG+VQ+AE  L+QAGLV++A+ +H+ L++W +     +LEL    + ++  VLAHR++FL   S+ E NK FL+Y      +WE+++ K+  E  +E +R
Sbjct:    1 MRFKLSLLKEPKH--ILSCVGWTTADELFSCSEDHQILKWNLLTNETAVVVKLQDDIYPIDLHWFPKT--VGGKKQATAESFVLTSTDGKFHLISKTGRIEKSVEAHRGAVLAGRWNYDGTALITAGEDGQIKIWSKSGMLRSTLAQQGTPVYSVAWGPDSDRILYTFGRQLIIKPLQPSSKVLQWKAHDGIILKVDWNSMNDLILSGGEDCKYKVWDSYGRLLYSSSSNDYPVTSVAWAPDGEVFAVGSFNTLRLCDKTGWSYALEKPNTGSVFSLAWSADGTQLAGACGNGHVIFAHIVEQRWEWRNFEITLTKRRTMQVRNVSNDAVDILEFRDRVIKASLAHGHLVVATSLQCSLYSTKNWNTPLIFDLKEGTVSLILQAERYFLLVDGGGIYVYSYEGRLVSTPKFAGMRTDILNAQSVSLSNDTIAVRDKTDEKVVYLFDAQTGKAIGDGKPFSHKLEVMEIALDQCGPSSDRKIALIDKNHDLYLTSVRRLGREHSVHKIVSGALFKTSLNWITKNLSSVII----FILFTVSNLPVL-----------LTCSEFSRTPHILNYVGAQVSVRRADGSLVYSSVSPYPALLHEYSGSARWEDALRLCRFAKDQTLWACLAGMAMANRELTTAEVAYAAIQEVDKVQYINFIKDLPSKESSLAHTLLFSGHVQEAEATLLQAGLVYQAIQIHINLYNWGQVRHSLSLELAVKHKTHVDTVLAHRQKFLQVFSKKETNKRFLQYSEGVEVDWEKIQAKIEMELAKERER 754          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 63.929 bits (154), Expect = 1.786e-10
Identity = 43/164 (26.22%), Postives = 84/164 (51.22%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT A+  +++SP+G  L +   D ++K+W S +G    SL+ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + L+VSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   28 VKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 191          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000007962.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 63.929 bits (154), Expect = 1.995e-10
Identity = 43/164 (26.22%), Postives = 84/164 (51.22%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT A+  +++SP+G  L +   D ++K+W S +G    SL+ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + L+VSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   28 VKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 191          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000052579.1 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 63.929 bits (154), Expect = 1.995e-10
Identity = 43/164 (26.22%), Postives = 84/164 (51.22%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT A+  +++SP+G  L +   D ++K+W S +G    SL+ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + L+VSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   28 VKPNYTLKFTLAGHTKAISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASDDKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 191          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 62.3882 bits (150), Expect = 5.768e-10
Identity = 42/164 (25.61%), Postives = 83/164 (50.61%), Query Frame = 1
Query:  310 ISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            +  N  ++ ++  HT AV  +++SP G  L +   D ++K+W + +G    +++ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + LIVSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   31 VKPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 194          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Sea Lamprey
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:795104])

HSP 1 Score: 49.2914 bits (116), Expect = 2.128e-6
Identity = 72/324 (22.22%), Postives = 124/324 (38.27%), Query Frame = 1
Query:   67 HKDLASCVGWS-SGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPT--NMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW----SRNGMLRSSLAQNPVPVYSGAWGGNSDQIL---YTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-----SYGGILYTSVA------------HDYPITAVAW-SCNGNMFAVGSYDTLRLCDK------NGWSYSLDKPQC------GGILSLAWSVDSTQLAAACGSGKVI 918
            H+D A  V WS SG  + SC  D  +  W  +   +V      ++   T  N+ W P    + S +   +  V  +  DG ++       +  ++E H   V  + W+P GN L T   D  V +W      +    S L  +   V    W  NS+ +    Y +  +L  +           + HE  + ++D+ +    +VS G+D   ++W      S GG +  +V             H   I  V+W    G +      DT+R+ ++      +G S    +  C        +  +AWS     L A+CG  +V+
Sbjct:   14 HQDRAWSVAWSPSGALIASCGGDKTVRVWGREGDGWVCRSVLADAHQRTVRNVAWSPCGTRLASASFDATTCV-WSRRDGDFE-------VTATLEGHENEVKGVAWAPSGNLLATCSRDKSVWIWEVDEEEDYECASVLNSHTQDVKHVVWHPNSEVLASASYDNSIRLYREDGDDWSSFATLEGHESTVWSIDFDATGRRLVSCGDDKTIRIWQEGAATSSGGCICVAVGATWECVCTLSGHHTRVIYDVSWCKLTGAIATASGDDTIRVFEEEAVPEGDGKSPRFYEAVCVRKAHDRDVNCVAWSPSDPGLLASCGDDRVV 329          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Sea Lamprey
Match: thoc3 (THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14])

HSP 1 Score: 48.1358 bits (113), Expect = 4.983e-6
Identity = 41/189 (21.69%), Postives = 73/189 (38.62%), Query Frame = 1
Query:  355 GAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPI-FWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAH-DYPITAVAWSCNGNMFAVGSYDT-LRLCDKNG----WSYSLDKPQCGGILSLAWSVDSTQLAAAC 900
            G  + I WSPDG  +  G ++ +V           +  Q    V   +W  ++D    T+G   +       +KPI    AH    + + +        +G  D    +W++        ++  D+P+  +++S +G M A  S D  + + D +     W    D P      ++AW      LA AC
Sbjct:  113 GENINICWSPDGQTIAVGNKEDVVTFIDAKNYKTKAEEQFKFEVNEISWNNDNDLFFLTNGNGCISIMSYPELKPIQSINAHPSNCICIKFDPTGKYFATGSADALVSLWDANELTCVRCLSRLDWPVRTLSFSHDGKMLASASEDHFIDIADVDTGEKLWEVHCDSP----TFTVAWHPKRPLLAFAC 297          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Sea Lamprey
Match: GNB3 (G protein subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:4400])

HSP 1 Score: 46.9802 bits (110), Expect = 6.495e-6
Identity = 38/166 (22.89%), Postives = 79/166 (47.59%), Query Frame = 1
Query:  322 GRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWS-RNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLV-IKSLQANVKPIFWKAHEGVIL---AVDWSSINGLIVSGGEDCKYKVWNSY----GGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            G+   +   H+G V+ +  +PDG A  +G  D   K+W  R+GM R + + +   + +  +  N +     S      +  L+A+ + + + +H+ +I    +V +S    L+++G +D    VW++      G+L     HD  ++ +  + +G   A GS+D+ 
Sbjct:   86 GQQTTAFVGHSGDVMSLALAPDGRAFVSGACDASAKLWDVRDGMCRQTFSGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELVLY-SHDNIICGITSVAFSRSGRLLLAGYDDFNCNVWDAMKAERAGVL---AGHDNRVSCLGVTEDGMAVATGSWDSF 247          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 51.6026 bits (122), Expect = 3.630e-7
Identity = 77/330 (23.33%), Postives = 133/330 (40.30%), Query Frame = 1
Query:   67 HKDLASCVGWSSGEEVFSCAD-DHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRI-EKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRS--------------SLAQN-----------------PVPVYSGAW---------GGNSDQILYTSGKQ--LVIKSLQANVKPIF-WKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGG-ILYTSVAHDYPITAVAWSCNGNMFAVGSYD-TLRLCDKNGWSYSLDKP-QCGGILSLAWSVDSTQLAAACGSGK 912
            H +   CV WS   EV +    D+ +  W+ K+G+ +       S + T++ W P  + +  G+K     +A +S DG  +      R+ + ++  HT +V  ++W   G  L++G  D  V+VW  N   R               SL+ +                 P      A           GNS++++ T+     + + +   + KPI     H+ ++  V +S     IVS   D   K+W+   G  + T   H   +  VAWS +  +    S D TL++ D      S+D P     + ++ WSVD  ++   C  GK
Sbjct:  185 HYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEP-IHLVKPGSKPR---LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRV---CSGGK 506          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Yeast
Match: PFS2 (Integral subunit of the pre-mRNA CPF complex; the cleavage and polyadenylation factor (CPF) complex plays an essential role in mRNA 3'-end formation by bridging different processing factors and thereby promoting the assembly of the processing complex [Source:SGD;Acc:S000005261])

HSP 1 Score: 49.6766 bits (117), Expect = 1.412e-6
Identity = 46/206 (22.33%), Postives = 85/206 (41.26%), Query Frame = 1
Query:  328 IEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRN-GMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLV-IKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSV---AHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQC----GGILSLAW-SVDSTQLAAACGSGKV 915
             E  ++AH  AV  +++S D + + +G  DG++K+W  N  M++   A +   +   A+  N  + +  S   ++ I +     +      H   + + DW    GLI S  +D   K+W+   G   +S+    H    T       GN+    S D  + C      YS+ +  C       ++L W  ++ +    AC  G +
Sbjct:  127 FETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQ-PTKGNLLMAISKD--KSCRVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSL 329          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Yeast
Match: PRP4 (Splicing factor; component of the U4/U6-U5 snRNP complex [Source:SGD;Acc:S000006382])

HSP 1 Score: 47.3654 bits (111), Expect = 7.617e-6
Identity = 61/235 (25.96%), Postives = 96/235 (40.85%), Query Frame = 1
Query:  271 IVALASTDGKYQFISRN--GRIEKSVEAHTGAVLVIRWSPD-GNALFTGGEDGIVKVW---SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKA-----------HEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWS-YSLDKPQCGGILSLAWSVDSTQLAAACGSGKVI 918
            +VA  S  G  Q ++      + + +++H G +  I W PD  N + +  EDG++K +   +  G LR  L  + V    G     SD   + SGK   I S   ++    W A           H+  + ++ +     L+ SGG D    +W+   G  + T   H  PI  VAWS NG   A G  D +     N W     D+ Q   IL+    V   + +   G  K++
Sbjct:  189 VVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLR--LLGDLV----GHERRISDVKYHPSGK--FIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGI----INVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLV 411          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Nematostella
Match: EDO40640 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M0])

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 383/767 (49.93%), Postives = 547/767 (71.32%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNS--DIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIR-EYEQEEKR 2322
            MRLK +  KE +HK+L SCVGW++ EE++S  DDH +L+WN  + E  +V++ P+  +PT++HW+P+      GNK  S  +++ L +TDGK+  ISRNGR+EKSVEAH GAVL  RWS DG+A+ T GEDG VK+WSR+GMLRS+L Q   PVYS AW  +SD ILYTSGKQLVIK LQA  KPI WKAHEG++L +DW+ IN LI+SGGEDCKYKVW+SYG +LY+S  H+YPIT+V+W+ +G +  VGS++TLRLCD+ GWSY+L+KP  G I ++AWS D TQLA ACG+G+VIF HV   RLEW+NF + + + + I V +V  +S + L+FRDR++K +  F +L+VATSS CYIYS +N+NTP++ DLK   ++LI+ S++ FL++D   L IY+YEGRL+ +PK   ++ ++++    S+SNDTL+++D++D+KVI+LF++ SG+  G G+PL H + ++ELAL+Q G   DR++AIIDKNRDLYL  V+  G + + VKLGTMV  + W+D+   LAA+   +  +W YP   F+D+ +L ++++EK S+ FG  P I  F  N    R+ +GS+ S  ++PY A+LH+  +++K ++A+ LCR VK+  LW CLA MA  +KE++TA+ AYAA+ + DKV+YI  IK IP KE R A M L    V +AE +L+QAGLV+RA+  ++ LF+WDRALEL    + ++  VLA R+++LD+  R E +K FL++       WE+V   I  E E+E  R
Sbjct:    1 MRLKTHLLKESKHKELVSCVGWTTAEELYSSGDDHSILRWNLLSDETTEVVKLPQEVFPTDLHWFPK----VLGNKKQSQLELMVLTATDGKFHLISRNGRVEKSVEAHRGAVLSGRWSYDGSAMVTVGEDGQVKIWSRSGMLRSTLMQTGTPVYSVAWSPDSDHILYTSGKQLVIKPLQAAAKPIQWKAHEGIVLKIDWNPINNLILSGGEDCKYKVWDSYGRVLYSSAPHEYPITSVSWAPDGELLGVGSFNTLRLCDRTGWSYALEKPNTGSIFNIAWSNDGTQLAGACGNGQVIFAHVIERRLEWKNFEMTVTERKSINVRDVVNDSKDTLDFRDRIIKTALGFQHLVVATSSQCYIYSVKNFNTPMIFDLKNGNISLIVLSKRHFLVVDDAGLQIYSYEGRLISAPKFQGLRTDVLNEQTVSLSNDTLAIKDRKDEKVIYLFEASSGRAVGSGEPLTHTMEVMELALNQCGPTGDRQLAIIDKNRDLYLTPVKHIGPAAKLVKLGTMVTSMAWNDSTNMLAALQDGRFTVWYYPTAVFVDQDILPKTLLEKDSSDFGKNPHILNFLENHCNMRRADGSLCSTIISPYPAMLHKYCSDSKWDDAVRLCRFVKDPALWACLATMAAYAKELNTAETAYAAIDEADKVQYINHIKEIPTKEGRNAAMALFCRQVMEAETILLQAGLVYRAIQTNIDLFNWDRALELAVKHKTHVDTVLAFRQKYLDNFGRKETSKRFLQFAQGVEVNWEKVNAKIEVELEKEASR 763          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 57.7658 bits (138), Expect = 8.753e-9
Identity = 44/169 (26.04%), Postives = 71/169 (42.01%), Query Frame = 1
Query:  337 SVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIK--SLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDK 834
            S+ AH   V   ++SPDG  + +G +D  +K+W R          +P    +      S   +   G    +K   ++ N     ++AH G + +V +      +VS   D   K+ +   G + YT   H  P T+V +S NG  FA GS D   +     W  + DK
Sbjct:  139 SLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMV----WKTNFDK 303          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Nematostella
Match: EDO40986 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J4])

HSP 1 Score: 55.0694 bits (131), Expect = 6.883e-8
Identity = 50/210 (23.81%), Postives = 90/210 (42.86%), Query Frame = 1
Query:  118 SCADDHMLLKWN------NKT----GEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLR-----------SSLAQNPVPVYSGAWGGNSDQILY-TSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVW 681
            SCADD ++  W+       KT    G  VK I+           W+P  + + SG+K +   + L  T        R G    ++  H   V+ I+W+ +GN L T   D ++K++    M             +++A +P+     A GG+   I++  SG    + ++++        AHEG++ ++ W  +  ++ SG  D   K W
Sbjct:  183 SCADDGLVKIWDFYRCMEEKTLRGHGADVKCID-----------WHPHKSLLVSGSKDSQQPIKLWDT--------RTGNGLATLHLHKSTVMSIKWNQNGNWLLTASRDHLLKLFDIRAMKELQAFRGHKREATAIAWHPIHENLFASGGSDGAIMFWMSGSDKDVGNMES--------AHEGMVWSLAWHPLGHILCSGSNDHTSKFW 365          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Nematostella
Match: EDO32418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV44])

HSP 1 Score: 52.7582 bits (125), Expect = 1.197e-7
Identity = 46/200 (23.00%), Postives = 88/200 (44.00%), Query Frame = 1
Query:  241 MTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCK-YKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYD-TLRLCDKNGWSYSLDK 834
            +T  N+    I  L + D + Q ++           HTG++    W+ + N +++GG+D ++++W    +  +   Q P  + +     + + ++ T G  +V    ++ +  I       ++            V+GGED K YK     G  L +   H  P+  V +S +G ++A GS D TLRL     W +++ K
Sbjct:   22 LTGSNEKILRIFDLQNLDSEPQVLT----------GHTGSIKTALWNKENNMVYSGGDDKMIRLWDTRTLENTRNIQLPHNLTNMDMSRDGNVLVITHGTTVVFYETES-MDVIKSFEMPTLVYGASLHPDKSCFVAGGEDLKIYKFDYDTGKELESYKGHFGPVHCVRYSPDGELYASGSEDGTLRL-----WQHTVGK 205          

HSP 2 Score: 48.1358 bits (113), Expect = 4.119e-6
Identity = 37/138 (26.81%), Postives = 56/138 (40.58%), Query Frame = 1
Query:  112 VFSCADDHMLLKWNNKTGEFVKVIEFPES----------------------FYPTNMHWYPRSNEM------TSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSR 441
            V+S  DD M+  W+ +T E  + I+ P +                      FY T      +S EM       S +   S  VA       Y+F    G+  +S + H G V  +R+SPDG    +G EDG +++W  
Sbjct:   64 VYSGGDDKMIRLWDTRTLENTRNIQLPHNLTNMDMSRDGNVLVITHGTTVVFYETESMDVIKSFEMPTLVYGASLHPDKSCFVAGGEDLKIYKFDYDTGKELESYKGHFGPVHCVRYSPDGELYASGSEDGTLRLWQH 201          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Nematostella
Match: EDO44795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR9])

HSP 1 Score: 52.7582 bits (125), Expect = 1.855e-7
Identity = 43/173 (24.86%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  313 SRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-------SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYD-TLRLCD 804
            S+ G +   ++ H GAV  +R SPDG  + +   D  +++W+ +     SL  +   V S A+  N  +++  +  K+L +  +++         H+G  + +D+S    L+ S G D    +W+         G I+     H   +  VA+S +G +   GS D T+R+ D
Sbjct:   17 SKTGALLAQLDGHAGAVTCVRVSPDGGVIASSSADKTIRLWNPSDEFLRSLEGHEDRVTSLAFSKNGKRLVSVALDKKLKVWDVESGNLLDTLTGHDGYPVCLDFSPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWD 189          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Medaka
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:101157236])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 382/752 (50.80%), Postives = 542/752 (72.07%), Query Frame = 1
Query:   67 HKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKR 2322
            HKDL SC+GW++ +E++SC+DDH +LKWN    E   V++  E  YP +MHW+P++  +    ++ ++I  L STDGK+  +S+ GRIEKSV+AH GAVL  RW+ DG AL T GEDG++K+WS+ GMLRS+LA    PVYS AWG +SD+ILYTSG QL IK LQ + K + WKAH+G++L VDW+S+N LI+SGGEDCKYKVW+S+G +L++S  HDYP+T+++W+ +G MFAVGS++TLRLCDK GWSY+++KP  G + SLAWS DSTQLA ACG+G VIF HV     EW+NFV+ L   R + V NV  ++V+ L+FRD V+K S  F +L+VATS  CY+YS+RNWNTP++ DLKE  V+LI+Q+EK FL++DG  L +++YEGRL+ SPK ++++A+ ++A + S+ +DT+++RD +D+KVI  FD  +GK  GDG PL HK+ ++E+ALDQ G A DRKIA+IDKNRDLYL SVR +G+  +  K+GTMV+ I W+D    L  +   +L +WCYP++ F DK LL +++  + S++F S P I  FSG  VT R+ +GS++   V PY+A+LH+  ++ +  +AL LCR VK++ LW CLA+MA  ++E+ TA++AY A+ ++ +VEYI MIK  P KE+  A MLL SG VQ+AE  L+QAGL+++A+ V++ LF+W+RALEL    + ++  VLAHR +FL    + E NK FL Y       WE +   I E E  ++R
Sbjct:   22 HKDLVSCLGWTTADELYSCSDDHQILKWNLVNNETNVVVKLSEDIYPLDMHWFPKT--VGGKRQTQAEIFVLTSTDGKFHLVSKMGRIEKSVDAHKGAVLAGRWNYDGTALVTAGEDGLIKIWSKVGMLRSTLANQGSPVYSVAWGPDSDRILYTSGVQLTIKPLQPSAKVMQWKAHDGLVLKVDWNSVNSLILSGGEDCKYKVWDSFGRLLHSSSPHDYPVTSLSWAPDGEMFAVGSFNTLRLCDKTGWSYAVEKPHTGSLFSLAWSADSTQLAGACGNGHVIFAHVLEQCWEWKNFVITLTKRRSMQVTNVMNDAVDILDFRDPVIKASLAFAHLVVATSLQCYVYSSRNWNTPLIFDLKEGTVSLILQAEKHFLLVDGAGLYVFSYEGRLISSPKFLDMRADSLNAQVISLCDDTIAIRDNRDEKVILFFDVLTGKAVGDGNPLTHKLEVVEIALDQCGPATDRKIALIDKNRDLYLASVRHFGRETKICKIGTMVDNIAWNDAANILCGIQDNQLTVWCYPSVVFTDKELLPKTLHIRDSSEFNSAPRILNFSGTKVTLRQGDGSLVYSSVPPYIALLHEYCSSARWEDALCLCRLVKDQSLWACLASMAMANRELTTAEMAYGAIGELPRVEYISMIKEQPSKESALAHMLLFSGQVQEAESALLQAGLIYQAIQVNIDLFNWERALELAVKHKTHVDTVLAHREKFLQKFGKKETNKRFLHYSEGVDVNWENIRAKI-EMELSKER 770          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Medaka
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:101157236])

HSP 1 Score: 822.772 bits (2124), Expect = 0.000e+0
Identity = 388/765 (50.72%), Postives = 547/765 (71.50%), Query Frame = 1
Query:   31 MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDV-DKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKR 2322
            MRLK   +    HKDL SC+GW++ +E++SC+DDH +LKWN    E   V++  E  YP +MHW+P++  +    ++ ++I  L STDGK+  +S+ GRIEKSV+AH GAVL  RW+ DG AL T GEDG++K+WS+ GMLRS+LA    PVYS AWG +SD+ILYTSG QL IK LQ + K + WKAH+G++L VDW+S+N LI+SGGEDCKYKVW+S+G +L++S  HDYP+T+++W+ +G MFAVGS++TLRLCDK GWSY+++KP  G + SLAWS DSTQLA ACG+G VIF HV     EW+NFV+ L   R + V NV  ++V+ L+FRD V+K S  F +L+VATS  CY+YS+RNWNTP++ DLKE  V+LI+Q+EK FL++DG  L +++YEGRL+ SPK ++++A+ ++A + S+ +DT+++RD +D+KVI  FD  +GK  GDG PL HK+ ++E+ALDQ G A DRKIA+IDKNRDLYL SVR +G+  +  K+GTMV+ I W+D    L  +   +L +WCYP++ F DK LL +++  + S++F S P I  FSG  VT R+ +GS++   V PY+A+LH+  ++ +  +AL LCR VK++ LW CLA+MA  ++E+ TA++AY A+ +V D VEYI MIK  P KE+  A MLL SG VQ+AE  L+QAGL+++A+ V++ LF+W+RALEL    + ++  VLAHR +FL    + E NK FL Y       WE +   I E E  ++R
Sbjct:    1 MRLKTTLS----HKDLVSCLGWTTADELYSCSDDHQILKWNLVNNETNVVVKLSEDIYPLDMHWFPKT--VGGKRQTQAEIFVLTSTDGKFHLVSKMGRIEKSVDAHKGAVLAGRWNYDGTALVTAGEDGLIKIWSKVGMLRSTLANQGSPVYSVAWGPDSDRILYTSGVQLTIKPLQPSAKVMQWKAHDGLVLKVDWNSVNSLILSGGEDCKYKVWDSFGRLLHSSSPHDYPVTSLSWAPDGEMFAVGSFNTLRLCDKTGWSYAVEKPHTGSLFSLAWSADSTQLAGACGNGHVIFAHVLEQCWEWKNFVITLTKRRSMQVTNVMNDAVDILDFRDPVIKASLAFAHLVVATSLQCYVYSSRNWNTPLIFDLKEGTVSLILQAEKHFLLVDGAGLYVFSYEGRLISSPKFLDMRADSLNAQVISLCDDTIAIRDNRDEKVILFFDVLTGKAVGDGNPLTHKLEVVEIALDQCGPATDRKIALIDKNRDLYLASVRHFGRETKICKIGTMVDNIAWNDAANILCGIQDNQLTVWCYPSVVFTDKELLPKTLHIRDSSEFNSAPRILNFSGTKVTLRQGDGSLVYSSVPPYIALLHEYCSSARWEDALCLCRLVKDQSLWACLASMAMANRELTTAEMAYGAIGEVRDLVEYISMIKEQPSKESALAHMLLFSGQVQEAESALLQAGLIYQAIQVNIDLFNWERALELAVKHKTHVDTVLAHREKFLQKFGKKETNKRFLHYSEGVDVNWENIRAKI-EMELSKER 758          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Medaka
Match: ift80 (intraflagellar transport 80 [Source:NCBI gene;Acc:101157236])

HSP 1 Score: 818.92 bits (2114), Expect = 0.000e+0
Identity = 376/728 (51.65%), Postives = 533/728 (73.21%), Query Frame = 1
Query:   67 HKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKY 2250
            HKDL SC+GW++ +E++SC+DDH +LKWN    E   V++  E  YP +MHW+P++  +    ++ ++I  L STDGK+  +S+ GRIEKSV+AH GAVL  RW+ DG AL T GEDG++K+WS+ GMLRS+LA    PVYS AWG +SD+ILYTSG QL IK LQ + K + WKAH+G++L VDW+S+N LI+SGGEDCKYKVW+S+G +L++S  HDYP+T+++W+ +G MFAVGS++TLRLCDK GWSY+++KP  G + SLAWS DSTQLA ACG+G VIF HV     EW+NFV+ L   R + V NV  ++V+ L+FRD V+K S  F +L+VATS  CY+YS+RNWNTP++ DLKE  V+LI+Q+EK FL++DG  L +++YEGRL+ SPK ++++A+ ++A + S+ +DT+++RD +D+KVI  FD  +GK  GDG PL HK+ ++E+ALDQ G A DRKIA+IDKNRDLYL SVR +G+  +  K+GTMV+ I W+D    L  +   +L +WCYP++ F DK LL +++  + S++F S P I  FSG  VT R+ +GS++   V PY+A+LH+  ++ +  +AL LCR VK++ LW CLA+MA  ++E+ TA++AY A+ ++ +VEYI MIK  P KE+  A MLL SG VQ+AE  L+QAGL+++A+ V++ LF+W+RALEL    + ++  VLAHR +FL    + E NK FL Y
Sbjct:   22 HKDLVSCLGWTTADELYSCSDDHQILKWNLVNNETNVVVKLSEDIYPLDMHWFPKT--VGGKRQTQAEIFVLTSTDGKFHLVSKMGRIEKSVDAHKGAVLAGRWNYDGTALVTAGEDGLIKIWSKVGMLRSTLANQGSPVYSVAWGPDSDRILYTSGVQLTIKPLQPSAKVMQWKAHDGLVLKVDWNSVNSLILSGGEDCKYKVWDSFGRLLHSSSPHDYPVTSLSWAPDGEMFAVGSFNTLRLCDKTGWSYAVEKPHTGSLFSLAWSADSTQLAGACGNGHVIFAHVLEQCWEWKNFVITLTKRRSMQVTNVMNDAVDILDFRDPVIKASLAFAHLVVATSLQCYVYSSRNWNTPLIFDLKEGTVSLILQAEKHFLLVDGAGLYVFSYEGRLISSPKFLDMRADSLNAQVISLCDDTIAIRDNRDEKVILFFDVLTGKAVGDGNPLTHKLEVVEIALDQCGPATDRKIALIDKNRDLYLASVRHFGRETKICKIGTMVDNIAWNDAANILCGIQDNQLTVWCYPSVVFTDKELLPKTLHIRDSSEFNSAPRILNFSGTKVTLRQGDGSLVYSSVPPYIALLHEYCSSARWEDALCLCRLVKDQSLWACLASMAMANRELTTAEMAYGAIGELPRVEYISMIKEQPSKESALAHMLLFSGQVQEAESALLQAGLIYQAIQVNIDLFNWERALELAVKHKTHVDTVLAHREKFLQKFGKKETNKRFLHY 747          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 62.3882 bits (150), Expect = 6.145e-10
Identity = 42/161 (26.09%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  319 NGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            N  ++ ++  HT AV  +++SP G  L +   D ++K+W + +G    +++ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + LIVSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   33 NYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 193          
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 62.003 bits (149), Expect = 7.370e-10
Identity = 42/161 (26.09%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  319 NGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVW-SRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTS-GKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWN-SYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTL 792
            N  ++ ++  HT AV  +++SP G  L +   D ++K+W + +G    +++ + + +   AW  +S+ ++  S  K L I  + +       K H   +   +++  + LIVSG  D   ++W+   G  L T  AH  P++AV ++ +G++    SYD L
Sbjct:   34 NYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 194          
BLAST of intraflagellar transport protein 80 homolog vs. Planmine SMEST
Match: SMESG000066998.1 (SMESG000066998.1)

HSP 1 Score: 1484.16 bits (3841), Expect = 0.000e+0
Identity = 730/731 (99.86%), Postives = 730/731 (99.86%), Query Frame = 1
Query:  136 MLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLIXXXXXXXXXXXXLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKRNS 2328
            MLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEM SGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLITVNNVTENSVENLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKRNS
Sbjct:    1 MLLKWNNKTGEFVKVIEFPESFYPTNMHWYPRSNEMISGNKSNSDIVALASTDGKYQFISRNGRIEKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHVTNVRLEWRNFVVLLADERLITVNNVTENSVENLEFRDRVVKMSFKFGYLLVATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYTYEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSGKPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQSRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRSIIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTNNKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEYIEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSWDRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEEVEKLIREYEQEEKRNS 731          
BLAST of intraflagellar transport protein 80 homolog vs. Planmine SMEST
Match: SMESG000010494.1 (SMESG000010494.1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.042e-7
Identity = 45/162 (27.78%), Postives = 74/162 (45.68%), Query Frame = 1
Query:  334 KSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWS-RNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIK--SLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGGI-LYTSVAHDYPITAVAWSCNGNMFAVGSYD-TLRLCD 804
            + V  HTG V  I +SPD     TG +D ++K+W+  NG LR SL  + V    G    +    +++ G+   +K   L+ N     +  H   +  +D      L+++GG D   +VW+    I ++    H   + +V    N      GS+D T+RL D
Sbjct:  131 RVVSGHTGWVRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGH-VSGVRGVKISHRHPYVFSCGEDKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWD 291          
BLAST of intraflagellar transport protein 80 homolog vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.086e-7
Identity = 42/162 (25.93%), Postives = 70/162 (43.21%), Query Frame = 1
Query:  337 SVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRN-----------GMLRSSLAQNPVPVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKYKVWNSYGG-ILYTSVAHDYPITAVAWSCNGNMFAVGSYD 786
            S+  H   V  +R+S DG  + +  +D  +K+W R+           G    SLA +P   Y  + G +S          + I  ++ N     + +H   + AV +      ++S  +D   K+++   G +LYT   H+ PI   A+S  G MFA G  D
Sbjct:  135 SLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDS---------HVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGAD 287          
BLAST of intraflagellar transport protein 80 homolog vs. Planmine SMEST
Match: SMESG000042345.1 (SMESG000042345.1)

HSP 1 Score: 53.5286 bits (127), Expect = 5.053e-7
Identity = 42/177 (23.73%), Postives = 74/177 (41.81%), Query Frame = 1
Query:  337 SVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGM------------LRS----SLAQNPVPVYSGAWGGNSDQILYTSGKQLVIK-SLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGED------------CKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGS 780
            ++  H   V V+RWSP GN L +  +DGI+ +W+++              L S    SL ++ + VY   W  N + ++  S     I   L+   K I  K H+  +  V W  ++ ++++   D            C YKVW S    L+   +  Y    + +S +G +    +
Sbjct:   63 NLNRHEKRVNVVRWSPSGNILASASDDGIIILWTKSKEAVPQKIDDDDVNLESWSPRSLRRHFLDVYDVCWSLNENHLISGSVDCCAILWDLKNTNKVIILKDHKQFVQGVAWDPLDNVVITQSSDRTMRVYRASTRTCIYKVWKSGDSKLFQDGSWKYFFRRLEFSPDGKLLVTPA 239          
BLAST of intraflagellar transport protein 80 homolog vs. Planmine SMEST
Match: SMESG000057676.1 (SMESG000057676.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.299e-6
Identity = 46/163 (28.22%), Postives = 74/163 (45.40%), Query Frame = 1
Query:  361 VLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPVPVYSGAWGGNSDQILYTSG--KQLVIKSLQANVKPIFWKAHEGVILAVDWSSINGLIVSGGEDCKY---KVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGSYD-TLRLCDKNGWSYSLD 831
            V  + W+ DG+ L TG  DG  ++W+ +G L S+L Q+  P+++  W    + +L T+G  K  ++     N     +  H+   L VDW        S   D K    KV N+   ++ T   H+  + A+ W   G   A  S D +L+L     WS + D
Sbjct:  309 VTSLDWNTDGSLLATGSYDGFARIWNIDGTLVSTLGQHKGPIFALKWNKKGNYVL-TAGVDKTTIVWEASTNTMIQQFSFHKAPTLDVDWKDAK-TFGSCSTDSKIHICKVGNT--SVVKTFKGHENEVNAIKWDPTGRFLASCSDDKSLKL-----WSMNED 462          
The following BLAST results are available for this feature:
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT800.000e+048.69intraflagellar transport 80 [Source:HGNC Symbol;Ac... [more]
IFT800.000e+048.96intraflagellar transport 80 [Source:HGNC Symbol;Ac... [more]
IFT800.000e+048.96intraflagellar transport 80 [Source:HGNC Symbol;Ac... [more]
AC079594.20.000e+048.53TRIM59 and iFT80 readthrough[more]
IFT802.194e-6351.67intraflagellar transport 80 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-20.000e+040.21CHE-2 protein [Source:UniProtKB/TrEMBL;Acc:G5EGF0... [more]
che-20.000e+040.21CHE-2 protein [Source:UniProtKB/TrEMBL;Acc:G5EGF0... [more]
wdr-5.16.371e-1127.95WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.16.371e-1127.95WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.38.771e-928.09WD repeat-containing protein wdr-5.3 [Source:UniP... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oseg51.153e-14933.69gene:FBgn0032891 transcript:FBtr0290042[more]
wds4.227e-1027.11gene:FBgn0040066 transcript:FBtr0308566[more]
wds4.227e-1027.11gene:FBgn0040066 transcript:FBtr0070438[more]
Poc12.484e-922.91gene:FBgn0036354 transcript:FBtr0321318[more]
Poc12.686e-922.91gene:FBgn0036354 transcript:FBtr0075863[more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ift800.000e+048.89intraflagellar transport 80 homolog (Chlamydomonas... [more]
ift800.000e+048.89intraflagellar transport 80 homolog (Chlamydomonas... [more]
wdr51.978e-1025.61WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
wdr57.512e-1025.61WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
tbl1xr1b9.974e-1025.71transducin (beta)-like 1 X-linked receptor 1b [Sou... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ift800.000e+049.02intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
ift800.000e+049.07intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
ift800.000e+049.93intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
ift800.000e+048.74intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
ift800.000e+048.37intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ift800.000e+048.76intraflagellar transport 80 [Source:MGI Symbol;Acc... [more]
Ift800.000e+048.76intraflagellar transport 80 [Source:MGI Symbol;Acc... [more]
Ift800.000e+048.76intraflagellar transport 80 [Source:MGI Symbol;Acc... [more]
Ift802.212e-7853.55intraflagellar transport 80 [Source:MGI Symbol;Acc... [more]
Ift802.005e-5350.63intraflagellar transport 80 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K057|IFT80_MOUSE0.000e+048.76Intraflagellar transport protein 80 homolog OS=Mus... [more]
sp|Q9P2H3|IFT80_HUMAN0.000e+048.69Intraflagellar transport protein 80 homolog OS=Hom... [more]
sp|Q66HB3|IFT80_RAT0.000e+048.50Intraflagellar transport protein 80 homolog OS=Rat... [more]
sp|Q9D7H2|WDR5B_MOUSE2.556e-1227.95WD repeat-containing protein 5B OS=Mus musculus OX... [more]
sp|Q4V8C4|WDR5B_RAT5.546e-1227.95WD repeat-containing protein 5B OS=Rattus norvegic... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JF990.000e+052.16WD_REPEATS_REGION domain-containing protein OS=Bio... [more]
A0A210PXE80.000e+050.85Intraflagellar transport protein 80-like OS=Mizuho... [more]
R7TDL00.000e+051.63WD_REPEATS_REGION domain-containing protein OS=Cap... [more]
V4B1Q10.000e+051.69WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A1S3JZ540.000e+051.83intraflagellar transport protein 80 homolog OS=Lin... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ift800.000e+047.99intraflagellar transport 80 homolog (Chlamydomonas... [more]
ENSAMXT00000007963.21.786e-1026.22WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000007962.21.995e-1026.22WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000052579.11.995e-1026.22WD repeat-containing protein 5-like [Source:NCBI g... [more]
wdr55.768e-1025.61WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ciao12.128e-622.22cytosolic iron-sulfur assembly component 1 [Source... [more]
thoc34.983e-621.69THO complex 3 [Source:ZFIN;Acc:ZDB-GENE-040808-14][more]
GNB36.495e-622.89G protein subunit beta 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RSA43.630e-723.33WD-repeat protein involved in ribosome biogenesis;... [more]
PFS21.412e-622.33Integral subunit of the pre-mRNA CPF complex; the ... [more]
PRP47.617e-625.96Splicing factor; component of the U4/U6-U5 snRNP c... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406400.000e+049.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453468.753e-926.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409866.883e-823.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324181.197e-723.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447951.855e-724.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ift800.000e+050.80intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
ift800.000e+050.72intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
ift800.000e+051.65intraflagellar transport 80 [Source:NCBI gene;Acc:... [more]
wdr56.145e-1026.09WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
wdr57.370e-1026.09WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
back to top
BLAST of intraflagellar transport protein 80 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066998.10.000e+099.86SMESG000066998.1[more]
SMESG000010494.13.042e-727.78SMESG000010494.1[more]
SMESG000024482.13.086e-725.93SMESG000024482.1[more]
SMESG000042345.15.053e-723.73SMESG000042345.1[more]
SMESG000057676.11.299e-628.22SMESG000057676.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009510 ID=SMED30009510|Name=intraflagellar transport protein 80 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2373bp
AATTAATTAATAAATTTAAAATTTATTAAAATGCGCTTGAAACTAAATGA
AAATAAAGAACAAGAACATAAAGATTTGGCCAGTTGTGTAGGTTGGTCAT
CTGGCGAAGAAGTTTTCAGTTGTGCTGATGATCATATGTTACTAAAATGG
AATAATAAAACTGGAGAATTTGTGAAAGTTATTGAATTTCCAGAAAGTTT
TTATCCAACTAATATGCATTGGTATCCACGATCAAATGAAATGACATCGG
GAAATAAAAGCAATTCTGATATTGTAGCACTTGCATCTACAGATGGTAAA
TATCAATTTATTTCTCGAAATGGTCGCATAGAAAAGTCGGTTGAAGCTCA
CACGGGGGCTGTTCTCGTCATCCGGTGGAGTCCTGATGGCAATGCTTTGT
TTACCGGTGGAGAAGACGGTATTGTTAAAGTGTGGTCGCGAAATGGAATG
CTGAGATCAAGTCTAGCTCAAAATCCGGTTCCAGTCTATTCTGGCGCGTG
GGGTGGAAATTCCGATCAAATTCTTTACACATCTGGCAAACAGCTCGTGA
TCAAATCTTTGCAAGCTAACGTGAAACCGATCTTCTGGAAAGCACACGAA
GGCGTTATTCTGGCTGTTGATTGGAGTTCTATCAATGGATTGATAGTTTC
TGGTGGTGAAGATTGTAAATATAAGGTGTGGAATAGTTACGGTGGTATTC
TCTATACTAGCGTGGCTCATGACTACCCAATCACTGCGGTGGCTTGGTCA
TGCAATGGAAATATGTTTGCCGTAGGAAGCTATGACACCCTGCGTCTTTG
TGACAAAAATGGCTGGTCCTATAGTCTTGACAAGCCTCAATGTGGGGGTA
TTTTATCTCTGGCCTGGTCTGTTGATAGCACTCAGTTAGCAGCTGCTTGT
GGCAGCGGTAAAGTTATCTTTGGTCATGTTACAAATGTTCGCTTGGAATG
GAGAAATTTCGTTGTATTGTTGGCGGATGAAAGACTAATAACAGTTAATA
ATGTTACAGAAAATTCCGTTGAAAATCTCGAATTTCGTGACCGTGTTGTA
AAAATGTCGTTTAAATTTGGATACCTTCTTGTTGCAACATCTTCGACATG
TTATATTTACAGCACTCGCAACTGGAATACCCCAGTCGTAATTGACCTAA
AAGAAGCACGTGTTACTCTAATAATGCAAAGTGAAAAGCTATTTTTAATA
ATTGATGGGGGTAATTTGCTCATTTATACCTATGAAGGTCGATTGCTATG
TAGTCCGAAAAGTGTAAATATCCAAGCTGAGATGATGCATGCTTCCCTGT
GCTCTATCAGCAATGATACTCTCTCTGTCCGGGATAAGCAAGATGATAAA
GTTATACATTTATTTGACAGTCATTCCGGTAAACCCAGTGGTGATGGAAA
GCCGCTTATACATAAAATTGGGATAATTGAGTTAGCACTTGACCAATCAG
GAAATGCTCCAGATAGGAAAATTGCCATCATAGATAAAAATAGGGACCTA
TATCTGTATTCGGTTAGGAGTTATGGACAAAGTCGTCGTTCAGTTAAATT
AGGAACTATGGTCAATTGTATTTGTTGGCACGATAATAATCCTTCGTTGG
CAGCCGTTGCAGGGGAGAAACTAATGATATGGTGTTATCCAAATATAGCA
TTTCTAGATAAATCGCTACTATCGCGTTCGATCATTGAAAAACCATCTAA
CCAATTCGGTTCTGAGCCCACTATACAAACTTTCTCTGGAAATAGCGTCA
CTTTTCGAAAGCAGGAGGGCAGTGTCATTTCGTGTTTCGTTGCACCATAT
GTTGCGGTTCTTCATCAGTTATTCACTAACAACAAATTAAATGAAGCTCT
CGCACTTTGCCGATCTGTGAAGGAGGAATGCTTGTGGTGCTGCCTGGCAG
CGATGGCCACCCTGAGCAAGGAGATCGATACCGCACAGATTGCATATGCG
GCACTGAGTGATGTGGACAAAGTGGAATATATCGAAATGATCAAACGGAT
CCCAGAAAAGGAAGCCCGGCAAGCCGAAATGCTGCTAATCAGCGGAAATG
TCCAGGACGCCGAGGGAATGCTTATGCAGGCCGGTTTAGTGTTCCGTGCC
GTAATGGTGCATTTGCGGCTGTTCAGTTGGGACAGGGCGCTCGAGTTGAC
CGCCACGAAACAGAAATATTTACCATTGGTTCTGGCACATCGGAGGAGAT
TTCTCGACAGCCTTTCACGATTGGAAAACAACAAAAACTTCCTGAAATAT
CTGAATGAACCGGTTCCGGAATGGGAGGAAGTGGAGAAACTGATCAGAGA
ATATGAGCAAGAAGAAAAAAGAAACAGCTAACTGATTTATTTTTTGTTTG
AAATGTGTTTTAATAAATTATTG
back to top

protein sequence of SMED30009510-orf-1

>SMED30009510-orf-1 ID=SMED30009510-orf-1|Name=SMED30009510-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=767bp
MRLKLNENKEQEHKDLASCVGWSSGEEVFSCADDHMLLKWNNKTGEFVKV
IEFPESFYPTNMHWYPRSNEMTSGNKSNSDIVALASTDGKYQFISRNGRI
EKSVEAHTGAVLVIRWSPDGNALFTGGEDGIVKVWSRNGMLRSSLAQNPV
PVYSGAWGGNSDQILYTSGKQLVIKSLQANVKPIFWKAHEGVILAVDWSS
INGLIVSGGEDCKYKVWNSYGGILYTSVAHDYPITAVAWSCNGNMFAVGS
YDTLRLCDKNGWSYSLDKPQCGGILSLAWSVDSTQLAAACGSGKVIFGHV
TNVRLEWRNFVVLLADERLITVNNVTENSVENLEFRDRVVKMSFKFGYLL
VATSSTCYIYSTRNWNTPVVIDLKEARVTLIMQSEKLFLIIDGGNLLIYT
YEGRLLCSPKSVNIQAEMMHASLCSISNDTLSVRDKQDDKVIHLFDSHSG
KPSGDGKPLIHKIGIIELALDQSGNAPDRKIAIIDKNRDLYLYSVRSYGQ
SRRSVKLGTMVNCICWHDNNPSLAAVAGEKLMIWCYPNIAFLDKSLLSRS
IIEKPSNQFGSEPTIQTFSGNSVTFRKQEGSVISCFVAPYVAVLHQLFTN
NKLNEALALCRSVKEECLWCCLAAMATLSKEIDTAQIAYAALSDVDKVEY
IEMIKRIPEKEARQAEMLLISGNVQDAEGMLMQAGLVFRAVMVHLRLFSW
DRALELTATKQKYLPLVLAHRRRFLDSLSRLENNKNFLKYLNEPVPEWEE
VEKLIREYEQEEKRNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0005929cilium
GO:0030992intraciliary transport particle B
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0001649osteoblast differentiation
GO:0002062chondrocyte differentiation
GO:0007224smoothened signaling pathway
GO:0035735intraciliary transport involved in cilium assembly
GO:0042073intraciliary transport
GO:0045880positive regulation of smoothened signaling pathway
GO:0050680negative regulation of epithelial cell proliferation
GO:0060271cilium morphogenesis
GO:0060349bone morphogenesis
GO:1905515non-motile cilium assembly
GO:2000051negative regulation of non-canonical Wnt signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 97..136
e-value: 3.7E-9
score: 46.4
coord: 501..535
e-value: 36.0
score: 7.1
coord: 4..41
e-value: 16.0
score: 9.3
coord: 179..218
e-value: 0.0017
score: 27.6
coord: 259..299
e-value: 56.0
score: 6.0
coord: 220..258
e-value: 0.005
score: 26.1
IPR001680WD40 repeatPFAMPF00400WD40coord: 102..136
e-value: 1.2E-4
score: 22.8
coord: 228..256
e-value: 0.092
score: 13.7
coord: 187..218
e-value: 0.26
score: 12.2
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 104..136
score: 14.986
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 186..218
score: 10.575
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 2..148
e-value: 3.9E-14
score: 54.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 310..585
e-value: 8.6E-8
score: 33.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 150..303
e-value: 6.3E-21
score: 76.4
NoneNo IPR availablePANTHERPTHR24098FAMILY NOT NAMEDcoord: 1..762
NoneNo IPR availablePANTHERPTHR24098:SF0INTRAFLAGELLAR TRANSPORT 80 HOMOLOG (CHLAMYDOMONAS)coord: 1..762
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 186..227
score: 9.652
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 104..145
score: 12.895
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 268..538
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 11..297