Tyrosine-protein kinase receptor

Overview
NameTyrosine-protein kinase receptor
Smed IDSMED30009509
Length (bp)4604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase receptor (SMED30009509) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase receptor (SMED30009509) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase receptor (SMED30009509) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase receptor (SMED30009509) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009509

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30009509SMESG000041357.1 dd_Smed_v4_9006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009509SMESG000041357.1 dd_Smed_v4_9006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: INSRR (insulin receptor related receptor [Source:HGNC Symbol;Acc:HGNC:6093])

HSP 1 Score: 208.379 bits (529), Expect = 3.611e-111
Identity = 232/981 (23.65%), Postives = 397/981 (40.47%), Query Frame = 1
Query:  127 KICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP-----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSK------KNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKL--WTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEF--RFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQA-MCDTCSICKKTCERN---PQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPME---NTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            ++C   DIR     +  L + + C++VEG + I  +        R   FP L +VTDY+LL F     ++  ++FPNL VIRG  L  G AL+++     R +   +L ++  G V V  N  LC++  IDW  +         +    +I  NK      C+++CP           + T        CW+ + CQ +C        + C       CCH +CLGGC    + + CVAC+ L ++  C+ +CP G Y+++  RCV    C+       +  +   +   C+ +CPS    +  + + +C     +  K  K  G   + S +    +  C   E  +I     G +L  +L+     +  +  F++I  S  L SL F   L  I+G A +   N TL +  N  L +L  W       I  G + F  N  LC   I+      G +      E+   TNG  A C    L       ++  + L W+  +    + +LS + YY+               C +  W++++ +    +  + GV L                  +SLKP T Y V++      T +DS    A S  V+  T    P+ PQ + S S++ + + + WKPP   NG +T Y++ + + A   + + N+Y ++      +N        N  +   ++  P+A M   C  C+         P + +E     +F+  +H+ I +     +P  ++S N                   S  H+   ++  P+    N+S   +++ ++P      +   V++ L +FTEY I+I AC       N++   +       CS       RT    + D IP    K     +  N  + + W  PP  NGLIL Y++ YR   +       T  C++         +H          +  P  G Y  ++   +LAGNG+W+
Sbjct:   28 EVCPSLDIRS---EVAELRQLENCSVVEGHLQILLMFTATGEDFRGLSFPRLTQVTDYLLL-FRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEMPHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQ-------PAPGANHIVGNKL--GEECADVCPGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPC---PHGMACTARGE--CCHTECLGGCSQPEDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSCLAQCPSGFTRN--SSSIFCHKCEGLCPKECK-VGTKTIDSIQAAQDLVGCTHVEGSLILNLRQGYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMV-DGNYTLYVLDNQNLQQLGSWV-AAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRAACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTL------------------ASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRGLRLPTSN--------NDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITI---PISPWKVTSINKSP-------------QRDSGRHR---RAAGPLRLGGNSSDFEIQEDKVP------RERAVLSGLRHFTEYRIDIHAC-------NHAAHTV------GCSAATFVFARTMPHREADGIP---GKVAWEASSKNS-VLLRWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSRLRYAKFGGVH--------LALLPP--GNYSARVRATSLAGNGSWT 902          

HSP 2 Score: 196.823 bits (499), Expect = 3.611e-111
Identity = 110/270 (40.74%), Postives = 160/270 (59.26%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ A+  + ++FL EA +MK F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L      ++      + +L   IQ    IADGM YLA  +FVHRDLAARNC+V  D  +KIG             DFG+T+ + E DYYRK G+   PVRWMAPESL+  ++TT +DVWS+GVVL+EI TL   PY G+S+E V++FV   G +  +    P  L ++M+ CW      RP+F  IL+ +   +    F+ +SFY++
Sbjct: 1014 TVNELASPRECIEFLKEASVMKAFKCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRPEAENNPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIG-------------DFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFV-MDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPS-FRLLSFYYS 1262          

HSP 3 Score: 41.2022 bits (95), Expect = 3.611e-111
Identity = 28/107 (26.17%), Postives = 55/107 (51.40%), Query Frame = 3
Query: 2994 SAYFNYLFPVDVDYV-LKITFSST-VFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFV 3296
            S  F  L P + D   L +  ++T V +  + +++ L ++   K+N+    + N  YF +      DEW +  + + ++  +G+G+FG+VY G  + LE+  +S  V
Sbjct:  904 SVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEYFSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPV 1010          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: INSR (insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091])

HSP 1 Score: 253.062 bits (645), Expect = 2.030e-67
Identity = 263/995 (26.43%), Postives = 419/995 (42.11%), Query Frame = 1
Query:  115 LYKRKICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNA-WRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK---FICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCV---------HKIECSKKN--MSITFNPNRCVKECPSDLFASFINGTKYCVNGSTIT-----TKYNKECGLL----FLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAF-IGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG--LTYYRSISTNMKNGGFSDSGCSSVIWSV--IEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE----FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDT---CSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPT-PKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            LY  ++C   DIR    ++  L + + C+++EG + I  + K      R   FP L  +TDY+LL F     ++  ++FPNL VIRG  L    AL+++     + L   +L +I  G+V +  N+ LC +  IDW  I D       S +  YI  NK     C + C         CP   I+ Q    CW+++ CQ +C +IC S           +CCH +CLG C    +   CVAC+       CV +CP  YY F+  RCV         HK + S++        + N+C+ ECPS           Y +N S +          K C LL     + S     +++ C      +I    GG +L+ +L      +  +  +++I RS  L SL+F   L  I+G+   IG  N +     N  L +LW        I  G + F  N  LC + IH      G +      ++   TNG  A C    L  + +      + L W+     +++ L G  L Y  +   N+      D+ C S  W+V  I+   ++ND   +  P  L            +  LKP T Y ++++    F   R+   A S+ ++  T    PS P    S+S++ ++I L WKPP  PNG IT Y++++ + A  E+S   E    D+C        +T    FE   +         D+   C  C KT  +  ++ EE      F+ ++H+V+ V R      SL    + ++A+P      P  ++ SV   PT P+ + P E    +N + +             VI+ L +FT Y IE+ AC+Q                   CS  A  S RT  E   D D++ P+  + +      N  + + W+ P + NGLI+ Y+++YR   D  +       C++ K     +    +  S           G Y  +I   +LAGNG+W+
Sbjct:   29 LYPGEVCPGMDIRN---NLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLL-FRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILD-------SVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHG----CTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSG----------YTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIG--NYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDA-CGSNSWTVVDIDPPLRSNDPKSQNHPGWL------------MRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQA--EDS---ELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLGDVGNVTVAVP-TVAAFPNTSSTSV---PTSPEEHRPFEKV--VNKESL-------------VISGLRHFTGYRIELQACNQDTPE-------------ERCSVAAYVSARTMPEAKAD-DIVGPVTHEIFE-----NNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHL-----CVSRKHFALERGCRLRGLS----------PGNYSVRIRATSLAGNGSWT 925          

HSP 2 Score: 211.075 bits (536), Expect = 7.726e-59
Identity = 115/270 (42.59%), Postives = 162/270 (60.00%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL +YL      ++        +L   IQ    IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+TT +D+WS+GVVL+EI++L   PY G+S+E V++FV   G         P  + D+M  CW F    RPTF+ I+  L   ++   F +VSF+H+
Sbjct: 1046 TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGV----VSKGQPT--LVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFV-MDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS-FPEVSFFHS 1294          

HSP 3 Score: 39.2762 bits (90), Expect = 7.726e-59
Identity = 19/61 (31.15%), Postives = 32/61 (52.46%), Query Frame = 3
Query: 3174 DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            DEW +  + + LL  +G+G+FG+VY G  + +        +      +VAVK +N   SL+
Sbjct: 1002 DEWEVSREKITLLRELGQGSFGMVYEGNARDI--------IKGEAETRVAVKTVNESASLR 1054          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: INSR (insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091])

HSP 1 Score: 246.899 bits (629), Expect = 1.879e-65
Identity = 265/1007 (26.32%), Postives = 422/1007 (41.91%), Query Frame = 1
Query:  115 LYKRKICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNA-WRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK---FICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCV---------HKIECSKKN--MSITFNPNRCVKECPSDLFASFINGTKYCVNGSTIT-----TKYNKECGLL----FLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAF-IGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG--LTYYRSISTNMKNGGFSDSGCSSVIWSV--IEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE----FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDT---CSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRK------KNNP------NSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPT-PKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            LY  ++C   DIR    ++  L + + C+++EG + I  + K      R   FP L  +TDY+LL F     ++  ++FPNL VIRG  L    AL+++     + L   +L +I  G+V +  N+ LC +  IDW  I D       S +  YI  NK     C + C         CP   I+ Q    CW+++ CQ +C +IC S           +CCH +CLG C    +   CVAC+       CV +CP  YY F+  RCV         HK + S++        + N+C+ ECPS           Y +N S +          K C LL     + S     +++ C      +I    GG +L+ +L      +  +  +++I RS  L SL+F   L  I+G+   IG  N +     N  L +LW        I  G + F  N  LC + IH      G +      ++   TNG  A C    L  + +      + L W+     +++ L G  L Y  +   N+      D+ C S  W+V  I+   ++ND   +  P  L            +  LKP T Y ++++    F   R+   A S+ ++  T    PS P    S+S++ ++I L WKPP  PNG IT Y++++ + A  E+S   E    D+C        +T    FE   +         D+   C  C KT  +  ++ EE      F+ ++H+V+ V RK        +P       SL    + ++A+P      P  ++ SV   PT P+ + P E    +N + +             VI+ L +FT Y IE+ AC+Q                   CS  A  S RT  E   D D++ P+  + + N       + + W+ P + NGLI+ Y+++YR   D  +       C++ K     +    +  S           G Y  +I   +LAGNG+W+
Sbjct:   29 LYPGEVCPGMDIRN---NLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLL-FRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILD-------SVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHG----CTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSG----------YTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIG--NYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDA-CGSNSWTVVDIDPPLRSNDPKSQNHPGWL------------MRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQA--EDS---ELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVP-TVAAFPNTSSTSV---PTSPEEHRPFEKV--VNKESL-------------VISGLRHFTGYRIELQACNQDTPE-------------ERCSVAAYVSARTMPEAKAD-DIVGPVTHEIFENNV-----VHLMWQEPKEPNGLIVLYEVSYRRYGDEELHL-----CVSRKHFALERGCRLRGLS----------PGNYSVRIRATSLAGNGSWT 937          

HSP 2 Score: 210.69 bits (535), Expect = 9.906e-59
Identity = 115/270 (42.59%), Postives = 162/270 (60.00%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL +YL      ++        +L   IQ    IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+TT +D+WS+GVVL+EI++L   PY G+S+E V++FV   G         P  + D+M  CW F    RPTF+ I+  L   ++   F +VSF+H+
Sbjct: 1058 TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGV----VSKGQPT--LVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFV-MDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS-FPEVSFFHS 1306          

HSP 3 Score: 39.2762 bits (90), Expect = 9.906e-59
Identity = 19/61 (31.15%), Postives = 32/61 (52.46%), Query Frame = 3
Query: 3174 DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            DEW +  + + LL  +G+G+FG+VY G  + +        +      +VAVK +N   SL+
Sbjct: 1014 DEWEVSREKITLLRELGQGSFGMVYEGNARDI--------IKGEAETRVAVKTVNESASLR 1066          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: IGF1R (insulin like growth factor 1 receptor [Source:HGNC Symbol;Acc:HGNC:5465])

HSP 1 Score: 209.149 bits (531), Expect = 1.070e-56
Identity = 240/976 (24.59%), Postives = 399/976 (40.88%), Query Frame = 1
Query:  154 PGISM----DSLIKAKECTIVEGKVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSCSN------MCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC-------SKKNMSITFNPNRCVKECPSDLFASFINGTK--YCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVII---SLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPK-FRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLT-YYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE---FRFTRQD--SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMC----DTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIP--ASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            PGI +      L + + CT++EG + I  +SK     S RFP L  +T+Y+LL F     ++  ++FPNL VIRG++L    AL+++     + +   +LR+I  G + +  N++LC +  +DW  I D       +    YI  NK    C + C        MC + TI+++    CW+ N CQ +C S C  +   C  NN   CCH +CLG C    N   CVAC+   Y   CV +CP   Y F+G RCV +  C       S  +     +   C++ECPS       NG++  YC+       K  +E      K  K +D V +    +   I   +L I    G +++ +L +    + +V  +++I  S+ L SL+FL  L  I G+  + + N +  +  N  L +LW  D +   I +G + F  N  LC + I+      G +      ++    NG  A C    L+ T        + + W   +  +Y+ L   T YY+               C S  W++++     N     ++P  L            +  LKP T Y VY++         D    A S  ++  T+  +PS P  + S S++ +++ + W PP  PNG ++ YI+ + +       + + Y +KD         +     + E+ T +      +C      C  C KT      ++EE      F+  +H+ I V R +     +                   N T+S   + T  ++    N +     + E P   S +  +   VI+NL  FT Y I+I +C+                    CS       RT  +   D IP P+ ++    N       I + W  P   NGLIL Y++ Y  + ++         C++ +              Y    +     G Y  +I   +L+GNG+W+
Sbjct:   35 PGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLL-FRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILD-------AVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRA--CTENNE--CCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIR---NGSQSMYCIPCEGPCPKVCEE-----EKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQL-EGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKD---VEPGIL------------LHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRK---YADGTIDIEEVTEN--PKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQV---------------ANTTMSSRSRNTTAADT--YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLG-------------CSASNFVFARTMPAEGADDIPGPVTWEPRPEN------SIFLKWPEPENPNGLILMYEIKYGSQVED------QRECVSRQEY----------RKYGGAKLNRLNPGNYTARIQATSLSGNGSWT 917          

HSP 2 Score: 34.2686 bits (77), Expect = 1.070e-56
Identity = 31/135 (22.96%), Postives = 57/135 (42.22%), Query Frame = 3
Query: 2982 YFIASAYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYI------LTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            Y  A  Y N++        L I     V ++   L+ I+++    K+N   +       + N  YF +      DEW +  + + +   +G+G+FG+VY G  K +        V      +VA+K +N   S++
Sbjct:  923 YVQAKRYENFIH-------LIIALPVAVLLIVGGLV-IMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGV--------VKDEPETRVAIKTVNEAASMR 1041          

HSP 3 Score: 206.453 bits (524), Expect = 5.794e-53
Identity = 115/275 (41.82%), Postives = 164/275 (59.64%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV++AA++ + ++FL+EA +MK+F  +H+V L+G+ +   Q   +L   V+MELM  GDL +YL       +   +    SL   IQ    IADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY G+S+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+  +   +    F++VSFY++
Sbjct: 1028 RVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV-MEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEM-EPGFREVSFYYS 1281          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Match: IGF1R (insulin like growth factor 1 receptor [Source:HGNC Symbol;Acc:HGNC:5465])

HSP 1 Score: 209.149 bits (531), Expect = 9.590e-54
Identity = 240/976 (24.59%), Postives = 399/976 (40.88%), Query Frame = 1
Query:  154 PGISM----DSLIKAKECTIVEGKVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSCSN------MCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC-------SKKNMSITFNPNRCVKECPSDLFASFINGTK--YCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVII---SLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPK-FRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLT-YYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE---FRFTRQD--SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMC----DTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIP--ASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            PGI +      L + + CT++EG + I  +SK     S RFP L  +T+Y+LL F     ++  ++FPNL VIRG++L    AL+++     + +   +LR+I  G + +  N++LC +  +DW  I D       +    YI  NK    C + C        MC + TI+++    CW+ N CQ +C S C  +   C  NN   CCH +CLG C    N   CVAC+   Y   CV +CP   Y F+G RCV +  C       S  +     +   C++ECPS       NG++  YC+       K  +E      K  K +D V +    +   I   +L I    G +++ +L +    + +V  +++I  S+ L SL+FL  L  I G+  + + N +  +  N  L +LW  D +   I +G + F  N  LC + I+      G +      ++    NG  A C    L+ T        + + W   +  +Y+ L   T YY+               C S  W++++     N     ++P  L            +  LKP T Y VY++         D    A S  ++  T+  +PS P  + S S++ +++ + W PP  PNG ++ YI+ + +       + + Y +KD         +     + E+ T +      +C      C  C KT      ++EE      F+  +H+ I V R +     +                   N T+S   + T  ++    N +     + E P   S +  +   VI+NL  FT Y I+I +C+                    CS       RT  +   D IP P+ ++    N       I + W  P   NGLIL Y++ Y  + ++         C++ +              Y    +     G Y  +I   +L+GNG+W+
Sbjct:   35 PGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLL-FRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILD-------AVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRA--CTENNE--CCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIR---NGSQSMYCIPCEGPCPKVCEE-----EKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQL-EGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKD---VEPGIL------------LHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRK---YADGTIDIEEVTEN--PKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQV---------------ANTTMSSRSRNTTAADT--YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLG-------------CSASNFVFARTMPAEGADDIPGPVTWEPRPEN------SIFLKWPEPENPNGLILMYEIKYGSQVED------QRECVSRQEY----------RKYGGAKLNRLNPGNYTARIQATSLSGNGSWT 917          

HSP 2 Score: 206.453 bits (524), Expect = 5.656e-53
Identity = 115/275 (41.82%), Postives = 164/275 (59.64%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV++AA++ + ++FL+EA +MK+F  +H+V L+G+ +   Q   +L   V+MELM  GDL +YL       +   +    SL   IQ    IADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY G+S+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+  +   +    F++VSFY++
Sbjct: 1029 RVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV-MEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEM-EPGFREVSFYYS 1282          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 179.104 bits (453), Expect = 8.973e-45
Identity = 232/1046 (22.18%), Postives = 405/1046 (38.72%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKH-------MCNSLR----------FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQK-------------------TRVCWSYNTCQSIC--DSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKS--FKDLDQVKNCYSAERVI---------ISLQIGGRD---LSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKN---KQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSV-IWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAIS-NHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAM----------------------------CDTCSICKKTCERNPQKQEE---LLEMTRFDTHMHSVIL-------VQRKKNNPNSLSSYNSKSIAIPNNFTTM----PL---------------------NATVSVVHKPT--PKSNI-------PMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVD-VIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNG 2937
            CT+VEG + I+ + KH       M  SL+          FP LRE+T   LL F +        IFPNL VI G  L+Q  ALI+Y N    +    L  I +G V +  N  LC    IDWK++       + S   + +             MCP    ++ K                    + CWS  TCQ  C  D +  +K++    +     CH QC+GGC    +   C ACK + +K +C+  C    Y     RCV + +C      +  NP    K  P    A     +  C +G  I    ++EC     K     +++ V + +   + I         ++++I G+    ++ +L+D+F N+  +  ++ + +S+   SL     L  I+ ++   +    + +  N  L KL+       +  G+V    N+ LC  +I   ++K+ +     D+   + TNG  AIC  + +N+++  V +  V   W +         + L    +++ +    +N    +   + V  W  +  Q     +G   +PT     D G         ++P T Y  Y+  +      A    + + F  ++     P  +       + I ++W+ PL PNG +T Y I  W+    EN  +     + FC ++ +T      +   K T    +P  +                            C +CS  +++ E+N +K+ +    +E + F+  +   +L       V+R   + N +S    K+  +     T+    PL                      +  ++  KPT  P + I       P+  + +INV       SAL     +VI NL ++T Y I + AC          Q + +  +    S+RA    RT+   D+D V+    +  +MN +   +++ VTW  P +VNG I  Y +  + K D  I       C+ +K   S +N        Q  + +N   G Y   +   ++ G G
Sbjct:  181 CTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITG-TLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHL------ITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQSCWSNTTCQKSCAYDRLLPTKEIGPGCDANGDRCHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQC------LQLNPVLSNKTVPIKATAGLC--SDKCPDGYQINPDDHRECRKCVGKCEIVCEINHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRIEAKSLF-RNLYAITVFENPNLKKLFDSTTDLTLDRGTVSIANNKMLCFKYIKQLMSKLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDIDQRKFLGYELFFKEVPRIDENMTIEEDRSACVDSWQSVFKQYYETSNG---EPTPDIFMDIGPR-----ERIRPNTLYAYYVATQMVLHAGAKNGVSKIGFVRTSYYTPDPPTLALAQVDSDAIHITWEAPLQPNGDLTHYTI-MWR----ENEVSPYEEAEKFC-TDASTPANRQHTKDPKETIVADKPVDIPSSRTVAPTLLTMMGHEDQQKTCAATPGCCSCSAIEESSEQNKKKRPDPMSAIESSAFENKLLDEVLMPRDTMRVRRSIEDANRVSEELEKAENLGKAPKTLGGKKPLIHISKKKPSSSSTTSTPAPTIASMYALTRKPTTVPGTRIRLYEIYEPLPGSWAINV-------SALALDNSYVIRNLKHYTLYAISLSAC----------QNMTVPGASCSISHRAGALKRTKHITDIDKVLNETIEWRFMNNS---QQVNVTWDPPTEVNGGIFGYVVKLKSKVDGSIVMT---RCVGAKRGYSTRN--------QGVLFQNLADGRYFVSVTATSVHGAG 1163          

HSP 2 Score: 170.244 bits (430), Expect = 4.760e-42
Identity = 100/273 (36.63%), Postives = 153/273 (56.04%), Query Frame = 2
Query: 3347 VSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYP-LVVMELMENGDLSNYLHQYAERSDK----------GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSF 4132
            V   A+ E++  +L EA +MK F    IV L G+        S++ P +VVME+M+ G+L +YL   ++R D+           +I   +   WA QI DGM YL   +F HRDLAARNC+++ D  +KIG             DFG+ + +  +DYY+  G+   PVRWM+PESL+   + +K+DVWS+GVVLYE+ TLG+ PY G+S++ V+ ++    K+        +    VM  CW +   DRPTF++++  L    + E F+ +SF
Sbjct: 1285 VDDPASTENL-NYLMEANIMKNFKTNFIVKLYGVI-------STVQPAMVVMEMMDLGNLRDYLR--SKREDEVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIG-------------DFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPECCENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPE-FRDLSF 1533          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 179.104 bits (453), Expect = 8.973e-45
Identity = 232/1046 (22.18%), Postives = 405/1046 (38.72%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKH-------MCNSLR----------FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQK-------------------TRVCWSYNTCQSIC--DSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKS--FKDLDQVKNCYSAERVI---------ISLQIGGRD---LSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKN---KQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSV-IWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAIS-NHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAM----------------------------CDTCSICKKTCERNPQKQEE---LLEMTRFDTHMHSVIL-------VQRKKNNPNSLSSYNSKSIAIPNNFTTM----PL---------------------NATVSVVHKPT--PKSNI-------PMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVD-VIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNG 2937
            CT+VEG + I+ + KH       M  SL+          FP LRE+T   LL F +        IFPNL VI G  L+Q  ALI+Y N    +    L  I +G V +  N  LC    IDWK++       + S   + +             MCP    ++ K                    + CWS  TCQ  C  D +  +K++    +     CH QC+GGC    +   C ACK + +K +C+  C    Y     RCV + +C      +  NP    K  P    A     +  C +G  I    ++EC     K     +++ V + +   + I         ++++I G+    ++ +L+D+F N+  +  ++ + +S+   SL     L  I+ ++   +    + +  N  L KL+       +  G+V    N+ LC  +I   ++K+ +     D+   + TNG  AIC  + +N+++  V +  V   W +         + L    +++ +    +N    +   + V  W  +  Q     +G   +PT     D G         ++P T Y  Y+  +      A    + + F  ++     P  +       + I ++W+ PL PNG +T Y I  W+    EN  +     + FC ++ +T      +   K T    +P  +                            C +CS  +++ E+N +K+ +    +E + F+  +   +L       V+R   + N +S    K+  +     T+    PL                      +  ++  KPT  P + I       P+  + +INV       SAL     +VI NL ++T Y I + AC          Q + +  +    S+RA    RT+   D+D V+    +  +MN +   +++ VTW  P +VNG I  Y +  + K D  I       C+ +K   S +N        Q  + +N   G Y   +   ++ G G
Sbjct:  181 CTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITG-TLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHL------ITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQSCWSNTTCQKSCAYDRLLPTKEIGPGCDANGDRCHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQC------LQLNPVLSNKTVPIKATAGLC--SDKCPDGYQINPDDHRECRKCVGKCEIVCEINHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRIEAKSLF-RNLYAITVFENPNLKKLFDSTTDLTLDRGTVSIANNKMLCFKYIKQLMSKLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDIDQRKFLGYELFFKEVPRIDENMTIEEDRSACVDSWQSVFKQYYETSNG---EPTPDIFMDIGPR-----ERIRPNTLYAYYVATQMVLHAGAKNGVSKIGFVRTSYYTPDPPTLALAQVDSDAIHITWEAPLQPNGDLTHYTI-MWR----ENEVSPYEEAEKFC-TDASTPANRQHTKDPKETIVADKPVDIPSSRTVAPTLLTMMGHEDQQKTCAATPGCCSCSAIEESSEQNKKKRPDPMSAIESSAFENKLLDEVLMPRDTMRVRRSIEDANRVSEELEKAENLGKAPKTLGGKKPLIHISKKKPSSSSTTSTPAPTIASMYALTRKPTTVPGTRIRLYEIYEPLPGSWAINV-------SALALDNSYVIRNLKHYTLYAISLSAC----------QNMTVPGASCSISHRAGALKRTKHITDIDKVLNETIEWRFMNNS---QQVNVTWDPPTEVNGGIFGYVVKLKSKVDGSIVMT---RCVGAKRGYSTRN--------QGVLFQNLADGRYFVSVTATSVHGAG 1163          

HSP 2 Score: 170.244 bits (430), Expect = 4.760e-42
Identity = 100/273 (36.63%), Postives = 153/273 (56.04%), Query Frame = 2
Query: 3347 VSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYP-LVVMELMENGDLSNYLHQYAERSDK----------GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSF 4132
            V   A+ E++  +L EA +MK F    IV L G+        S++ P +VVME+M+ G+L +YL   ++R D+           +I   +   WA QI DGM YL   +F HRDLAARNC+++ D  +KIG             DFG+ + +  +DYY+  G+   PVRWM+PESL+   + +K+DVWS+GVVLYE+ TLG+ PY G+S++ V+ ++    K+        +    VM  CW +   DRPTF++++  L    + E F+ +SF
Sbjct: 1285 VDDPASTENL-NYLMEANIMKNFKTNFIVKLYGVI-------STVQPAMVVMEMMDLGNLRDYLR--SKREDEVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIG-------------DFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPECCENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPE-FRDLSF 1533          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 178.718 bits (452), Expect = 1.105e-44
Identity = 232/1046 (22.18%), Postives = 405/1046 (38.72%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKH-------MCNSLR----------FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQK-------------------TRVCWSYNTCQSIC--DSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKS--FKDLDQVKNCYSAERVI---------ISLQIGGRD---LSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKN---KQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSV-IWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAIS-NHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAM----------------------------CDTCSICKKTCERNPQKQEE---LLEMTRFDTHMHSVIL-------VQRKKNNPNSLSSYNSKSIAIPNNFTTM----PL---------------------NATVSVVHKPT--PKSNI-------PMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVD-VIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNG 2937
            CT+VEG + I+ + KH       M  SL+          FP LRE+T   LL F +        IFPNL VI G  L+Q  ALI+Y N    +    L  I +G V +  N  LC    IDWK++       + S   + +             MCP    ++ K                    + CWS  TCQ  C  D +  +K++    +     CH QC+GGC    +   C ACK + +K +C+  C    Y     RCV + +C      +  NP    K  P    A     +  C +G  I    ++EC     K     +++ V + +   + I         ++++I G+    ++ +L+D+F N+  +  ++ + +S+   SL     L  I+ ++   +    + +  N  L KL+       +  G+V    N+ LC  +I   ++K+ +     D+   + TNG  AIC  + +N+++  V +  V   W +         + L    +++ +    +N    +   + V  W  +  Q     +G   +PT     D G         ++P T Y  Y+  +      A    + + F  ++     P  +       + I ++W+ PL PNG +T Y I  W+    EN  +     + FC ++ +T      +   K T    +P  +                            C +CS  +++ E+N +K+ +    +E + F+  +   +L       V+R   + N +S    K+  +     T+    PL                      +  ++  KPT  P + I       P+  + +INV       SAL     +VI NL ++T Y I + AC          Q + +  +    S+RA    RT+   D+D V+    +  +MN +   +++ VTW  P +VNG I  Y +  + K D  I       C+ +K   S +N        Q  + +N   G Y   +   ++ G G
Sbjct:  134 CTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITG-TLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHL------ITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQSCWSNTTCQKSCAYDRLLPTKEIGPGCDANGDRCHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQC------LQLNPVLSNKTVPIKATAGLC--SDKCPDGYQINPDDHRECRKCVGKCEIVCEINHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRIEAKSLF-RNLYAITVFENPNLKKLFDSTTDLTLDRGTVSIANNKMLCFKYIKQLMSKLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDIDQRKFLGYELFFKEVPRIDENMTIEEDRSACVDSWQSVFKQYYETSNG---EPTPDIFMDIGPR-----ERIRPNTLYAYYVATQMVLHAGAKNGVSKIGFVRTSYYTPDPPTLALAQVDSDAIHITWEAPLQPNGDLTHYTI-MWR----ENEVSPYEEAEKFC-TDASTPANRQHTKDPKETIVADKPVDIPSSRTVAPTLLTMMGHEDQQKTCAATPGCCSCSAIEESSEQNKKKRPDPMSAIESSAFENKLLDEVLMPRDTMRVRRSIEDANRVSEELEKAENLGKAPKTLGGKKPLIHISKKKPSSSSTTSTPAPTIASMYALTRKPTTVPGTRIRLYEIYEPLPGSWAINV-------SALALDNSYVIRNLKHYTLYAISLSAC----------QNMTVPGASCSISHRAGALKRTKHITDIDKVLNETIEWRFMNNS---QQVNVTWDPPTEVNGGIFGYVVKLKSKVDGSIVMT---RCVGAKRGYSTRN--------QGVLFQNLADGRYFVSVTATSVHGAG 1116          

HSP 2 Score: 170.244 bits (430), Expect = 4.292e-42
Identity = 100/273 (36.63%), Postives = 153/273 (56.04%), Query Frame = 2
Query: 3347 VSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYP-LVVMELMENGDLSNYLHQYAERSDK----------GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSF 4132
            V   A+ E++  +L EA +MK F    IV L G+        S++ P +VVME+M+ G+L +YL   ++R D+           +I   +   WA QI DGM YL   +F HRDLAARNC+++ D  +KIG             DFG+ + +  +DYY+  G+   PVRWM+PESL+   + +K+DVWS+GVVLYE+ TLG+ PY G+S++ V+ ++    K+        +    VM  CW +   DRPTF++++  L    + E F+ +SF
Sbjct: 1238 VDDPASTENL-NYLMEANIMKNFKTNFIVKLYGVI-------STVQPAMVVMEMMDLGNLRDYLR--SKREDEVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIG-------------DFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPECCENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPE-FRDLSF 1486          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 178.333 bits (451), Expect = 1.239e-44
Identity = 232/1046 (22.18%), Postives = 405/1046 (38.72%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKH-------MCNSLR----------FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQK-------------------TRVCWSYNTCQSIC--DSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKS--FKDLDQVKNCYSAERVI---------ISLQIGGRD---LSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKN---KQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSV-IWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAIS-NHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAM----------------------------CDTCSICKKTCERNPQKQEE---LLEMTRFDTHMHSVIL-------VQRKKNNPNSLSSYNSKSIAIPNNFTTM----PL---------------------NATVSVVHKPT--PKSNI-------PMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVD-VIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNG 2937
            CT+VEG + I+ + KH       M  SL+          FP LRE+T   LL F +        IFPNL VI G  L+Q  ALI+Y N    +    L  I +G V +  N  LC    IDWK++       + S   + +             MCP    ++ K                    + CWS  TCQ  C  D +  +K++    +     CH QC+GGC    +   C ACK + +K +C+  C    Y     RCV + +C      +  NP    K  P    A     +  C +G  I    ++EC     K     +++ V + +   + I         ++++I G+    ++ +L+D+F N+  +  ++ + +S+   SL     L  I+ ++   +    + +  N  L KL+       +  G+V    N+ LC  +I   ++K+ +     D+   + TNG  AIC  + +N+++  V +  V   W +         + L    +++ +    +N    +   + V  W  +  Q     +G   +PT     D G         ++P T Y  Y+  +      A    + + F  ++     P  +       + I ++W+ PL PNG +T Y I  W+    EN  +     + FC ++ +T      +   K T    +P  +                            C +CS  +++ E+N +K+ +    +E + F+  +   +L       V+R   + N +S    K+  +     T+    PL                      +  ++  KPT  P + I       P+  + +INV       SAL     +VI NL ++T Y I + AC          Q + +  +    S+RA    RT+   D+D V+    +  +MN +   +++ VTW  P +VNG I  Y +  + K D  I       C+ +K   S +N        Q  + +N   G Y   +   ++ G G
Sbjct:  105 CTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITG-TLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHL------ITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQSCWSNTTCQKSCAYDRLLPTKEIGPGCDANGDRCHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQC------LQLNPVLSNKTVPIKATAGLC--SDKCPDGYQINPDDHRECRKCVGKCEIVCEINHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRIEAKSLF-RNLYAITVFENPNLKKLFDSTTDLTLDRGTVSIANNKMLCFKYIKQLMSKLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDIDQRKFLGYELFFKEVPRIDENMTIEEDRSACVDSWQSVFKQYYETSNG---EPTPDIFMDIGPR-----ERIRPNTLYAYYVATQMVLHAGAKNGVSKIGFVRTSYYTPDPPTLALAQVDSDAIHITWEAPLQPNGDLTHYTI-MWR----ENEVSPYEEAEKFC-TDASTPANRQHTKDPKETIVADKPVDIPSSRTVAPTLLTMMGHEDQQKTCAATPGCCSCSAIEESSEQNKKKRPDPMSAIESSAFENKLLDEVLMPRDTMRVRRSIEDANRVSEELEKAENLGKAPKTLGGKKPLIHISKKKPSSSSTTSTPAPTIASMYALTRKPTTVPGTRIRLYEIYEPLPGSWAINV-------SALALDNSYVIRNLKHYTLYAISLSAC----------QNMTVPGASCSISHRAGALKRTKHITDIDKVLNETIEWRFMNNS---QQVNVTWDPPTEVNGGIFGYVVKLKSKVDGSIVMT---RCVGAKRGYSTRN--------QGVLFQNLADGRYFVSVTATSVHGAG 1087          

HSP 2 Score: 170.244 bits (430), Expect = 4.538e-42
Identity = 100/273 (36.63%), Postives = 153/273 (56.04%), Query Frame = 2
Query: 3347 VSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYP-LVVMELMENGDLSNYLHQYAERSDK----------GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSF 4132
            V   A+ E++  +L EA +MK F    IV L G+        S++ P +VVME+M+ G+L +YL   ++R D+           +I   +   WA QI DGM YL   +F HRDLAARNC+++ D  +KIG             DFG+ + +  +DYY+  G+   PVRWM+PESL+   + +K+DVWS+GVVLYE+ TLG+ PY G+S++ V+ ++    K+        +    VM  CW +   DRPTF++++  L    + E F+ +SF
Sbjct: 1209 VDDPASTENL-NYLMEANIMKNFKTNFIVKLYGVI-------STVQPAMVVMEMMDLGNLRDYLR--SKREDEVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIG-------------DFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPECCENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPE-FRDLSF 1457          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 169.088 bits (427), Expect = 4.899e-43
Identity = 100/274 (36.50%), Postives = 153/274 (55.84%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYP-LVVMELMENGDLSNYLHQYAERSDK----------GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSF 4132
             V   A+ E++  +L EA +MK F    IV L G+        S++ P +VVME+M+ G+L +YL   ++R D+           +I   +   WA QI DGM YL   +F HRDLAARNC+++ D  +KIG             DFG+ + +  +DYY+  G+   PVRWM+PESL+   + +K+DVWS+GVVLYE+ TLG+ PY G+S++ V+ ++    K+        +    VM  CW +   DRPTF++++  L    + E F+ +SF
Sbjct:  110 NVDDPASTENL-NYLMEANIMKNFKTNFIVKLYGVI-------STVQPAMVVMEMMDLGNLRDYLR--SKREDEVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIG-------------DFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPECCENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPE-FRDLSF 359          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0290232)

HSP 1 Score: 219.55 bits (558), Expect = 1.357e-108
Identity = 123/282 (43.62%), Postives = 166/282 (58.87%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYL--HQYAERSDK--------GMIDGKQSLLW------AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ AT  +   FLSEA +MK+F  YH+V L+G+ +           LVVMELM+ GDL +YL  H+  ER +         G+    Q   +      AI+IADGM YLA K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK  +   PVRWM PESLR  VY++ +DV+S+GVVL+E++TL + PY G+S+E V+ +V   G +       P  L  +M  CW    + RP+F+ I+ YL P   N  FK+VSFYH+
Sbjct: 1406 TVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCS------RGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIG-------------DFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYV-IDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHS 1667          

HSP 2 Score: 179.489 bits (454), Expect = 1.357e-108
Identity = 242/1010 (23.96%), Postives = 403/1010 (39.90%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPE--RTIDDQKT-----------------RVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCY--GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC--------SKKNMSITFNPNRCVKECPSDLFASFINGT-KYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNC---YSAERVIISLQI-GGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDS-TNGHIAICTFIQLNLTVVEVKSQCVRL-------YWKNKQTSNYQIL-------SGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEE--LLEMTRFDTHMHSVILVQ--RKKNNPNSLSSYNSK-----SIAIPNNFTTMPLNATVSVVHKPT---PKSNIPMENTSSI------------------------NVKQIEIPASALKTQYYH-VITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLE 2955
            CT++EG ++I  ++     +  FP L EVTDYI++   +     S  IFPNL VIRG +L  G AL+VY N     L    LRSI  G V +  N  LC    IDW  I       +++  +L + T          + CP   R  +   T                 R+CW+   CQ+ C   C +  +  H      CC + CLGGC      N+ C++C+ + +   C+ SCP GYY+F  SRCV   EC        +     I +N  +C+  CP+    S      + C  G     K +KEC    + S +   +   C      E + IS++   G  +  +L+     +  ++  + +  +  L+SL F   L EI G   +      L +  N  L +LW P+    I  G V F  N  LC + I+  +  +  +   F+K  + + +NG+   C    LN+T+  V +    L         + ++ SN  I+        G  +Y  I     +   SD  C    W V   +     SGV +                 +S+L P T+Y  Y+     + + + A S+   F T+   PS    + + + + ++I ++W     P G++T+Y I   K  L      N  +N+D+C   T    K  +++    T        +   C   + + + + Q+ ++  +     F+  + + I V   RK  N +S  S  ++     S AIPN   T P      V  +P     + ++ + +  SI                        N +  E+ A  L     H V   L +FT Y I +VAC +   +          F  + CS+  +    T+R    D++  +  D  + N T     + V W  P   NG I+ Y++ Y+++K +   Q     CI +            N +    I  N   G Y F++   ++AG G+++ +E
Sbjct:  357 CTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLS-KIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEI------LAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNNCIDEHT-----CCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQFD-SRCVTANECITLTKFETNSVYSGIPYN-GQCITHCPTGYQKSENKRMCEPCPGG-----KCDKECSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEISGDPPMDADKYALYVLDNRDLDELWGPNQTVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSDVGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKVEIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPE----KSGVMV-----------------LSNLIPYTNYSYYVRTMAISSELTNAESDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI---KAKLINRPTRN--NNRDYC---TEPLVKAMENDLPATTPTKKISDPLAGDCKCVEGSKKTSSQEYDDRKVQAGMEFENALQNFIFVPNIRKSKNGSSDKSDGAEGAALDSNAIPNGGATNPSRRRRDVALEPELDDVEGSVLLRHVRSITDDTDAFFEKDDENTYKDEEDLSSNKQFYEVFAKELPPNQTHFVFEKLRHFTRYAIFVVACREEIPSEKLRD---TSFKKSLCSDYDTVFQTTKRKKFADIVMDLKVDLEHANNT--ESPVRVRWTPPVDPNGEIVTYEVAYKLQKPD---QVEEKKCIPAADF---------NQTAGYLIKLN--EGLYSFRVRANSIAGYGDFTEVE 1298          

HSP 3 Score: 38.5058 bits (88), Expect = 1.357e-108
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 3
Query: 3072 MAVALISIL--IWYLAWKK---NQRYILTRNNHYFLSGQ---DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKL 3269
            +A  ++S+   + YL  +K   N  ++ T  N ++ S Q   D+W +  +++  L P+G+G+FG+VY G LK  
Sbjct: 1320 LAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPLGQGSFGMVYEGILKSF 1393          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0290230)

HSP 1 Score: 219.55 bits (558), Expect = 1.357e-108
Identity = 123/282 (43.62%), Postives = 166/282 (58.87%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYL--HQYAERSDK--------GMIDGKQSLLW------AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ AT  +   FLSEA +MK+F  YH+V L+G+ +           LVVMELM+ GDL +YL  H+  ER +         G+    Q   +      AI+IADGM YLA K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK  +   PVRWM PESLR  VY++ +DV+S+GVVL+E++TL + PY G+S+E V+ +V   G +       P  L  +M  CW    + RP+F+ I+ YL P   N  FK+VSFYH+
Sbjct: 1406 TVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCS------RGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIG-------------DFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYV-IDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHS 1667          

HSP 2 Score: 179.489 bits (454), Expect = 1.357e-108
Identity = 242/1010 (23.96%), Postives = 403/1010 (39.90%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPE--RTIDDQKT-----------------RVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCY--GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC--------SKKNMSITFNPNRCVKECPSDLFASFINGT-KYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNC---YSAERVIISLQI-GGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDS-TNGHIAICTFIQLNLTVVEVKSQCVRL-------YWKNKQTSNYQIL-------SGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEE--LLEMTRFDTHMHSVILVQ--RKKNNPNSLSSYNSK-----SIAIPNNFTTMPLNATVSVVHKPT---PKSNIPMENTSSI------------------------NVKQIEIPASALKTQYYH-VITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLE 2955
            CT++EG ++I  ++     +  FP L EVTDYI++   +     S  IFPNL VIRG +L  G AL+VY N     L    LRSI  G V +  N  LC    IDW  I       +++  +L + T          + CP   R  +   T                 R+CW+   CQ+ C   C +  +  H      CC + CLGGC      N+ C++C+ + +   C+ SCP GYY+F  SRCV   EC        +     I +N  +C+  CP+    S      + C  G     K +KEC    + S +   +   C      E + IS++   G  +  +L+     +  ++  + +  +  L+SL F   L EI G   +      L +  N  L +LW P+    I  G V F  N  LC + I+  +  +  +   F+K  + + +NG+   C    LN+T+  V +    L         + ++ SN  I+        G  +Y  I     +   SD  C    W V   +     SGV +                 +S+L P T+Y  Y+     + + + A S+   F T+   PS    + + + + ++I ++W     P G++T+Y I   K  L      N  +N+D+C   T    K  +++    T        +   C   + + + + Q+ ++  +     F+  + + I V   RK  N +S  S  ++     S AIPN   T P      V  +P     + ++ + +  SI                        N +  E+ A  L     H V   L +FT Y I +VAC +   +          F  + CS+  +    T+R    D++  +  D  + N T     + V W  P   NG I+ Y++ Y+++K +   Q     CI +            N +    I  N   G Y F++   ++AG G+++ +E
Sbjct:  357 CTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLS-KIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEI------LAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNNCIDEHT-----CCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQFD-SRCVTANECITLTKFETNSVYSGIPYN-GQCITHCPTGYQKSENKRMCEPCPGG-----KCDKECSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEISGDPPMDADKYALYVLDNRDLDELWGPNQTVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSDVGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKVEIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPE----KSGVMV-----------------LSNLIPYTNYSYYVRTMAISSELTNAESDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI---KAKLINRPTRN--NNRDYC---TEPLVKAMENDLPATTPTKKISDPLAGDCKCVEGSKKTSSQEYDDRKVQAGMEFENALQNFIFVPNIRKSKNGSSDKSDGAEGAALDSNAIPNGGATNPSRRRRDVALEPELDDVEGSVLLRHVRSITDDTDAFFEKDDENTYKDEEDLSSNKQFYEVFAKELPPNQTHFVFEKLRHFTRYAIFVVACREEIPSEKLRD---TSFKKSLCSDYDTVFQTTKRKKFADIVMDLKVDLEHANNT--ESPVRVRWTPPVDPNGEIVTYEVAYKLQKPD---QVEEKKCIPAADF---------NQTAGYLIKLN--EGLYSFRVRANSIAGYGDFTEVE 1298          

HSP 3 Score: 38.5058 bits (88), Expect = 1.357e-108
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 3
Query: 3072 MAVALISIL--IWYLAWKK---NQRYILTRNNHYFLSGQ---DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKL 3269
            +A  ++S+   + YL  +K   N  ++ T  N ++ S Q   D+W +  +++  L P+G+G+FG+VY G LK  
Sbjct: 1320 LAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPLGQGSFGMVYEGILKSF 1393          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0084121)

HSP 1 Score: 219.55 bits (558), Expect = 1.357e-108
Identity = 123/282 (43.62%), Postives = 166/282 (58.87%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYL--HQYAERSDK--------GMIDGKQSLLW------AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ AT  +   FLSEA +MK+F  YH+V L+G+ +           LVVMELM+ GDL +YL  H+  ER +         G+    Q   +      AI+IADGM YLA K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK  +   PVRWM PESLR  VY++ +DV+S+GVVL+E++TL + PY G+S+E V+ +V   G +       P  L  +M  CW    + RP+F+ I+ YL P   N  FK+VSFYH+
Sbjct: 1406 TVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCS------RGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIG-------------DFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYV-IDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHS 1667          

HSP 2 Score: 179.489 bits (454), Expect = 1.357e-108
Identity = 242/1010 (23.96%), Postives = 403/1010 (39.90%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPE--RTIDDQKT-----------------RVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCY--GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC--------SKKNMSITFNPNRCVKECPSDLFASFINGT-KYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNC---YSAERVIISLQI-GGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDS-TNGHIAICTFIQLNLTVVEVKSQCVRL-------YWKNKQTSNYQIL-------SGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEE--LLEMTRFDTHMHSVILVQ--RKKNNPNSLSSYNSK-----SIAIPNNFTTMPLNATVSVVHKPT---PKSNIPMENTSSI------------------------NVKQIEIPASALKTQYYH-VITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLE 2955
            CT++EG ++I  ++     +  FP L EVTDYI++   +     S  IFPNL VIRG +L  G AL+VY N     L    LRSI  G V +  N  LC    IDW  I       +++  +L + T          + CP   R  +   T                 R+CW+   CQ+ C   C +  +  H      CC + CLGGC      N+ C++C+ + +   C+ SCP GYY+F  SRCV   EC        +     I +N  +C+  CP+    S      + C  G     K +KEC    + S +   +   C      E + IS++   G  +  +L+     +  ++  + +  +  L+SL F   L EI G   +      L +  N  L +LW P+    I  G V F  N  LC + I+  +  +  +   F+K  + + +NG+   C    LN+T+  V +    L         + ++ SN  I+        G  +Y  I     +   SD  C    W V   +     SGV +                 +S+L P T+Y  Y+     + + + A S+   F T+   PS    + + + + ++I ++W     P G++T+Y I   K  L      N  +N+D+C   T    K  +++    T        +   C   + + + + Q+ ++  +     F+  + + I V   RK  N +S  S  ++     S AIPN   T P      V  +P     + ++ + +  SI                        N +  E+ A  L     H V   L +FT Y I +VAC +   +          F  + CS+  +    T+R    D++  +  D  + N T     + V W  P   NG I+ Y++ Y+++K +   Q     CI +            N +    I  N   G Y F++   ++AG G+++ +E
Sbjct:  357 CTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLS-KIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEI------LAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNNCIDEHT-----CCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQFD-SRCVTANECITLTKFETNSVYSGIPYN-GQCITHCPTGYQKSENKRMCEPCPGG-----KCDKECSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEISGDPPMDADKYALYVLDNRDLDELWGPNQTVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSDVGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKVEIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPE----KSGVMV-----------------LSNLIPYTNYSYYVRTMAISSELTNAESDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI---KAKLINRPTRN--NNRDYC---TEPLVKAMENDLPATTPTKKISDPLAGDCKCVEGSKKTSSQEYDDRKVQAGMEFENALQNFIFVPNIRKSKNGSSDKSDGAEGAALDSNAIPNGGATNPSRRRRDVALEPELDDVEGSVLLRHVRSITDDTDAFFEKDDENTYKDEEDLSSNKQFYEVFAKELPPNQTHFVFEKLRHFTRYAIFVVACREEIPSEKLRD---TSFKKSLCSDYDTVFQTTKRKKFADIVMDLKVDLEHANNT--ESPVRVRWTPPVDPNGEIVTYEVAYKLQKPD---QVEEKKCIPAADF---------NQTAGYLIKLN--EGLYSFRVRANSIAGYGDFTEVE 1298          

HSP 3 Score: 38.5058 bits (88), Expect = 1.357e-108
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 3
Query: 3072 MAVALISIL--IWYLAWKK---NQRYILTRNNHYFLSGQ---DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKL 3269
            +A  ++S+   + YL  +K   N  ++ T  N ++ S Q   D+W +  +++  L P+G+G+FG+VY G LK  
Sbjct: 1320 LAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPLGQGSFGMVYEGILKSF 1393          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0290231)

HSP 1 Score: 219.55 bits (558), Expect = 1.357e-108
Identity = 123/282 (43.62%), Postives = 166/282 (58.87%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYL--HQYAERSDK--------GMIDGKQSLLW------AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ AT  +   FLSEA +MK+F  YH+V L+G+ +           LVVMELM+ GDL +YL  H+  ER +         G+    Q   +      AI+IADGM YLA K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK  +   PVRWM PESLR  VY++ +DV+S+GVVL+E++TL + PY G+S+E V+ +V   G +       P  L  +M  CW    + RP+F+ I+ YL P   N  FK+VSFYH+
Sbjct: 1406 TVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCS------RGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIG-------------DFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYV-IDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHS 1667          

HSP 2 Score: 179.489 bits (454), Expect = 1.357e-108
Identity = 242/1010 (23.96%), Postives = 403/1010 (39.90%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPE--RTIDDQKT-----------------RVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCY--GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC--------SKKNMSITFNPNRCVKECPSDLFASFINGT-KYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNC---YSAERVIISLQI-GGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDS-TNGHIAICTFIQLNLTVVEVKSQCVRL-------YWKNKQTSNYQIL-------SGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEE--LLEMTRFDTHMHSVILVQ--RKKNNPNSLSSYNSK-----SIAIPNNFTTMPLNATVSVVHKPT---PKSNIPMENTSSI------------------------NVKQIEIPASALKTQYYH-VITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLE 2955
            CT++EG ++I  ++     +  FP L EVTDYI++   +     S  IFPNL VIRG +L  G AL+VY N     L    LRSI  G V +  N  LC    IDW  I       +++  +L + T          + CP   R  +   T                 R+CW+   CQ+ C   C +  +  H      CC + CLGGC      N+ C++C+ + +   C+ SCP GYY+F  SRCV   EC        +     I +N  +C+  CP+    S      + C  G     K +KEC    + S +   +   C      E + IS++   G  +  +L+     +  ++  + +  +  L+SL F   L EI G   +      L +  N  L +LW P+    I  G V F  N  LC + I+  +  +  +   F+K  + + +NG+   C    LN+T+  V +    L         + ++ SN  I+        G  +Y  I     +   SD  C    W V   +     SGV +                 +S+L P T+Y  Y+     + + + A S+   F T+   PS    + + + + ++I ++W     P G++T+Y I   K  L      N  +N+D+C   T    K  +++    T        +   C   + + + + Q+ ++  +     F+  + + I V   RK  N +S  S  ++     S AIPN   T P      V  +P     + ++ + +  SI                        N +  E+ A  L     H V   L +FT Y I +VAC +   +          F  + CS+  +    T+R    D++  +  D  + N T     + V W  P   NG I+ Y++ Y+++K +   Q     CI +            N +    I  N   G Y F++   ++AG G+++ +E
Sbjct:  357 CTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLS-KIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEI------LAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNNCIDEHT-----CCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQFD-SRCVTANECITLTKFETNSVYSGIPYN-GQCITHCPTGYQKSENKRMCEPCPGG-----KCDKECSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEISGDPPMDADKYALYVLDNRDLDELWGPNQTVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSDVGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKVEIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPE----KSGVMV-----------------LSNLIPYTNYSYYVRTMAISSELTNAESDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI---KAKLINRPTRN--NNRDYC---TEPLVKAMENDLPATTPTKKISDPLAGDCKCVEGSKKTSSQEYDDRKVQAGMEFENALQNFIFVPNIRKSKNGSSDKSDGAEGAALDSNAIPNGGATNPSRRRRDVALEPELDDVEGSVLLRHVRSITDDTDAFFEKDDENTYKDEEDLSSNKQFYEVFAKELPPNQTHFVFEKLRHFTRYAIFVVACREEIPSEKLRD---TSFKKSLCSDYDTVFQTTKRKKFADIVMDLKVDLEHANNT--ESPVRVRWTPPVDPNGEIVTYEVAYKLQKPD---QVEEKKCIPAADF---------NQTAGYLIKLN--EGLYSFRVRANSIAGYGDFTEVE 1298          

HSP 3 Score: 38.5058 bits (88), Expect = 1.357e-108
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 3
Query: 3072 MAVALISIL--IWYLAWKK---NQRYILTRNNHYFLSGQ---DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKL 3269
            +A  ++S+   + YL  +K   N  ++ T  N ++ S Q   D+W +  +++  L P+G+G+FG+VY G LK  
Sbjct: 1320 LAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPLGQGSFGMVYEGILKSF 1393          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Match: Alk (gene:FBgn0040505 transcript:FBtr0087118)

HSP 1 Score: 159.073 bits (401), Expect = 1.374e-38
Identity = 89/251 (35.46%), Postives = 141/251 (56.18%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLW-AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLV 4093
            T+ +    E    FL EA +M +F   ++VHLIG+       +   Y  +V+EL+  GDL  +L +     ++  +   + LL+ A+ +A G  Y+  KRF+HRD+AARNCL+ +      G  + +        DFG+++ I  +DYYRK G+A  P++WM PE+    ++T+KTDVWS+G++L+E+ +LG  PY G  +  V+E V   G       + P S+  VM  CW+    DRPTF+ +LE+L 
Sbjct: 1228 TLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCF-----DRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSK-----GPGRVVKI-----ADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELV-VRGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLT 1461          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: insrb (insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-020503-4])

HSP 1 Score: 249.21 bits (635), Expect = 2.951e-70
Identity = 261/953 (27.39%), Postives = 402/953 (42.18%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK--FICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCVH-------KIECSKKN---MSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKEC-GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPK-FRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG--LTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDS-GVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFT----RQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDF-CQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTR-FDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            CT++EG + I  + K      R   FP L  VTDY+L+ F     ++  ++FPNL VIRG  L    AL+++     + +   SL +I  G V +  N NLC +  +DW  I D       S +  YI  NK    C N C         C + TI+      CW+ N CQ IC S C       H      CCH+QCLGGC    N   CVAC+   Y E CV  CP GYY FK  RCV          +C  K+    +   +   C+ ECPS    + +N T   +     T +  K C G+  + S      ++ C      +I    GG  ++ +L      L  +  ++ I R+  L SL+FL  L  I+G+   G  N +     N  L +LW  +     IL G ++F+ N  LCK+ I       G +N + D     S     + C    L  T +   S  + + W++   S+++ L G  + Y  +   N+      D+ C S  W++ + +     S G +++P  L            I  LKP T Y V ++ +       Q   A +  ++  T+   PS P    S S++ ++I L WKPP  PNG IT YIIY  K +     +  +Y  +     S T T     +   ++  N    P      C+ C KT E   +K+ E  E  + F+ ++H+ +   R             +S+ + N   T+P   T   +    P ++IP E  S    +++   AS+ +     VI+NL +FT Y IEI AC+                    CS       RT      DVI  P+  + + +   +   + + WK P   NG+I+ Y++ Y    DN   Q     C++  S       + KN  Y+   +R    G Y  ++   +LAGNG+W+
Sbjct:   46 CTVIEGHLKILLMFKTTQEDFRGLSFPKLVMVTDYLLI-FRVYGLESLGSLFPNLTVIRGSNLFFNYALVMFEMIQMKEIGLHSLTNITRGAVRIEKNPNLCYLSTLDWSKILD-------SVEDNYIVANKDDLECGNICPGTIAGTISCKQTTINGNFGERCWNQNHCQRICPSECVHGACTSHKE----CCHEQCLGGCSVPGNSTKCVACRNFLYGEACVDRCPPGYYTFKSWRCVSLQFCQDLHNQCKDKSGDCHAYVIHNGACIPECPSGY--TTVNSTS--LTCMPCTGRCPKVCTGVQTVDSVTAAQALRGCTVLNGSLIIKISGGNSIAAELESSLGQLEEITGYLTIRRAYALVSLSFLRKLHLIRGETLDG-GNYSFHAMDNQNLRQLWDWNKHNLTILKGRMKFIQNGKLCKSEILRMEQATGTKNRMNDI----SNEKDQSYCESHILKFTQIRTMSDKILIRWESFWPSDFRDLLGFMVLYKEAPHRNVTEYDGQDA-CGSNSWAIADVEPPQRPSEGKEVEPGYL------------IMPLKPWTQYAVMVKAQLAASEDHQVRGAKTEIIYVRTNATRPSVPLDPHSWSNSSSQIILKWKPPSDPNGNITHYIIYCQKQSEDITHYKFDYCQQGMKVPSHTPTHHDVEE---DQKLNQTEVPDQKGHCCA-CPKT-EMQLKKEAEETEFRKTFENYLHNEVFEPRPHR--------RRRSVGVAN--ATLPNFGTTPTIIPNFPTTSIPEEEKS----RKMVFKASSKEAM---VISNLLHFTSYQIEIHACNDPTDP-------------GRCSMPTYVKARTLPELKADVIAEPVTHEFFPDEPDV---VYIRWKEPKTPNGMIILYEVKYLRMSDNYEDQI----CVSRIS-------YEKNHGYR---LRVGHPGNYSVRVRATSLAGNGSWT 912          

HSP 2 Score: 38.891 bits (89), Expect = 2.951e-70
Identity = 32/130 (24.62%), Postives = 59/130 (45.38%), Query Frame = 3
Query: 3009 YLFPVDVDYVLKITFSSTVFIMAVALISILI----WYLAWKKNQRY-----ILTRNNHYFLSGQD-----EWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            Y +  D +  +KI     V I+A+ +  ++I     Y   KK Q       ++  +N  ++S  D     EW +  + + ++  +G+G+FG+VY G  K +        +      +VAVK +N   SL+
Sbjct:  916 YFYVQDREMSMKI-----VIILAICIFLLVILASVGYFVLKKKQTEGPTGPLIASSNPEYISANDVYIPDEWEVPREKITVMRELGQGSFGMVYEGIAKDI--------IKGEPDTRVAVKTVNESASLR 1032          

HSP 3 Score: 204.912 bits (520), Expect = 1.019e-52
Identity = 114/275 (41.45%), Postives = 163/275 (59.27%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL +YL      ++        +L   IQ    IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+T  +D WS+GVVL+EISTL   PY G+S+E V++FV   G         P  + ++M  CW +    RPTF  I+E +   + +  F++VSF+++
Sbjct: 1019 RVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVVMELMTHGDLKSYLRSLRPDAENNPGSPPPTLKEMIQMSAEIADGMAYLNAKKFVHRDLAARNCMVAEDYTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFV-MDGGYLDRPENCPERMHNLMQMCWQYNPKMRPTFHEIIEMIKEDL-HPTFQEVSFFYS 1272          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: insra (insulin receptor a [Source:ZFIN;Acc:ZDB-GENE-020503-3])

HSP 1 Score: 216.468 bits (550), Expect = 8.528e-62
Identity = 241/958 (25.16%), Postives = 390/958 (40.71%), Query Frame = 1
Query:  193 CTIVEG--KVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK--FICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCY-GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKN----------MSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKEC-GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQA-FIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG--LTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDS-GVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            CT++EG  K+++   +K      L +P L  VTDY+LL F     ++  ++FPNL V+RG  L    AL+++     + +   SL +I  G V V  N +LC +  +DW  I D       S +  YI  NK    C + C         CP  TI+   +  CW+   CQ +C S C  +         S CCH QCLGGC    ++  CVAC+   +   CV  CP G+Y FKG RCV    C + +               +   C+ ECPS    + +N T   +N +       K C GL  + S      ++ C      ++    GG +++ +L      L  +  ++ +  S  L SL+FL  L  I G+   +G  N +     N  L +LW        I  G + F  N  LC + I       G +N     +++  TNG  A C    L  T +   S  + + W+     +++ L G  + Y  +   N+      D+ C S  W + +       + G + +P  L            I  LKP T Y + ++ + +  D      A S  ++  T+   PS P    S S++ ++I L WKPP  PNG IT Y+++  +       +  +Y  K     +  T   T   N E+   +  + Q     C  C KT ++  ++ EE      F+ ++H+ +   R      SL       + I N  ++       S+ +    +S  P E   +  +  I      ++ +   VI+NL +FT Y IEI AC+                    CS  A  S RT  E   D D++  I  + +         + + W  P   NG+I+ Y+++Y+   D         +C++ K+  +               +R    G Y  +I   +LAGNG+W+    F
Sbjct:   45 CTVIEGHLKILLMFTTKPEDFRGLSYPKLTVVTDYLLL-FRVYGLESLSDLFPNLTVVRGNNLFFNYALVLFEMLQLKEIGLHSLMNITRGAVRVEKNPDLCYLSTLDWSMILD-------SVEDNYIVANKNDRECGDICPGTVLGKTTCPLTTINGDFSERCWNQKYCQRMCPSSCKHRA----CTKDSQCCHDQCLGGCLEPHSSNKCVACRNFMHNNMCVEKCPHGFYTFKGWRCVSFSFCQELHNKCKQGKGDCHEYVIHNGACIPECPSGY--TTVNSTT--LNCTPCAGLCPKVCMGLKTVDSVTAAQALRGCTVINGSLVINIRGGNNIAAELEANLGQLEEITGYLTVRHSYALVSLSFLRKLRIIHGETQEVG--NYSFYALDNQNLRQLWDWSKHNLTIQQGRMFFHHNSKLCMSEIRRMEEVTGTKNRQTKNDIVSKTNGDQASCESKVLKFTRISTLSDKIIIKWEAFWPPDFRDLLGFMVLYKEAPYKNVTEFDGQDA-CGSNSWVIADVDPPPRATEGKEHEPGYL------------IFPLKPWTQYAIMVKTQLSASDEHQVHGAKSEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFCQQQPEASELYKFDYCQKGM---KLPTRAPTQVDNEEEQKWNQTEEQGPDSRCCACPKTEKQLKKEAEETEYRKTFENYLHNEVFELRPSRQRRSL-------VGIANRTSSRLFTTPSSLPNGSATRS--PEEEAEANKISLI------VQAKESTVISNLRHFTSYQIEIHACNHGSDP-------------TRCSMAAYVSARTMPEEKAD-DIVGKITCEVF------EYSVHIRWIEPKAPNGMIILYEVHYKRLGDTEELH----HCVSRKNYIADGGCK----------LRVVHPGNYTVRIRATSLAGNGSWTEPTHF 919          

HSP 2 Score: 43.5134 bits (101), Expect = 8.528e-62
Identity = 33/120 (27.50%), Postives = 54/120 (45.00%), Query Frame = 3
Query: 3021 VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQ----RYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            VD   VLKI     +    + L+ +  + +  K+ +    R   + N  YF   +    DEW +  + + LL  +G+G+FG+VY G  K +        V      +VAVK +N   SL+
Sbjct:  926 VDPSNVLKIVIGPVICFFLLLLLCVGFYIVKKKQTEGPTGRLYTSPNPEYFSPDEVYEPDEWEVPREKITLLRELGQGSFGMVYEGNGKDI--------VKGESQTRVAVKTVNESASLR 1037          

HSP 3 Score: 204.142 bits (518), Expect = 1.988e-52
Identity = 116/277 (41.88%), Postives = 165/277 (59.57%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDG------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL ++L     R D     G      K+ +  A +IADGM YL  K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+T  +D WS+GVVL+E+STL   PY G+S+E V++FV   G            L ++M  CW +    RPTF  I+E L   ++   F++VSF+++
Sbjct: 1024 RVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVVMELMTHGDLKSFLRSL--RPDSENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDLTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEVSTLAEQPYQGLSNEQVLKFV-MEGGYLDRPDNCADRLHNLMQMCWHYNPKMRPTFQEIIEMLREDLHPS-FQEVSFFYS 1277          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: igf1ra (insulin-like growth factor 1a receptor [Source:ZFIN;Acc:ZDB-GENE-020503-1])

HSP 1 Score: 229.95 bits (585), Expect = 2.124e-60
Identity = 234/968 (24.17%), Postives = 401/968 (41.43%), Query Frame = 1
Query:  181 KAKECTIVEGKVVI-------THLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEA---QCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQD---SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFK---TSQSNFEKATNDNFQPQAMCD-TCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQ-YYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            K + CT+VEG + I        +L++    +L FP L  VTDYILL   S  D  S+ +FPNL VIRG  L    AL+++   + + +   +LR+I  G + +  N  LC + ++DW  + D       +    YI  NK   S  C ++CP            + +D  +  CW+ N CQ +C   C  +       +   CCH QCLG C    N K C AC+   +++ CV +CP   Y+F+G RC+    C++ ++        +   C+ +CP   F      + +C     +  K  +       K+   +D  ++      +  +LQI    G +++ +L      ++ V  +++I  ++ L SL+FL  L  I G+  +  T        N+ L  LW        I +G + F  N  LC + I     K  ++  + + ++   +NG  A C    L       +S  ++L W+  +  +Y+ ++S + YY+              GC S  W++++    Q K+ D GV L P                  LKP T Y ++++      +D     A S  V+  T+   PS P    + +++ + + + W PP+ PNG  T Y + + + A      + E    ++C  E     +   TS S+ E  T       A  +  C  C KT E    + E+      F+  +H+ I   R  +            + + N+     ++  +SV+            N +   + + E P S  K    +  I NL  FT Y I+I AC+               + ++ CS  A   +RT+ +   D IP  +  +      GI   + + W  P   NGLIL Y++ YR+       +A    C++ +    ++     N +          SG Y  ++   +LAGNG+W+   SF
Sbjct:   76 KLENCTVVEGYLQILLIGDKNNNLNQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSV-LFPNLNVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLLMD-------AEFNNYIAGNK--QSKECGDVCPGINEDRPHCIRTSFNDNYSYRCWTSNHCQKVCPKECEKR----ACTDAGQCCHPQCLGSCTEADNDKACAACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARVHLPSEVDFVIHNGECMPDCPPG-FTRNETQSMFCSACDGLCDKVCES------KTIDSVDAAQSLQGCTVIKGNLQINIRRGNNIASELESFMGLIQTVTGYVRIKHTHTLGSLSFLKSLRYIVGEELVDNT-YAFHAVDNHNLQYLWDWTQHNLTIKTGKLYFRFNPKLCMSEIRKMWEKTSVREKMAEDDV--RSNGERASCESYILKFRSNHTQSTRIKLTWERYRPPDYRDLISFIVYYKEAPFQNITEFDGQDGCGSNSWNMVDVDLPQEKSIDPGVLLSP------------------LKPWTQYAIFVKAVTLVVEDKHVGGAKSEVVYIRTNASAPSMPLDARAYANSSSSLMVKWSPPIAPNGNKTFYFLRWQQQAE-----DGELYQHNYCSKELKIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPCPKTKEDLKAEAEDRSYRKVFENFLHNSIFTPRPPDR------KRRDLMGVANSTLVSGVSRNISVLES----------NITQPELPEKEYPFSEGKVHTEFMEIHNLRPFTVYRIDIHACN---------------YEVHRCSAAAFVFSRTKPADKADDIPGSVTQERDEKGEGI---VLLRWPEPLHPNGLILMYEIKYRLGT-----EAEKHECVSRQQYKVLRGAQLSNLA----------SGNYSARVRATSLAGNGSWTEPVSF 947          

HSP 2 Score: 206.453 bits (524), Expect = 3.818e-53
Identity = 115/279 (41.22%), Postives = 168/279 (60.22%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAER----SDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRIL----EYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L     +    S + +   K+ +  A +IADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY GMS+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+    E L P      F++VSF+++
Sbjct: 1055 RVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRSKEQGSSSQSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFV-MEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIINSIKEELEPP-----FREVSFFYS 1308          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: igf1ra (insulin-like growth factor 1a receptor [Source:ZFIN;Acc:ZDB-GENE-020503-1])

HSP 1 Score: 229.565 bits (584), Expect = 2.845e-60
Identity = 234/968 (24.17%), Postives = 401/968 (41.43%), Query Frame = 1
Query:  181 KAKECTIVEGKVVI-------THLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEA---QCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQD---SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFK---TSQSNFEKATNDNFQPQAMCD-TCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQ-YYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            K + CT+VEG + I        +L++    +L FP L  VTDYILL   S  D  S+ +FPNL VIRG  L    AL+++   + + +   +LR+I  G + +  N  LC + ++DW  + D       +    YI  NK   S  C ++CP            + +D  +  CW+ N CQ +C   C  +       +   CCH QCLG C    N K C AC+   +++ CV +CP   Y+F+G RC+    C++ ++        +   C+ +CP   F      + +C     +  K  +       K+   +D  ++      +  +LQI    G +++ +L      ++ V  +++I  ++ L SL+FL  L  I G+  +  T        N+ L  LW        I +G + F  N  LC + I     K  ++  + + ++   +NG  A C    L       +S  ++L W+  +  +Y+ ++S + YY+              GC S  W++++    Q K+ D GV L P                  LKP T Y ++++      +D     A S  V+  T+   PS P    + +++ + + + W PP+ PNG  T Y + + + A      + E    ++C  E     +   TS S+ E  T       A  +  C  C KT E    + E+      F+  +H+ I   R  +            + + N+     ++  +SV+            N +   + + E P S  K    +  I NL  FT Y I+I AC+               + ++ CS  A   +RT+ +   D IP  +  +      GI   + + W  P   NGLIL Y++ YR+       +A    C++ +    ++     N +          SG Y  ++   +LAGNG+W+   SF
Sbjct:   48 KLENCTVVEGYLQILLIGDKNNNLNQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSV-LFPNLNVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLLMD-------AEFNNYIAGNK--QSKECGDVCPGINEDRPHCIRTSFNDNYSYRCWTSNHCQKVCPKECEKR----ACTDAGQCCHPQCLGSCTEADNDKACAACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARVHLPSEVDFVIHNGECMPDCPPG-FTRNETQSMFCSACDGLCDKVCES------KTIDSVDAAQSLQGCTVIKGNLQINIRRGNNIASELESFMGLIQTVTGYVRIKHTHTLGSLSFLKSLRYIVGEELVDNT-YAFHAVDNHNLQYLWDWTQHNLTIKTGKLYFRFNPKLCMSEIRKMWEKTSVREKMAEDDV--RSNGERASCESYILKFRSNHTQSTRIKLTWERYRPPDYRDLISFIVYYKEAPFQNITEFDGQDGCGSNSWNMVDVDLPQEKSIDPGVLLSP------------------LKPWTQYAIFVKAVTLVVEDKHVGGAKSEVVYIRTNASAPSMPLDARAYANSSSSLMVKWSPPIAPNGNKTFYFLRWQQQAE-----DGELYQHNYCSKELKIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPCPKTKEDLKAEAEDRSYRKVFENFLHNSIFTPRPPDR------KRRDLMGVANSTLVSGVSRNISVLES----------NITQPELPEKEYPFSEGKVHTEFMEIHNLRPFTVYRIDIHACN---------------YEVHRCSAAAFVFSRTKPADKADDIPGSVTQERDEKGEGI---VLLRWPEPLHPNGLILMYEIKYRLGT-----EAEKHECVSRQQYKVLRGAQLSNLA----------SGNYSARVRATSLAGNGSWTEPVSF 919          

HSP 2 Score: 206.453 bits (524), Expect = 4.327e-53
Identity = 115/279 (41.22%), Postives = 168/279 (60.22%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAER----SDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRIL----EYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L     +    S + +   K+ +  A +IADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY GMS+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+    E L P      F++VSF+++
Sbjct: 1027 RVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRSKEQGSSSQSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFV-MEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIINSIKEELEPP-----FREVSFFYS 1280          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Match: igf1rb (insulin-like growth factor 1b receptor [Source:ZFIN;Acc:ZDB-GENE-020503-2])

HSP 1 Score: 224.172 bits (570), Expect = 1.205e-58
Identity = 238/991 (24.02%), Postives = 412/991 (41.57%), Query Frame = 1
Query:  106 NVTLYKRKICKFDIRIPGISMDSLI----KAKECTIVEGKVVITHLSKHMCN------SLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGC-YGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMS----ITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKD-LDQVKNCYSAERVIISLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSIS-TNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYL-------EFRFTRQDSAAI---SNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNF---EKATNDNFQPQAMCDT-CSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKS-NIPMENTSSINVKQIEIPASALKTQYYHV-ITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
             + L    +C  +I  PGI + + I    + + CT++EG + I  +     N      +L FP L  +TDY+LL F     ++   +FPNL VIRG  L    AL+++   + + +   +LR+I  G + +  N  LC + ++DW  I D       +    +I  NK   S  C N+CP    D+ +   CW+ N CQ +C   C  +       ++  CCH QCLG C    +++ C AC+   ++  CV  CP G Y+F+G RC+ +  CSK ++        +   C+ +CP      F     + V+ S + T  +  C  +  +   D +D  ++      +  +L I    G +++ +L +    ++ V  +I+I  S+ L SL+FL  L  I G+     T        N  L  LW        I  G + F  N  LC + I     K G++++  +++     NG  A C    L  T    +S  ++L W++ + S+ + +++ + YY+     N+      DS C S  W++++    +      L P  +            +S+LKP T Y +++       E R   +D   +   S  V+  T    PS P  I + S++ +++ + W PPL PNG  T Y++  WK    +   + E    ++C  E     + S +     E     N +      T C  C KT E   + ++++     F+  +H+ I   R  +                     +   A V+ +H       N+   N S     + E      K +  H+ IT L  FT Y I++ AC++                +  CS  A   +RT+ +   D IP       +   G    + + W  P K NGLI+ Y++ YR+  +    +     C++ +     K +   N             G Y  ++   +LAGNG+W+   +F
Sbjct:   15 GLVLVLSTLCHGEICGPGIDIGNDIGNFKRLENCTVIEGYLQILLIGDKNSNNQEVFRTLSFPKLTMITDYLLL-FRVSGLESLSTLFPNLAVIRGRNLFYNYALVIFELTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLILD-------AELNNFIDGNK--QSKECGNVCPGIMEDNSQCTRCWTSNHCQKVCR--CGQR----ACTDSGQCCHPQCLGSCSVPDSDRACAACQNYNHEGRCVEDCPPGTYKFEGWRCITRDFCSKVHLPDYDRFVIHAGECMSDCP----PGFTRDESHGVSVSMLCTACDGPCDKICDEKVIDSVDAAQSLKGCTVIKGNLHINIRRGTNIASELENFLGLIKTVTGYIKIRSSHTLTSLSFLKSLRYIHGEELWDNT-YAFAALDNQHLQLLWDWSQHNLTISEGKLYFRLNPKLCMSEIRKMWAKTGIKDNFVERDF--RNNGDRASCGTKILKFTSNNTRSNQIKLMWESYRPSDSRDLVNFIVYYKEAPFQNITEFDGQDS-CGSDSWNMVDVDLPDEKI---LNPGVV------------LSALKPWTQYAIFVKAVTLIVEDRDRDKDRLHLGPQSEVVYIRTKPSAPSMPVDIRAYSNSSSKLVVRWAPPLAPNGNNTYYLLR-WK----QQGEDRELYQHNYCSKELKIPVRVSATGLTDTEDTKPTNHETGGRDKTPCCPCPKTEEDLKRIEDDIYYRKAFENFLHNAIFTPRPPDR----------------RRRDLFGVANVTSIHTLLAGHWNLTEGNFSDDEPPRREFSFLERKVKERHIEITGLQPFTVYRIDLHACNEE---------------VRHCSAAAFVFSRTKAAEKADDIP-----GSVTWEGQEDSVFLKWPEPDKPNGLIMLYEIQYRLGTEPEKHE-----CVSRQHYRKHKGVKLSNLG----------PGNYSVRVRATSLAGNGSWTEPIAF 910          

HSP 2 Score: 200.675 bits (509), Expect = 2.722e-51
Identity = 112/274 (40.88%), Postives = 162/274 (59.12%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQY---AERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +           LV+MELM  GDL +YL         S   +   K+ +  A +IADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY GMS+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+  +   +    FK+ SF+++
Sbjct: 1017 RVAIKTVNESASLHERIEFLNEASVMKEFNCHHVVRLLGVVS------QGQPTLVIMELMTRGDLKSYLRSLRSVENTSSLPLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFIVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFV-MEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEDL-EAGFKETSFFYS 1269          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: INSRR (insulin receptor related receptor [Source:NCBI gene;Acc:100490498])

HSP 1 Score: 245.743 bits (626), Expect = 1.783e-127
Identity = 239/956 (25.00%), Postives = 424/956 (44.35%), Query Frame = 1
Query:  181 KAKECTIVEGKVVITHL---SKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC------SKKNMSITFN--PNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQP-QAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYY---HVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPN--CINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            K + CT+++G + I  +          LRF  L  +T+Y+LL F     ++  ++FPNL +IRG +L    +L+++     R +   SL +I +G V +  N  LC++  IDW  +       S+S +  YI  NK +    C+++CP          +  I+      CW+  +CQ +C      +D+ C  +NT  CCH +CLGGC    + + CVAC+     ++C+ SCP G +E++G RC+ +  C      S+ + S  F    NRC+ ECPS    +  + + +C     +  K  K  G   + S +   ++  C + E  +I     G +L+ +L+     +  +  F++I  S  L SL+F   L  I+G   +   N TL I  N  L +LWTP+    I  G + F  N  LC + I++     G +      ++   TNG  A C    L       ++  + L W+  Q   + +LS + +Y+               C +  W+V++ +                P +  +E    +++LKP   Y +Y+     T +++     A S+ V+  T    P+ PQ +  +S++ + + + WKPP   NG +T Y++  W+  + +      Y N ++C         ++ + F+   N N  P Q   D C  C+K    +P+  E   +  +F+  + + I + +    P  ++  N  +   P     +P      + +   P+  +    + +IN   ++    + K + +    VI+NL +FTEY I+I AC       N++ +I+       CS       RT + P  D I  + + T+  +T  N  I + W+ P   NGLIL Y++ Y  K+D+   +   P   C++ +     K +H          +  P  G Y  +I   +LAGNG+W+
Sbjct:   47 KLENCTVIQGNLQILLMFSTKPEDFRGLRFERLTMITEYLLL-FRVYGLESLRDLFPNLSIIRGTDLFFHYSLVIFEMPHLRDIGLYSLTNILNGAVRIERNQELCHISTIDWSLL-------SESVENNYIVGNKPV--EECADVCPGIRDSGESCIKTPINGNMESRCWTSTSCQKVCPC---KEDIAC--SNTGECCHPECLGGCNKAGDPRACVACRNFYIDDQCLPSCPPGTFEYEGWRCIEEAYCGNLLKESENSESTKFVIFENRCLSECPSGYTRN--DSSIFCHKCEGLCPKTCK-AGNKVIDSLEAAKELTGCTNIEGNLILNIRRGHNLASELQQSLGLIETITGFLKIKHSFALVSLSFFKNLKLIRGDTMV-DGNYTLYILDNQNLLQLWTPE-SLSIPVGKLYFAFNPKLCLSEIYHMEEITGTRGRQNKADINPRTNGDQASCNIRPLRFVSNWTEADRINLKWERYQPPGHDLLSFVVHYKESPFQNITEYLGQDACGANSWNVVDVEL---------------PLNNEQEPSVTLTNLKPWVQYAIYVRAITLTAEENGRKFGAQSDVVYIRTRPAAPTVPQDVMIMSNSSSHLIVRWKPPTQRNGNLTYYLV-LWQQMVEDKEL---YLN-NYCTKGLKLPTSSADTRFDNDDNGNQDPNQDTEDKCCPCQKDGGLHPEMDEGSFQ-KKFENFLRNTIFIPKP---PWKVTLINKDNQRAPKRRRDVPGMNPEVLGNASLPEGTV----SHTINHTGVDSKPYSYKDKVFLNRMVISNLRHFTEYRIDIHAC-------NHAAEIV------GCSAATFVFARTMQDPLADNI--VGNITW-EVTAKNA-ILMKWEEPKNPNGLILKYEIKY--KRDH---EEGPPTVVCVSRQQFQRYKGVH--------LTLLQP--GNYSARIRATSLAGNGSWT 922          

HSP 2 Score: 221.09 bits (562), Expect = 1.783e-127
Identity = 130/333 (39.04%), Postives = 177/333 (53.15%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSF------YHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSK 4297
            R  L TV++ AT  + ++FL+EA +MK FL +H+V L+G+ +           LV+MELM  GDL +YL       +      + SL   IQ    IADGM YL  K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK G++  PVRWM+PESL+  ++TT +DVWS+GVVL+EI+TL   PY GM++E V+ FV     +       P  L ++M WCW      RP+F++ILE +   +    F+QVSF        +G  E         +N + +    P    C    K    NSL       D SK
Sbjct: 1036 RVALKTVNELATTRERIEFLNEASVMKAFLCHHVVRLLGVVS------QGQPALVIMELMTRGDLKSYLRSLRPDEENNHPGNQPSLKRMIQMAGEIADGMAYLTAKKFVHRDLAARNCMVSEDLTVKIG-------------DFGMTRDIYETDYYRKGGKSLLPVRWMSPESLKDGIFTTYSDVWSFGVVLWEIATLAEQPYQGMANEQVLHFV-IDNGILEKPENCPDRLHELMRWCWQKNPKHRPSFIQILESIKDELPTS-FQQVSFCNSQERKRSGSMETSDTEVDQSLNNLLDQPPSPSFNNCSSQAKEEKGNSLKAIATKRDSSK 1347          

HSP 3 Score: 34.2686 bits (77), Expect = 1.783e-127
Identity = 25/102 (24.51%), Postives = 49/102 (48.04%), Query Frame = 3
Query: 3063 VFIMAVALISILIWYLAWKKNQR------YILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMN 3338
            + ++ +A +++ I++   K N           + N  YF +      DEW    +++ ++  +G+G+FG+VY G        AK I  N  +  +VA+K +N
Sbjct:  950 ILLVVIAFLAVFIFFYNKKGNNNGYPNGTLYASVNPEYFSASDMYVPDEWEFPRENITIIKELGQGSFGMVYEGV-------AKDIVKNEPV-TRVALKTVN 1043          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: INSRR (insulin receptor related receptor [Source:NCBI gene;Acc:100490498])

HSP 1 Score: 240.35 bits (612), Expect = 3.001e-124
Identity = 239/964 (24.79%), Postives = 424/964 (43.98%), Query Frame = 1
Query:  181 KAKECTIVEGKVVITHL---SKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC------SKKNMSITFN--PNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIA---ICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQP-QAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYY---HVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS-PLESFE 2964
            K + CT+++G + I  +          LRF  L  +T+Y+LL F     ++  ++FPNL +IRG +L    +L+++     R +   SL +I +G V +  N  LC++  IDW  +       S+S +  YI  NK +    C+++CP          +  I+      CW+  +CQ +C      +D+ C  +NT  CCH +CLGGC    + + CVAC+     ++C+ SCP G +E++G RC+ +  C      S+ + S  F    NRC+ ECPS    +  + + +C     +  K  K  G   + S +   ++  C + E  +I     G +L+ +L+     +  +  F++I  S  L SL+F   L  I+G   +   N TL I  N  L +LWTP+    I  G + F  N  LC + I++     G +      ++   TNG  A    C    L       ++  + L W+  Q   + +LS + +Y+               C +  W+V++ +                P +  +E    +++LKP   Y +Y+     T +++     A S+ V+  T    P+ PQ +  +S++ + + + WKPP   NG +T Y++  W+  + +      Y N ++C         ++ + F+   N N  P Q   D C  C+K    +P+  E   +  +F+  + + I + +       +   N + +           NA++       P+  +    + +IN   ++    + K + +    VI+NL +FTEY I+I AC       N++ +I+       CS       RT + P  D I  + + T+  +T  N  I + W+ P   NGLIL Y++ Y+ +   V+       C++ +     K +H          +  P  G Y  +I   +LAGNG+W+ P+E  E
Sbjct:   28 KLENCTVIQGNLQILLMFSTKPEDFRGLRFERLTMITEYLLL-FRVYGLESLRDLFPNLSIIRGTDLFFHYSLVIFEMPHLRDIGLYSLTNILNGAVRIERNQELCHISTIDWSLL-------SESVENNYIVGNKPV--EECADVCPGIRDSGESCIKTPINGNMESRCWTSTSCQKVCPC---KEDIAC--SNTGECCHPECLGGCNKAGDPRACVACRNFYIDDQCLPSCPPGTFEYEGWRCIEEAYCGNLLKESENSESTKFVIFENRCLSECPSGYTRN--DSSIFCHKCEGLCPKTCK-AGNKVIDSLEAAKELTGCTNIEGNLILNIRRGHNLASELQQSLGLIETITGFLKIKHSFALVSLSFFKNLKLIRGDTMV-DGNYTLYILDNQNLLQLWTPE-SLSIPVGKLYFAFNPKLCLSEIYHMEEITGTRGRQNKADINPRTNGDQASCESCNIRPLRFVSNWTEADRINLKWERYQPPGHDLLSFVVHYKESPFQNITEYLGQDACGANSWNVVDVEL---------------PLNNEQEPSVTLTNLKPWVQYAIYVRAITLTAEENGRKFGAQSDVVYIRTRPAAPTVPQDVMIMSNSSSHLIVRWKPPTQRNGNLTYYLV-LWQQMVEDKEL---YLN-NYCTKGLKLPTSSADTRFDNDDNGNQDPNQDTEDKCCPCQKDGGLHPEMDEGSFQ-KKFENFLRNTIFIPKAPKRRRDVPGMNPEVLG----------NASL-------PEGTV----SHTINHTGVDSKPYSYKDKVFLNRMVISNLRHFTEYRIDIHAC-------NHAAEIV------GCSAATFVFARTMQDPLADNI--VGNITW-EVTAKNA-ILMKWEEPKNPNGLILKYEIKYK-RPPTVV-------CVSRQQFQRYKGVH--------LTLLQP--GNYSARIRATSLAGNGSWTEPMEPSE 894          

HSP 2 Score: 216.083 bits (549), Expect = 3.001e-124
Identity = 130/338 (38.46%), Postives = 180/338 (53.25%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGM---------IDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSF------YHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSK 4297
            R  L TV++ AT  + ++FL+EA +MK FL +H+V L+G+ +           LV+MELM  GDL +YL     R D+ +            K+ +  A +IADGM YL  K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK G++  PVRWM+PESL+  ++TT +DVWS+GVVL+EI+TL   PY GM++E V+ FV     +       P  L ++M WCW      RP+F++ILE +   +    F+QVSF        +G  E         +N + +    P    C    K    NSL       D SK
Sbjct:  992 RVALKTVNELATTRERIEFLNEASVMKAFLCHHVVRLLGVVS------QGQPALVIMELMTRGDLKSYLRSL--RPDEELKYSCTSLICPSLKRMIQMAGEIADGMAYLTAKKFVHRDLAARNCMVSEDLTVKIG-------------DFGMTRDIYETDYYRKGGKSLLPVRWMSPESLKDGIFTTYSDVWSFGVVLWEIATLAEQPYQGMANEQVLHFV-IDNGILEKPENCPDRLHELMRWCWQKNPKHRPSFIQILESIKDELPTS-FQQVSFCNSQERKRSGSMETSDTEVDQSLNNLLDQPPSPSFNNCSSQAKEEKGNSLKAIATKRDSSK 1306          

HSP 3 Score: 34.6538 bits (78), Expect = 3.001e-124
Identity = 25/102 (24.51%), Postives = 49/102 (48.04%), Query Frame = 3
Query: 3063 VFIMAVALISILIWYLAWKKNQR------YILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMN 3338
            + ++ +A +++ I++   K N           + N  YF +      DEW    +++ ++  +G+G+FG+VY G        AK I  N  +  +VA+K +N
Sbjct:  906 ILLVVIAFLAVFIFFYNKKGNNNGYPNGTLYASVNPEYFSASDMYVPDEWEFPRENITIIKELGQGSFGMVYEGV-------AKDIVKNEPV-TRVALKTVN 999          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: INSR (insulin receptor [Source:NCBI gene;Acc:100492718])

HSP 1 Score: 245.743 bits (626), Expect = 9.606e-69
Identity = 269/1023 (26.30%), Postives = 433/1023 (42.33%), Query Frame = 1
Query:   25 KSICFIFIMLNYYVIFILYLLCNVNCENVTLYKRKICK-FDIRIPGISMDSLIKAKECTIVEG--KVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNA-WRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYI---KTNKFICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKN----------MSITFNPNRCVKECPSDLFASFINGTKYCVNG--STITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG-LTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDS-GVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFK------TSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNY-RIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFE 2964
            KSI  IFI      IF+L +LC+ N         KIC   DIR   IS  S+++  +CT++EG  ++++   SK      LRFP L  +TDY+LL F     ++  ++FPNL VIRG  L    AL+++     + +   +L +I  G+V +  N+ LC +  IDW  I D       S +  YI   + NK  C + C         C +  ++      CW+ + CQ++C S C  K   C  +    CCH +CLG C    +  +C AC+  +Y+  C+ +CP G Y F+G RC+    C + +               +   C+ +CPS   A+    T     G    + T Y     +  + S     +++ C      +I    GG +++ +L      +  +  +++I RS  L SL+F   L  I+G+  +   N +     N  L +LW        I+ G + F  N  LC   IH      G +      ++   TNG  A C    LN   +      V L W      +Y+ L G + +Y+               C S  W+V++       + G  L P             C + +LKP T Y V+++   +  D      A S  ++  T+  +PS P    S+S++ ++I L WKPP  PNG +T Y++ YW+    E   ++E    D+C    N G K      T  S+ E+  N N Q       C  C KT  +  ++Q+E      F+ ++H+ + + R       L    + ++  P    ++  NA+          +  P E    I  +++    S +       +T L +FT Y IEI AC+              + SM  CS  A  S RT  E + D  V P  Y+    NI      I + W+ P   NGLI+ Y+++Y R+     +      +C++ K  ++ K   AK        +R    G Y  +I   +LAGNG+W+    F+
Sbjct:   23 KSIAGIFI------IFML-ILCDQN-------DGKICPSMDIRN-NISQFSMLE--DCTVIEGHLQILLMFTSKPENFRGLRFPKLTMITDYLLL-FRVYGLESLKDLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILD-------SVEDNYIELNRDNKEECGDVCPGAGKGKSKCKQIVVNGAFIERCWTQDHCQTVCPSEC--KGSGCLPDGQ--CCHSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSCPPYVIHKGECMPDCPSGYIANSTTRTCTPCAGPCPKVCTIYQS---VKTIDSVTSAQELRGCTVVNGSLIINIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEV-LEAGNYSFYALDNPSLRQLWDWHKHNLTIIHGKLFFHHNPRLCLAEIHQMEEVTGTKGRQDKNDISTKTNGDQASCEDNLLNFNFIRTSHDMVLLKWDPYWPPDYRDLLGFMVHYKEAPYQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTLSPG------------CLLRNLKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLV-YWQ----EQPEDSELYELDYC----NKGLKLPSRTWTPPSDIEENGNIN-QTDQPSSKCCPCPKTDFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRRELFGVANGTLPDPVTAPSL-FNAS---------STRAPDETEPKIYSQKVWFKESLM-------VTGLKHFTGYRIEIHACNH-------------ELSMG-CSVAAYVSARTMPEATADNVVGPITYEYIEPNI------IHLKWQEPKDPNGLIVLYEVHYSRVGGTEEVI-----SCVSQKQYSTDKG--AK--------LRVLTPGNYSVKIRATSLAGNGSWTEPAYFQ 938          

HSP 2 Score: 38.1206 bits (87), Expect = 9.606e-69
Identity = 28/106 (26.42%), Postives = 49/106 (46.23%), Query Frame = 3
Query: 3069 IMAVALISILIWYLAWKKNQRY-----ILTRNNHYFLSGQ-----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            I  + L+ +L++ +  KK         +   +N  +LS       DEW +    + LL  +G+G+FG+VY G  K +        +     ++VAVK +N   SL+
Sbjct:  956 IAVILLLFVLVYCVIQKKKDAEGPVGPLYASSNPEYLSASEVYIPDEWEVPRDKISLLRELGQGSFGMVYEGIAKDI--------IKGEPEVRVAVKTVNESASLR 1053          

HSP 3 Score: 204.142 bits (518), Expect = 3.173e-52
Identity = 115/277 (41.52%), Postives = 167/277 (60.29%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDG------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LV+MELM +GDL +YL     R D     G      K+ +  A +I+DGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI++L   PY G+S+E V++FV   G         P  L  +M  CW +    RPTF+ I++ L   ++   F++VSFY++
Sbjct: 1040 RVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVIMELMTHGDLKSYLRSL--RPDAENNPGRPAPTLKEMIQMAAEISDGMAYLNAKKFVHRDLAARNCMVAEDYTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFV-MDGGSLDQPENCPPRLHSLMQMCWQYNPKMRPTFLEIIDMLKDDLHLS-FQEVSFYYS 1293          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: INSR (insulin receptor [Source:NCBI gene;Acc:100492718])

HSP 1 Score: 239.58 bits (610), Expect = 3.885e-67
Identity = 248/968 (25.62%), Postives = 407/968 (42.05%), Query Frame = 1
Query:  187 KECTIVEG--KVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNA-WRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYI---KTNKFICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKN----------MSITFNPNRCVKECPSDLFASFINGTKYCVNG--STITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG-LTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDS-GVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFK------TSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNY-RIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFE 2964
            ++CT++EG  ++++   SK      LRFP L  +TDY+LL F     ++  ++FPNL VIRG  L    AL+++     + +   +L +I  G+V +  N+ LC +  IDW  I D       S +  YI   + NK  C + C         C +  ++      CW+ + CQ++C S C  K   C  +    CCH +CLG C    +  +C AC+  +Y+  C+ +CP G Y F+G RC+    C + +               +   C+ +CPS   A+    T     G    + T Y     +  + S     +++ C      +I    GG +++ +L      +  +  +++I RS  L SL+F   L  I+G+  +   N +     N  L +LW        I+ G + F  N  LC   IH      G +      ++   TNG  A C    LN   +      V L W      +Y+ L G + +Y+               C S  W+V++       + G  L P             C + +LKP T Y V+++   +  D      A S  ++  T+  +PS P    S+S++ ++I L WKPP  PNG +T Y++ YW+    E   ++E    D+C    N G K      T  S+ E+  N N Q       C  C KT  +  ++Q+E      F+ ++H+ + + R       L    + ++  P    ++  NA+          +  P E    I  +++    S +       +T L +FT Y IEI AC+              + SM  CS  A  S RT  E + D  V P  Y+    NI      I + W+ P   NGLI+ Y+++Y R+     +      +C++ K  ++ K   AK        +R    G Y  +I   +LAGNG+W+    F+
Sbjct:   24 EDCTVIEGHLQILLMFTSKPENFRGLRFPKLTMITDYLLL-FRVYGLESLKDLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILD-------SVEDNYIELNRDNKEECGDVCPGAGKGKSKCKQIVVNGAFIERCWTQDHCQTVCPSEC--KGSGCLPDGQ--CCHSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSCPPYVIHKGECMPDCPSGYIANSTTRTCTPCAGPCPKVCTIYQS---VKTIDSVTSAQELRGCTVVNGSLIINIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEV-LEAGNYSFYALDNPSLRQLWDWHKHNLTIIHGKLFFHHNPRLCLAEIHQMEEVTGTKGRQDKNDISTKTNGDQASCEDNLLNFNFIRTSHDMVLLKWDPYWPPDYRDLLGFMVHYKEAPYQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTLSPG------------CLLRNLKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLV-YWQ----EQPEDSELYELDYC----NKGLKLPSRTWTPPSDIEENGNIN-QTDQPSSKCCPCPKTDFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRRELFGVANGTLPDPVTAPSL-FNAS---------STRAPDETEPKIYSQKVWFKESLM-------VTGLKHFTGYRIEIHACNH-------------ELSMG-CSVAAYVSARTMPEATADNVVGPITYEYIEPNI------IHLKWQEPKDPNGLIVLYEVHYSRVGGTEEVI-----SCVSQKQYSTDKG--AK--------LRVLTPGNYSVKIRATSLAGNGSWTEPAYFQ 901          

HSP 2 Score: 38.5058 bits (88), Expect = 3.885e-67
Identity = 33/130 (25.38%), Postives = 59/130 (45.38%), Query Frame = 3
Query: 2997 AYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRY-----ILTRNNHYFLSGQ-----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            AYF    P   + ++KI     + +  + L+ +L++ +  KK         +   +N  +LS       DEW +    + LL  +G+G+FG+VY G  K +        +     ++VAVK +N   SL+
Sbjct:  898 AYFQ--VPDHRNSIVKIVTGPVIAV--ILLLFVLVYCVIQKKKDAEGPVGPLYASSNPEYLSASEVYIPDEWEVPRDKISLLRELGQGSFGMVYEGIAKDI--------IKGEPEVRVAVKTVNESASLR 1015          

HSP 3 Score: 204.142 bits (518), Expect = 2.834e-52
Identity = 115/277 (41.52%), Postives = 167/277 (60.29%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDG------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LV+MELM +GDL +YL     R D     G      K+ +  A +I+DGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI++L   PY G+S+E V++FV   G         P  L  +M  CW +    RPTF+ I++ L   ++   F++VSFY++
Sbjct: 1002 RVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVIMELMTHGDLKSYLRSL--RPDAENNPGRPAPTLKEMIQMAAEISDGMAYLNAKKFVHRDLAARNCMVAEDYTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFV-MDGGSLDQPENCPPRLHSLMQMCWQYNPKMRPTFLEIIDMLKDDLHLS-FQEVSFYYS 1255          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Match: INSR (insulin receptor [Source:NCBI gene;Acc:100492718])

HSP 1 Score: 243.817 bits (621), Expect = 1.117e-64
Identity = 251/981 (25.59%), Postives = 412/981 (42.00%), Query Frame = 1
Query:  187 KECTIVEG--KVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNA-WRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYI---KTNKFICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKN----------MSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECG---------LLFLKSFKDLDQV------KNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG-LTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDS-GVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFK------TSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNY-RIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFE 2964
            ++CT++EG  ++++   SK      LRFP L  +TDY+LL F     ++  ++FPNL VIRG  L    AL+++     + +   +L +I  G+V +  N+ LC +  IDW  I D       S +  YI   + NK  C + C         C +  ++      CW+ + CQ++C S C  K   C  +    CCH +CLG C    +  +C AC+  +Y+  C+ +CP G Y F+G RC+    C + +               +   C+ +CPSD+F  +          S + + Y++ C              +S K +D V      + C      +I    GG +++ +L      +  +  +++I RS  L SL+F   L  I+G+  +   N +     N  L +LW        I+ G + F  N  LC   IH      G +      ++   TNG  A C    LN   +      V L W      +Y+ L G + +Y+               C S  W+V++       + G  L P             C + +LKP T Y V+++   +  D      A S  ++  T+  +PS P    S+S++ ++I L WKPP  PNG +T Y++ YW+    E   ++E    D+C    N G K      T  S+ E+  N N Q       C  C KT  +  ++Q+E      F+ ++H+ + + R       L    + ++  P    ++  NA+          +  P E    I  +++    S +       +T L +FT Y IEI AC+              + SM  CS  A  S RT  E + D  V P  Y+    NI      I + W+ P   NGLI+ Y+++Y R+     +      +C++ K  ++ K   AK        +R    G Y  +I   +LAGNG+W+    F+
Sbjct:   14 EDCTVIEGHLQILLMFTSKPENFRGLRFPKLTMITDYLLL-FRVYGLESLKDLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILD-------SVEDNYIELNRDNKEECGDVCPGAGKGKSKCKQIVVNGAFIERCWTQDHCQTVCPSEC--KGSGCLPDGQ--CCHSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSCPPYVIHKGECMPDCPSDIFYFY----------SDVPSLYSRTCTPCAGPCPKVCTIYQSVKTIDSVTSAQELRGCTVVNGSLIINIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEV-LEAGNYSFYALDNPSLRQLWDWHKHNLTIIHGKLFFHHNPRLCLAEIHQMEEVTGTKGRQDKNDISTKTNGDQASCEDNLLNFNFIRTSHDMVLLKWDPYWPPDYRDLLGFMVHYKEAPYQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTLSPG------------CLLRNLKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLV-YWQ----EQPEDSELYELDYC----NKGLKLPSRTWTPPSDIEENGNIN-QTDQPSSKCCPCPKTDFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRRELFGVANGTLPDPVTAPSL-FNAS---------STRAPDETEPKIYSQKVWFKESLM-------VTGLKHFTGYRIEIHACNH-------------ELSMG-CSVAAYVSARTMPEATADNVVGPITYEYIEPNI------IHLKWQEPKDPNGLIVLYEVHYSRVGGTEEVI-----SCVSQKQYSTDKG--AK--------LRVLTPGNYSVKIRATSLAGNGSWTEPAYFQ 897          

HSP 2 Score: 204.142 bits (518), Expect = 2.597e-52
Identity = 115/277 (41.52%), Postives = 167/277 (60.29%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDG------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LV+MELM +GDL +YL     R D     G      K+ +  A +I+DGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI++L   PY G+S+E V++FV   G         P  L  +M  CW +    RPTF+ I++ L   ++   F++VSFY++
Sbjct:  982 RVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVIMELMTHGDLKSYLRSL--RPDAENNPGRPAPTLKEMIQMAAEISDGMAYLNAKKFVHRDLAARNCMVAEDYTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFV-MDGGSLDQPENCPPRLHSLMQMCWQYNPKMRPTFLEIIDMLKDDLHLS-FQEVSFYYS 1235          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Insrr (insulin receptor-related receptor [Source:MGI Symbol;Acc:MGI:1346037])

HSP 1 Score: 213.772 bits (543), Expect = 1.809e-114
Identity = 241/1000 (24.10%), Postives = 400/1000 (40.00%), Query Frame = 1
Query:  127 KICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP-----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSK----KNMSITFN--PNRCVKECPSDLFASFINGTKYCVNGSTITTKY-----NKEC--GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKL--WTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEF--RFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKD--FCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF-----EYKETNG 2982
            ++C   DIR     +  L + + C++VEG + I  +        R   FP L +VTDY+LL F     ++  ++FPNL VIRG  L  G ALI++     R +   SL ++  G V V  N  LC++  IDW  +     + +  T   +I  NK      C+++CP             T   +    CW+ + CQ +C      + + C       CCH +CLGGC    + + CVAC+ L ++  C+ +CP G Y+++  RCV    C+       ++ TF      C+ +CP            +  NGS+I          KEC  G   + S +    +  C   E  +I     G +L  +L+     +  +  F++I  S  L +L F   L  I+G + +   N TL +  N  L +L  W       I  G + F  N  LC   I+      G +      E+   TNG  A C    L       +   + L W+  +    + +LS + YY+               C +  W++++ +    +  + GV L P                  LKP T Y V++      T +DS    A S  V+  T    P+ PQ + S S++ + + + WKPP+  NG IT Y++ + + A   + + N+Y ++      S  +T F       E       +P+  C  C            + +E+    +F+  +H  I + +    P  ++S N                   S  H+         +N S   +++ ++P      +   +++ L +FTEY I+I AC       N++   +       CS       RT    + D IP    K      G    +T+ W  PP  NGLIL Y++ YR   +       T  C++      +  +H          +  P  G Y  ++   +LAGNG+W+   +F     E ++T G
Sbjct:   28 EVCPSLDIRS---EVTELRRLENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLL-FRVYGLESLRDLFPNLTVIRGTRLFLGYALIIFEMPHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLL-----QPAPGTN--HIVGNKL--GEECADVCPGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVCPC---PRGMACTAGGD--CCHSECLGGCSQPEDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCAHLREVPGLATTFGIYEGSCLAQCPPG----------FTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQATQDLVGCTHVEGNLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNLKLIRGDSMV-DGNYTLYVLDNQNLQQLGSWV-TAGLTIPVGKIYFAFNPRLCLEHIYQLEEVTGTRGRQSKAEINPRTNGDRAACQTRTLRFVFNLTEEDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAP------------------LKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNITYYLVLWQRLAEDGDLYINDYCHRGLRLPTSSHDTRFDREDPALEA------EPEQGCCPCQHSPPGQALPALEAQEVTFQKKFENFLHHAITIPKA---PWKVTSINKNP-------------QRDSERHRREAGLLRLGKNNSDFEIQEDKVP------RERAILSGLRHFTEYRIDIHAC-------NHAAHTV------GCSAATFVFARTMPHREADGIP---GKVAWKAAG-KSSVTLHWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSRLRYAKVGGVH--------LALLPP--GNYSAKVRATSLAGNGSWTDGVTFYITDLEEEDTGG 919          

HSP 2 Score: 199.904 bits (507), Expect = 1.809e-114
Identity = 113/270 (41.85%), Postives = 160/270 (59.26%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ A+  + V+FL EA +MK F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L      ++      + +L   IQ    IADGM YLA K+FVHRDLAARNC+V  D  +KIG             DFG+T+ + E DYYRK G+   PVRWMAPESL+  ++TT +DVWS+GVVL+EI TL   PY G+S+E V++FV   G +  +    P  L ++M  CW      RPTF+ IL+ +   +    F+  SFY++
Sbjct: 1014 TVNELASARERVEFLKEASVMKAFKCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIG-------------DFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFV-MDGGVLEELENCPIQLQELMRLCWQHSPRLRPTFVHILDRIQDELRPS-FRLCSFYYS 1262          

HSP 3 Score: 43.5134 bits (101), Expect = 1.809e-114
Identity = 24/88 (27.27%), Postives = 47/88 (53.41%), Query Frame = 3
Query: 3045 ITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFV 3296
            +T +   F++ V L ++  +Y + K+N     + N  YF +      DEW +  + + ++  +G+G+FG+VY G  + LE+  +S  V
Sbjct:  924 LTVTPVGFMLLVTLAALGFFY-SRKRNSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIRELGQGSFGMVYEGLARGLEAGEESTPV 1010          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Insrr (insulin receptor-related receptor [Source:MGI Symbol;Acc:MGI:1346037])

HSP 1 Score: 213.772 bits (543), Expect = 1.809e-114
Identity = 241/1000 (24.10%), Postives = 400/1000 (40.00%), Query Frame = 1
Query:  127 KICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP-----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSK----KNMSITFN--PNRCVKECPSDLFASFINGTKYCVNGSTITTKY-----NKEC--GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKL--WTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEF--RFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKD--FCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF-----EYKETNG 2982
            ++C   DIR     +  L + + C++VEG + I  +        R   FP L +VTDY+LL F     ++  ++FPNL VIRG  L  G ALI++     R +   SL ++  G V V  N  LC++  IDW  +     + +  T   +I  NK      C+++CP             T   +    CW+ + CQ +C      + + C       CCH +CLGGC    + + CVAC+ L ++  C+ +CP G Y+++  RCV    C+       ++ TF      C+ +CP            +  NGS+I          KEC  G   + S +    +  C   E  +I     G +L  +L+     +  +  F++I  S  L +L F   L  I+G + +   N TL +  N  L +L  W       I  G + F  N  LC   I+      G +      E+   TNG  A C    L       +   + L W+  +    + +LS + YY+               C +  W++++ +    +  + GV L P                  LKP T Y V++      T +DS    A S  V+  T    P+ PQ + S S++ + + + WKPP+  NG IT Y++ + + A   + + N+Y ++      S  +T F       E       +P+  C  C            + +E+    +F+  +H  I + +    P  ++S N                   S  H+         +N S   +++ ++P      +   +++ L +FTEY I+I AC       N++   +       CS       RT    + D IP    K      G    +T+ W  PP  NGLIL Y++ YR   +       T  C++      +  +H          +  P  G Y  ++   +LAGNG+W+   +F     E ++T G
Sbjct:   28 EVCPSLDIRS---EVTELRRLENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLL-FRVYGLESLRDLFPNLTVIRGTRLFLGYALIIFEMPHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLL-----QPAPGTN--HIVGNKL--GEECADVCPGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVCPC---PRGMACTAGGD--CCHSECLGGCSQPEDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCAHLREVPGLATTFGIYEGSCLAQCPPG----------FTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQATQDLVGCTHVEGNLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNLKLIRGDSMV-DGNYTLYVLDNQNLQQLGSWV-TAGLTIPVGKIYFAFNPRLCLEHIYQLEEVTGTRGRQSKAEINPRTNGDRAACQTRTLRFVFNLTEEDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAP------------------LKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNITYYLVLWQRLAEDGDLYINDYCHRGLRLPTSSHDTRFDREDPALEA------EPEQGCCPCQHSPPGQALPALEAQEVTFQKKFENFLHHAITIPKA---PWKVTSINKNP-------------QRDSERHRREAGLLRLGKNNSDFEIQEDKVP------RERAILSGLRHFTEYRIDIHAC-------NHAAHTV------GCSAATFVFARTMPHREADGIP---GKVAWKAAG-KSSVTLHWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSRLRYAKVGGVH--------LALLPP--GNYSAKVRATSLAGNGSWTDGVTFYITDLEEEDTGG 919          

HSP 2 Score: 199.904 bits (507), Expect = 1.809e-114
Identity = 113/270 (41.85%), Postives = 160/270 (59.26%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ A+  + V+FL EA +MK F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L      ++      + +L   IQ    IADGM YLA K+FVHRDLAARNC+V  D  +KIG             DFG+T+ + E DYYRK G+   PVRWMAPESL+  ++TT +DVWS+GVVL+EI TL   PY G+S+E V++FV   G +  +    P  L ++M  CW      RPTF+ IL+ +   +    F+  SFY++
Sbjct: 1014 TVNELASARERVEFLKEASVMKAFKCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIG-------------DFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFV-MDGGVLEELENCPIQLQELMRLCWQHSPRLRPTFVHILDRIQDELRPS-FRLCSFYYS 1262          

HSP 3 Score: 43.5134 bits (101), Expect = 1.809e-114
Identity = 24/88 (27.27%), Postives = 47/88 (53.41%), Query Frame = 3
Query: 3045 ITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFV 3296
            +T +   F++ V L ++  +Y + K+N     + N  YF +      DEW +  + + ++  +G+G+FG+VY G  + LE+  +S  V
Sbjct:  924 LTVTPVGFMLLVTLAALGFFY-SRKRNSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIRELGQGSFGMVYEGLARGLEAGEESTPV 1010          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Insr (insulin receptor [Source:MGI Symbol;Acc:MGI:96575])

HSP 1 Score: 245.358 bits (625), Expect = 3.199e-65
Identity = 262/995 (26.33%), Postives = 416/995 (41.81%), Query Frame = 1
Query:  115 LYKRKICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNA-WRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK---FICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM-----------SITFNPNRCVKECPSDLFASFINGTKYCVNGSTIT-----TKYNKECGLL----FLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAF-IGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG--LTYYRSISTNMKNGGFSDSGCSSVIWSV--IEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE----FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMT---RFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPK-SNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            LY  ++C   DIR    ++  L + + C+++EG + I  + K      R   FP L  +TDY+LL F     ++  ++FPNL VIRG  L    AL+++     + L   +L +I  G+V +  N+ LC +  IDW  I D       S +  YI  NK     C + C         CP   I+ Q    CW+++ CQ +C +IC S           +CCHK+CLG C    +   CVAC+      +CV +CP  YY F+  RCV+   C   +                + N+C+ ECPS           Y +N S +          K C +L     + S     +++ C      +I    GG +L+ +L      +  +  F++I RS  L SL+F   L  I+G+   IG  N +     N  L +LW        I  G + F  N  LC + IH      G +      ++   TNG  A C    L  + +      + L W+     +++ L G  L Y  +   N+      D+ C S  W+V  I+   ++ND      P S  P   G      +  LKP T Y ++++    F   R+   A S+ ++  T    PS P    S+S++ ++I L WKPP  PNG IT Y++Y+ + A  E+S   E    D+C        +T    FE   +         D+ S C    + + Q  +EL E +    F+ ++H+V+ V R      SL    + +        T+P    VS    PT +  + P E    +N + +             VI+ L +FT Y IE+ AC+Q   +               CS  A  S RT  E   D D++ P+  + +      N  + + W+ P + NGLI+ Y+++YR   D  +       C++ K     +    +  S           G Y  ++   +LAGNG+W+
Sbjct:   29 LYPGEVCPGMDIRN---NLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLL-FRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILD-------SVEDNYIVLNKDDNEECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHG----CTAEGLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPGCHQYVIHNNKCIPECPSG----------YTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIG--NYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDA-CGSNSWTVVDIDPPQRSND------PKSQTPSHPG----WLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQA--EDS---ELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLEEVGNVTATT----LTLPDFPNVSSTIVPTSQEEHRPFEKV--VNKESL-------------VISGLRHFTGYRIELQACNQDSPD-------------ERCSVAAYVSARTMPEAKAD-DIVGPVTHEIFE-----NNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHL-----CVSRKHFALERGCRLRGLS----------PGNYSVRVRATSLAGNGSWT 927          

HSP 2 Score: 204.142 bits (518), Expect = 3.854e-57
Identity = 112/270 (41.48%), Postives = 161/270 (59.63%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL ++L      ++        +L   IQ    IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+T  +D+WS+GVVL+EI++L   PY G+S+E V++FV   G         P  L D+M  CW F    RPTF+ I+  L   ++   F +VSF+++
Sbjct: 1048 TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGV----VSKGQPT--LVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFV-MDGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS-FPEVSFFYS 1296          

HSP 3 Score: 40.0466 bits (92), Expect = 3.854e-57
Identity = 20/61 (32.79%), Postives = 32/61 (52.46%), Query Frame = 3
Query: 3174 DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            DEW +  + + LL  +G+G+FG+VY G  K +        +      +VAVK +N   SL+
Sbjct: 1004 DEWEVPREKITLLRELGQGSFGMVYEGNAKDI--------IKGEAETRVAVKTVNESASLR 1056          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Igf1r (insulin-like growth factor I receptor [Source:MGI Symbol;Acc:MGI:96433])

HSP 1 Score: 216.853 bits (551), Expect = 2.584e-56
Identity = 236/972 (24.28%), Postives = 398/972 (40.95%), Query Frame = 1
Query:  154 PGISM----DSLIKAKECTIVEGKVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSCSN------MCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCY-GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC-------SKKNMSITFNPNRCVKECPSDLFASFINGTKYCV--NGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPK-FRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLT-YYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE---FRFTRQD--SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKD------FCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIP--ASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            PGI +      L + + CT++EG + I  +SK     S RFP L  +T+Y+LL F     ++  ++FPNL VIRG++L    AL+++     + +   +LR+I  G + +  N++LC +  IDW  I D       +    YI  NK    C + C        MC + TI+++    CW+ N CQ +C S+C  +   C  NN   CCH +CLG C+    N  CVAC+   YK  CV +CP G Y F+G RCV +  C       S  +     + + C++ECPS  F      + YC+   G       ++E     + S      ++ C   +  ++     G +++ +L +    + +V  +++I  S+ L SL+FL  L  I G+  + + N +  +  N  L +LW  + +   + SG + F  N  LC + I+      G +      ++    NG  A C    L  T        + + W   +  +Y+ L   T YY+               C S  W++++     N  G   +P  L            +  LKP T Y VY++         D    A S  ++  T+  +PS P  + S S++ +++ + W PP  PNG ++ YI+ + +       + + Y +KD      +     +    T     E    D          C  C KT      ++EE      F+  +H+ I V R +     +    + ++      ++   N TV+  +           N +     + E P   S +  +   VI+NL  FT Y I+I +C+                    CS       RT  +   D IP P+ ++    N       I + W  P   NGLIL Y++ Y  + ++         C++ +              Y    +     G Y  +I   +L+GNG+W+
Sbjct:   35 PGIDIRNDYQQLKRLENCTVIEGFLHILLISKAEDYRSYRFPKLTVITEYLLL-FRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILD-------AVSNNYIVGNKPPKECGDLCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRA--CTENNE--CCHPECLGSCHTPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHDDECMQECPSG-FIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQL-EGNYSFYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKEG---EPGIL------------LHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDK-------GPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERRRRDVMQVANTTM------SSRSRNTTVADTY-----------NITDPEEFETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLG-------------CSASNFVFARTMPAEGADDIPGPVTWEPRPEN------SIFLKWPEPENPNGLILMYEIKYGSQVED------QRECVSRQEY----------RKYGGAKLNRLNPGNYTARIQATSLSGNGSWT 918          

HSP 2 Score: 202.986 bits (515), Expect = 5.221e-52
Identity = 116/276 (42.03%), Postives = 165/276 (59.78%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQ-YAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV++AA++ + ++FL+EA +MK+F  +H+V L+G+ +   Q   +L   V+MELM  GDL +YL     E     ++    SL   IQ    IADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY G+S+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+  +   +    F++VSFY++
Sbjct: 1030 RVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV-MEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIIGSIKDEMEPS-FQEVSFYYS 1284          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Match: Axl (AXL receptor tyrosine kinase [Source:MGI Symbol;Acc:MGI:1347244])

HSP 1 Score: 156.762 bits (395), Expect = 3.781e-38
Identity = 90/244 (36.89%), Postives = 142/244 (58.20%), Query Frame = 2
Query: 3362 TIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLL-WAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYL 4090
            T  ++  FLSEA  MK+F   +++ LIG+      +     P+V++  M++GDL ++L  Y+   D+ +    Q L+ +   IA GM YL+ KRF+HRDLAARNC+++ ++++ +              DFGL+K I   DYYR+   AK PV+W+A ESL   VYT+K+DVWS+GV ++EI+T G  PY G+ +  + +++R G +L      +   L  +M+ CW     DRP+F  + E L
Sbjct:  560 TRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFL-LYSRLGDQPVFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVA-------------DFGLSKKIYNGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPVDCL-DGLYALMSRCWELNPRDRPSFAELREDL 788          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|O73798|IGF1R_XENLA (Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.347e-121
Identity = 257/996 (25.80%), Postives = 419/996 (42.07%), Query Frame = 1
Query:  127 KICK--FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNS---LRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSI------TFNPNRCVKECPSDLFASFINGTKYCVNGSTITT--KYNKECGLLFLKSFKDLDQVKNCYSAERVII---SLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLT-YYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVY-----LEFRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNA----LFENS--FNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRK-KNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQY---YHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            K+C    DIR     +  L + ++C ++EG + I  +S         LRFP L  +TDY+LL F      +  N+FPNL VIRG  L    AL+++     + +   +LR+I  G V +  NS LC V  +DW  + D       +    YI  NK      C ++CP          + +I+++    CWS   CQ +C S+C  +   C  NN   CCH +CLG C    N   CVAC    Y+  CV +CP   Y+F+G RC+ +  C+K ++ I        +   CV ECPS           Y +N S   T       C  +  +  K +D V +    E   +   +LQ+    G++++ +L +    +  V  +++I  S+ L SL+FL  L  I G+  +   N +  +  NN L +LW        I  G +RF  N  LC + I+      G +    ++++  STNG++A C    LN T        ++L W+  +  +Y+ L   T YY+               C S  W++++      K +D G+ L+                   LKP T Y +Y     L     R    A S  ++  T   +PS PQ + S S++ +++ + W PP  PNG ++ YI+ + +      L++ +  F ++  N+ +     +T   T  +  E +  +          C+ C KT      +++E      F+  +H+ I V R  +   + L+  NS   +   N TT   +                  N S      IE P    K  Y     VI+NL  FT Y I+I +C+                    CS       RT  +   D IP I + T     G+   I + W  P + NGLIL Y++ Y+ + +           ++ + ++  +  + KN   +  ++R P  G Y  Q+   +L GNG+W+ + SF
Sbjct:   26 KVCGPNMDIRN---DVSELKQLRDCVVIEGYLQILLISNAKAEDFRNLRFPNLTVITDYLLL-FRVSGLVSLSNLFPNLTVIRGRVLFYNYALVIFEMTDLKEIGLYNLRNITRGAVRIEKNSELCYVSTVDWSLVLD-------AVYNNYIVGNK--PPKECVDLCPGAREKMQICEKSSINNEFADRCWSDEHCQKVCPSVCGKRA--CSDNNE--CCHPECLGSCTAPDNDTACVACHHYFYEGRCVPTCPSNTYKFEGWRCITREVCAKMHIWIHSTIPFIIHKGECVYECPSG----------YMLNKSQSMTCSPCEGPCPKICEEKMKTIDSVTSAQMLEGCTVLKGNLQLNIRKGQNIAAELENFLGLIETVTGYVKIRHSHALVSLSFLKSLRYILGEEQM-PGNYSFYVFDNNNLQQLWDWSKHNLTIKEGKIRFAFNSKLCASEIYRMEEVTGTKGRQAEEDISLSTNGNMASCESHVLNFTSRSKIKNRIKLTWERYRPPDYRDLISFTVYYKEAPFRNVTEYDGQDACGSNSWNMVDVDLPASKESDPGILLQ------------------GLKPWTQYAIYVKAITLTMLENRHIHGAKSKIIYMRTDAAVPSIPQDMISASNSSSQLVVKWNPPSLPNGNLSYYIVRWQQQPQDRHLYQYNYCFKDKVPNRKYANGTIDTEGGTEPTKPEGSVGEKGH------YCA-CPKTEAEEKAEKDEAEYRKVFENFLHNSIFVPRPNRRRRDVLAVGNSTVTSYEKNSTTEDFS------------------NFSDSERDDIEYPFYETKVDYKWERTVISNLQPFTLYRIDIHSCNHEAEKLG-------------CSASNFVFARTMPAAGADDIPGIVN-TKEEDDGV---IFLGWPEPLRPNGLILMYEIEYKHQGE-----------VHRECVS--RQDYRKNGGIK--LVRLP-PGNYSAQVQAISLYGNGSWTEMVSF 917          

HSP 2 Score: 209.92 bits (533), Expect = 1.347e-121
Identity = 115/270 (42.59%), Postives = 161/270 (59.63%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++AA++ + ++FL+EA +MK+F  +H+V L+G+ +           LV+MELM  GDL +YL      ++        SL   IQ    IADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY GMS+E V+ FV   G L       P  L ++M  CW F    RP+F+ I+  +   + +  FK+VSF+++
Sbjct: 1030 TVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVS------QGQPTLVIMELMTRGDLKSYLRSLRPDTESNSGQPTPSLKKMIQMAGEIADGMSYLNANKFVHRDLAARNCMVTEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFV-MEGGLLEKPDNCPDMLFELMRMCWQFNPKMRPSFLEIISSIKDEL-DPGFKEVSFFYS 1278          

HSP 3 Score: 33.8834 bits (76), Expect = 1.347e-121
Identity = 25/102 (24.51%), Postives = 47/102 (46.08%), Query Frame = 3
Query: 3078 VALISILIWYLAWKKNQRY-----ILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            V +ISI+ +    + + R        + N  YF + +    D+W +  + + +   +G+G+FG+VY G  K +        V      KVA+K +N   S++
Sbjct:  945 VGIISIVCFVFKKRNSNRLGNGVLYASVNPEYFSAAEMYVPDKWEVPREKITMNRELGQGSFGMVYEGIAKGV--------VKDEAETKVAIKTVNEAASMR 1038          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q9WTL4|INSRR_MOUSE (Insulin receptor-related protein OS=Mus musculus OX=10090 GN=Insrr PE=1 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 1.106e-113
Identity = 241/1000 (24.10%), Postives = 400/1000 (40.00%), Query Frame = 1
Query:  127 KICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP-----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSK----KNMSITFN--PNRCVKECPSDLFASFINGTKYCVNGSTITTKY-----NKEC--GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKL--WTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEF--RFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKD--FCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF-----EYKETNG 2982
            ++C   DIR     +  L + + C++VEG + I  +        R   FP L +VTDY+LL F     ++  ++FPNL VIRG  L  G ALI++     R +   SL ++  G V V  N  LC++  IDW  +     + +  T   +I  NK      C+++CP             T   +    CW+ + CQ +C      + + C       CCH +CLGGC    + + CVAC+ L ++  C+ +CP G Y+++  RCV    C+       ++ TF      C+ +CP            +  NGS+I          KEC  G   + S +    +  C   E  +I     G +L  +L+     +  +  F++I  S  L +L F   L  I+G + +   N TL +  N  L +L  W       I  G + F  N  LC   I+      G +      E+   TNG  A C    L       +   + L W+  +    + +LS + YY+               C +  W++++ +    +  + GV L P                  LKP T Y V++      T +DS    A S  V+  T    P+ PQ + S S++ + + + WKPP+  NG IT Y++ + + A   + + N+Y ++      S  +T F       E       +P+  C  C            + +E+    +F+  +H  I + +    P  ++S N                   S  H+         +N S   +++ ++P      +   +++ L +FTEY I+I AC       N++   +       CS       RT    + D IP    K      G    +T+ W  PP  NGLIL Y++ YR   +       T  C++      +  +H          +  P  G Y  ++   +LAGNG+W+   +F     E ++T G
Sbjct:   28 EVCPSLDIRS---EVTELRRLENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLL-FRVYGLESLRDLFPNLTVIRGTRLFLGYALIIFEMPHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLL-----QPAPGTN--HIVGNKL--GEECADVCPGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVCPC---PRGMACTAGGD--CCHSECLGGCSQPEDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCAHLREVPGLATTFGIYEGSCLAQCPPG----------FTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQATQDLVGCTHVEGNLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNLKLIRGDSMV-DGNYTLYVLDNQNLQQLGSWV-TAGLTIPVGKIYFAFNPRLCLEHIYQLEEVTGTRGRQSKAEINPRTNGDRAACQTRTLRFVFNLTEEDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAP------------------LKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNITYYLVLWQRLAEDGDLYINDYCHRGLRLPTSSHDTRFDREDPALEA------EPEQGCCPCQHSPPGQALPALEAQEVTFQKKFENFLHHAITIPKA---PWKVTSINKNP-------------QRDSERHRREAGLLRLGKNNSDFEIQEDKVP------RERAILSGLRHFTEYRIDIHAC-------NHAAHTV------GCSAATFVFARTMPHREADGIP---GKVAWKAAG-KSSVTLHWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSRLRYAKVGGVH--------LALLPP--GNYSAKVRATSLAGNGSWTDGVTFYITDLEEEDTGG 919          

HSP 2 Score: 199.904 bits (507), Expect = 1.106e-113
Identity = 113/270 (41.85%), Postives = 160/270 (59.26%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ A+  + V+FL EA +MK F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L      ++      + +L   IQ    IADGM YLA K+FVHRDLAARNC+V  D  +KIG             DFG+T+ + E DYYRK G+   PVRWMAPESL+  ++TT +DVWS+GVVL+EI TL   PY G+S+E V++FV   G +  +    P  L ++M  CW      RPTF+ IL+ +   +    F+  SFY++
Sbjct: 1014 TVNELASARERVEFLKEASVMKAFKCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIG-------------DFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFV-MDGGVLEELENCPIQLQELMRLCWQHSPRLRPTFVHILDRIQDELRPS-FRLCSFYYS 1262          

HSP 3 Score: 43.5134 bits (101), Expect = 1.106e-113
Identity = 24/88 (27.27%), Postives = 47/88 (53.41%), Query Frame = 3
Query: 3045 ITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFV 3296
            +T +   F++ V L ++  +Y + K+N     + N  YF +      DEW +  + + ++  +G+G+FG+VY G  + LE+  +S  V
Sbjct:  924 LTVTPVGFMLLVTLAALGFFY-SRKRNSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIRELGQGSFGMVYEGLARGLEAGEESTPV 1010          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|Q64716|INSRR_RAT (Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3)

HSP 1 Score: 213.772 bits (543), Expect = 1.211e-113
Identity = 240/1007 (23.83%), Postives = 393/1007 (39.03%), Query Frame = 1
Query:  127 KICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP-----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCV------HKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKY-----NKEC--GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKL--WTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEF--RFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKD--FCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKK-------NNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF-----EYKETNG 2982
            ++C   DIR     +  L + + C++VEG + I  +        R   FP L +VTDY+LL F     ++  ++FPNL VIRG  L  G ALI++     R +   SL ++  G V V  N  LC++  IDW  +         +    +I  NK      C+++CP             T        CW+ + CQ +C      + L C V     CCH +CLGGC    + + CVAC+ L ++  C+ +CP G Y+++  RCV      H  E      +       C+ +CP            +  NGS+I          KEC  G   + S +    +  C   E  +I     G +L  +L+     +  +  F++I  S  L +L F   L  I+G + +   N TL +  N  L +L  W       I  G + F  N  LC   I+      G +      E+   TNG  A C    L       +   + L W+  +    + +LS + YY+               C +  W++++ +    +  + GV L P                  LKP T Y V++      T +DS    A S  V+  T    P+ PQ + S S++ + + + WKPP+  NG IT Y++ + + A   + + N+Y ++      S  +T F       E       +P+  C  C            + +E+    +F+  +H  I + +          NP   S  + +   +      + L                  +N S   + + ++P      +   V++ L +FTEY I+I AC       N++   +       CS       RT    + D IP    K      G    + + W  PP  NGLIL Y++ YR   +       T  C++      +  +H          +  P  G Y  ++   +LAGNG+W+   +F     E ++T G
Sbjct:   28 EVCPSLDIRS---EVTELRRLENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLL-FRVYGLESLRDLFPNLAVIRGARLFLGYALIIFEMPHLRDIGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLLQ-------PAPGANHIVGNKL--GEECADVCPGVLGAAGEPCVRTTFGGHTDYRCWTSSHCQRVCPC---PRGLACTVGGE--CCHSECLGGCSQPEDPRACVACRHLYFQGVCLPTCPPGTYQYESWRCVTAELCGHLREVPGHATAFGIYEGSCLAQCPPG----------FTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQATQDLVGCTHVEGSLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNLKLIRGDSMV-DGNYTLYVLDNQNLQQLGSWV-AAGLTIPVGKIYFAFNPRLCLEHIYQLEEVTGTRGRQSKAEINPRTNGDRAACQTRTLRFVFNLTEEDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAP------------------LKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNITYYLVLWQRLAEDGDLYINDYCHRGLRLPTSSHDTRFDREDPALEA------EPEQGCCPCQHSPPGQALPALEAQEVTFQKKFENFLHHAITIPKAPWKVTSINKNPQRDSERHRRETGL------LRLG-----------------KNNSDFEIHEDKVP------RERAVLSGLRHFTEYRIDIHAC-------NHAAHTV------GCSAATFVFARTMPHREADGIP---GKVVWKAVG-KSSVILHWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSRLRYAKVGGVH--------LALLPP--GNYSAKVRATSLAGNGSWTDGVAFYITGPEEEDTGG 919          

HSP 2 Score: 199.904 bits (507), Expect = 1.211e-113
Identity = 113/270 (41.85%), Postives = 160/270 (59.26%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ A+  + V+FL EA +MK F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L      ++      + +L   IQ    IADGM YLA K+FVHRDLAARNC+V  D  +KIG             DFG+T+ + E DYYRK G+   PVRWMAPESL+  ++TT +DVWS+GVVL+EI TL   PY G+S+E V++FV   G +  +    P  L ++M  CW      RPTF+ IL+ +   +    F+  SFY++
Sbjct: 1014 TVNELASARERVEFLKEASVMKAFKCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIG-------------DFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFV-MDGGVLEEQEDCPIQLQELMRRCWQHTPRLRPTFVHILDRIQDELRPS-FRLCSFYYS 1262          

HSP 3 Score: 43.1282 bits (100), Expect = 1.211e-113
Identity = 25/91 (27.47%), Postives = 49/91 (53.85%), Query Frame = 3
Query: 3039 LKITFSST-VFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFV 3296
            L+I  + T V  M + +++ L ++ + K+N     + N  YF +      DEW +  + + ++  +G+G+FG+VY G  + LE+  +S  V
Sbjct:  920 LRILLTVTPVGFMLLVMLAALGFFYSKKRNSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIRELGQGSFGMVYEGLARGLEAGEESTPV 1010          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|P14616|INSRR_HUMAN (Insulin receptor-related protein OS=Homo sapiens OX=9606 GN=INSRR PE=1 SV=2)

HSP 1 Score: 208.379 bits (529), Expect = 1.608e-110
Identity = 232/981 (23.65%), Postives = 397/981 (40.47%), Query Frame = 1
Query:  127 KICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP-----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSK------KNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKL--WTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEF--RFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQA-MCDTCSICKKTCERN---PQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPME---NTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            ++C   DIR     +  L + + C++VEG + I  +        R   FP L +VTDY+LL F     ++  ++FPNL VIRG  L  G AL+++     R +   +L ++  G V V  N  LC++  IDW  +         +    +I  NK      C+++CP           + T        CW+ + CQ +C        + C       CCH +CLGGC    + + CVAC+ L ++  C+ +CP G Y+++  RCV    C+       +  +   +   C+ +CPS    +  + + +C     +  K  K  G   + S +    +  C   E  +I     G +L  +L+     +  +  F++I  S  L SL F   L  I+G A +   N TL +  N  L +L  W       I  G + F  N  LC   I+      G +      E+   TNG  A C    L       ++  + L W+  +    + +LS + YY+               C +  W++++ +    +  + GV L                  +SLKP T Y V++      T +DS    A S  V+  T    P+ PQ + S S++ + + + WKPP   NG +T Y++ + + A   + + N+Y ++      +N        N  +   ++  P+A M   C  C+         P + +E     +F+  +H+ I +     +P  ++S N                   S  H+   ++  P+    N+S   +++ ++P      +   V++ L +FTEY I+I AC       N++   +       CS       RT    + D IP    K     +  N  + + W  PP  NGLIL Y++ YR   +       T  C++         +H          +  P  G Y  ++   +LAGNG+W+
Sbjct:   28 EVCPSLDIRS---EVAELRQLENCSVVEGHLQILLMFTATGEDFRGLSFPRLTQVTDYLLL-FRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEMPHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQ-------PAPGANHIVGNKL--GEECADVCPGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPC---PHGMACTARGE--CCHTECLGGCSQPEDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSCLAQCPSGFTRN--SSSIFCHKCEGLCPKECK-VGTKTIDSIQAAQDLVGCTHVEGSLILNLRQGYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMV-DGNYTLYVLDNQNLQQLGSWV-AAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRAACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTL------------------ASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRGLRLPTSN--------NDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITI---PISPWKVTSINKSP-------------QRDSGRHR---RAAGPLRLGGNSSDFEIQEDKVP------RERAVLSGLRHFTEYRIDIHAC-------NHAAHTV------GCSAATFVFARTMPHREADGIP---GKVAWEASSKNS-VLLRWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSRLRYAKFGGVH--------LALLPP--GNYSARVRATSLAGNGSWT 902          

HSP 2 Score: 196.823 bits (499), Expect = 1.608e-110
Identity = 110/270 (40.74%), Postives = 160/270 (59.26%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ A+  + ++FL EA +MK F  +H+V L+G+ +   Q   +L   V+MELM  GDL ++L      ++      + +L   IQ    IADGM YLA  +FVHRDLAARNC+V  D  +KIG             DFG+T+ + E DYYRK G+   PVRWMAPESL+  ++TT +DVWS+GVVL+EI TL   PY G+S+E V++FV   G +  +    P  L ++M+ CW      RP+F  IL+ +   +    F+ +SFY++
Sbjct: 1014 TVNELASPRECIEFLKEASVMKAFKCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSHLRSLRPEAENNPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIG-------------DFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFV-MDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPS-FRLLSFYYS 1262          

HSP 3 Score: 41.2022 bits (95), Expect = 1.608e-110
Identity = 28/107 (26.17%), Postives = 55/107 (51.40%), Query Frame = 3
Query: 2994 SAYFNYLFPVDVDYV-LKITFSST-VFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFV 3296
            S  F  L P + D   L +  ++T V +  + +++ L ++   K+N+    + N  YF +      DEW +  + + ++  +G+G+FG+VY G  + LE+  +S  V
Sbjct:  904 SVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEYFSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPV 1010          
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Match: sp|P09208|INSR_DROME (Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3)

HSP 1 Score: 219.55 bits (558), Expect = 1.041e-107
Identity = 123/282 (43.62%), Postives = 166/282 (58.87%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYL--HQYAERSDK--------GMIDGKQSLLW------AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ AT  +   FLSEA +MK+F  YH+V L+G+ +           LVVMELM+ GDL +YL  H+  ER +         G+    Q   +      AI+IADGM YLA K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK  +   PVRWM PESLR  VY++ +DV+S+GVVL+E++TL + PY G+S+E V+ +V   G +       P  L  +M  CW    + RP+F+ I+ YL P   N  FK+VSFYH+
Sbjct: 1406 TVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCS------RGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIG-------------DFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYV-IDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHS 1667          

HSP 2 Score: 179.489 bits (454), Expect = 1.041e-107
Identity = 242/1010 (23.96%), Postives = 403/1010 (39.90%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPE--RTIDDQKT-----------------RVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCY--GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC--------SKKNMSITFNPNRCVKECPSDLFASFINGT-KYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNC---YSAERVIISLQI-GGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDS-TNGHIAICTFIQLNLTVVEVKSQCVRL-------YWKNKQTSNYQIL-------SGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEE--LLEMTRFDTHMHSVILVQ--RKKNNPNSLSSYNSK-----SIAIPNNFTTMPLNATVSVVHKPT---PKSNIPMENTSSI------------------------NVKQIEIPASALKTQYYH-VITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPI-YDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLE 2955
            CT++EG ++I  ++     +  FP L EVTDYI++   +     S  IFPNL VIRG +L  G AL+VY N     L    LRSI  G V +  N  LC    IDW  I       +++  +L + T          + CP   R  +   T                 R+CW+   CQ+ C   C +  +  H      CC + CLGGC      N+ C++C+ + +   C+ SCP GYY+F  SRCV   EC        +     I +N  +C+  CP+    S      + C  G     K +KEC    + S +   +   C      E + IS++   G  +  +L+     +  ++  + +  +  L+SL F   L EI G   +      L +  N  L +LW P+    I  G V F  N  LC + I+  +  +  +   F+K  + + +NG+   C    LN+T+  V +    L         + ++ SN  I+        G  +Y  I     +   SD  C    W V   +     SGV +                 +S+L P T+Y  Y+     + + + A S+   F T+   PS    + + + + ++I ++W     P G++T+Y I   K  L      N  +N+D+C   T    K  +++    T        +   C   + + + + Q+ ++  +     F+  + + I V   RK  N +S  S  ++     S AIPN   T P      V  +P     + ++ + +  SI                        N +  E+ A  L     H V   L +FT Y I +VAC +   +          F  + CS+  +    T+R    D++  +  D  + N T     + V W  P   NG I+ Y++ Y+++K +   Q     CI +            N +    I  N   G Y F++   ++AG G+++ +E
Sbjct:  357 CTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLS-KIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEI------LAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNNCIDEHT-----CCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQFD-SRCVTANECITLTKFETNSVYSGIPYN-GQCITHCPTGYQKSENKRMCEPCPGG-----KCDKECSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEISGDPPMDADKYALYVLDNRDLDELWGPNQTVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSDVGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKVEIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPE----KSGVMV-----------------LSNLIPYTNYSYYVRTMAISSELTNAESDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI---KAKLINRPTRN--NNRDYC---TEPLVKAMENDLPATTPTKKISDPLAGDCKCVEGSKKTSSQEYDDRKVQAGMEFENALQNFIFVPNIRKSKNGSSDKSDGAEGAALDSNAIPNGGATNPSRRRRDVALEPELDDVEGSVLLRHVRSITDDTDAFFEKDDENTYKDEEDLSSNKQFYEVFAKELPPNQTHFVFEKLRHFTRYAIFVVACREEIPSEKLRD---TSFKKSLCSDYDTVFQTTKRKKFADIVMDLKVDLEHANNT--ESPVRVRWTPPVDPNGEIVTYEVAYKLQKPD---QVEEKKCIPAADF---------NQTAGYLIKLN--EGLYSFRVRANSIAGYGDFTEVE 1298          

HSP 3 Score: 38.5058 bits (88), Expect = 1.041e-107
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 3
Query: 3072 MAVALISIL--IWYLAWKK---NQRYILTRNNHYFLSGQ---DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKL 3269
            +A  ++S+   + YL  +K   N  ++ T  N ++ S Q   D+W +  +++  L P+G+G+FG+VY G LK  
Sbjct: 1320 LAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPLGQGSFGMVYEGILKSF 1393          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: V3ZZ12 (Tyrosine-protein kinase receptor (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_51396 PE=3 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 6.913e-141
Identity = 269/973 (27.65%), Postives = 428/973 (43.99%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHM---CNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSCSNMCPERTIDDQKTRVCWSYNTCQS--ICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECS-----------KKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGST--ITTKYNKEC--------GLLFLKSFKDLDQVKNCYSAERVIISLQI---GGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPD--PKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEE----LLEMTRFDTHMHSVILVQRKKN--NPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSI--NVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETN 2979
            CTI+EG + I  + + M      L FP L E+T +ILL +      T  +IFPNL VIRG EL    A+  Y       L   SL +I  G V +  NS LC V  IDW+ +      AS + K      NK    C N C + C    +  ++ + CWS   CQ    C+  C  K ++C+ + T  CCH  C+GGC G   +DC+ACK + Y+  C   C    Y++   RC+   EC            K     +    +C+KECP               NG T  +TT   +EC         + F +    +D  +       +   L+I   GG ++ ++L      +  +  +I+I RS  + SL F   L  I+G+  + QT  +L+I  N  L +L++P+     RIL+G  +F  NR LC   I NF+N +GL N+    + + STNG    C    LNL+V  V    V L W   +T + + +LS + +YR + +   N       CS  +W   E +   N +  ++                 ISSL+P T Y  Y++ +   R  S+AISN  +F T    PS P  +E  +    E++++W PP  PNG IT YI+  W+  + +     E+  +D+C+   +      + + +K              C  C KT    PQ++EE     L    F+  +H  + V+RK+   +PN + S   K ++   +      N  V V      K  +  +N+S      ++ +   S + +Q  H + NL +   Y +E+VAC   +  +       M    +   N A  + RT  S   D I    + + + +     E+ + W+ P K NGL++ ++++Y+   +N +    TP CIN     SIK           + +     G Y F+I   +LAG G W+P++ F  ++T 
Sbjct:   19 CTIIEGFLHIVLIERVMEADFAKLSFPKLVEITGHILL-YRVDGLRTLRHIFPNLAVIRGQELFHNYAIAAYQMQDLEELGLVSLTAIKRGAVRLEKNSKLCYVDTIDWEKL-----AASDNWKDNVFSENKDEQECVNICPDQCSRSKVKGKEAKRCWSSKDCQKGLDCEKKCG-KGIFCN-DETGECCHNYCMGGCRGPRKEDCLACKAVIYQGICEPRCNPETYKYMDRRCLLDKECMNMENHQKGEEWKIIRGDSGMEGKCIKECP---------------NGYTKNVTTPNIRECTKCSAHCPKVCFGRVIDSIDAAQTLTGCTSITGPLEIEIDGGSNIVVELEKSLGEIEEISHYIKITRSYPIISLHFFKKLKLIKGEK-LDQTYYSLNIFDNPNLQELFSPEVTKNLRILNGKSKFNFNRKLCFYKIENFLNAVGLANTTDALDDVKSTNGDSIPCEVNTLNLSVQAVNHHSVILKWDQFKTHDIRPLLSYVVHYREVQSKNINIFQGRDACSESVWKTKEVEPDKNSNPEEI-----------------ISSLRPWTLYAAYIQTYTIGRASSSAISNLTYFRTKPYYPSAPTNLEITAEVEGELKVTWDPPKLPNGNITYYIV-KWRRQVLKRE---EFDKRDYCKEPLDLNRDKKEKDKKKEEAKKNLTLPSGGQCCRCPKT----PQEEEEENRIRLNEIAFENALHDEVYVKRKREVPSPNDIKSGKQKYLSGNTD------NEDVDVKRL---KGKVDGKNSSDFNNETEENQENTSIVHSQEIH-LPNLGHSQPYTVEVVACLSDKDKYGKE----MCSHSHSQGNSAIANARTLASKTADTI----NASTITVKPNKTEVMIKWEEPRKPNGLVIKFEIDYQKTHNNDV----TP-CINYTKYRSIK----------GYKLEKLQPGNYSFKIRATSLAGPGEWTPVKYFFIEDTG 909          

HSP 2 Score: 223.016 bits (567), Expect = 6.913e-141
Identity = 123/270 (45.56%), Postives = 167/270 (61.85%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDG------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFY 4135
            TV+  A ++D + FL EAC+MK F  +H+V L+G+    + +    Y  V+MELM+NGDL NYL  +  R D    +G      K+ L  A +IADGM YLA K+FVHRDLAARNC+V  +  +KIG             DFG+T+ I   DYYRK G+   PVRWMAPESL+  ++TT +DVWSYGVVL+E++TL + PY G+S+E V+ +V   GK        P  L D+M  CW + D +RPTF  I+E LVP ++   FK VS++
Sbjct: 1011 TVNDQAGVQDKMNFLKEACIMKAFSCFHVVKLLGV----VSQGQPAY--VIMELMKNGDLKNYLRSH--RPDVEDNNGAPPPTLKEILQMAGEIADGMAYLADKKFVHRDLAARNCMVAEENTVKIG-------------DFGMTRDIYMTDYYRKGGKGLLPVRWMAPESLKDGIFTTMSDVWSYGVVLWEMATLAAQPYQGLSNEEVLRYV-SEGKFMEKPEGCPDRLYDLMLKCWQYKDKNRPTFKEIIEMLVPDLHPS-FKDVSYF 1257          

HSP 3 Score: 43.1282 bits (100), Expect = 6.913e-141
Identity = 27/87 (31.03%), Postives = 46/87 (52.87%), Query Frame = 3
Query: 3093 ILIWYLAWKK-NQRYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMN 3338
            I++W+    +     I++ N +YF +G     D+W ++   ++L+  IG+G+FG+VY G    L  P K        PM +AVK +N
Sbjct:  935 IVVWFAKESELANNLIVSHNPNYFPAGDVYIPDDWEVDRDKIELIREIGEGSFGMVYEGIATDL-PPYKG-------PMNIAVKTVN 1013          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: R4IS90 (Tyrosine-protein kinase receptor OS=Pinctada fucata OX=50426 GN=irr PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 2.183e-136
Identity = 278/985 (28.22%), Postives = 426/985 (43.25%), Query Frame = 1
Query:  193 CTIVEGKV---VITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSCSNMCPERTIDDQKTRVCWSYNTCQSI--CDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKL----RYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSI-----TFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDP--KFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG-LTYYRSISTNMKNGGFSDS--GCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICE-ISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALF-ENSFNNEYSNKD-FCQSETNTGFKTSQSNFEKATNDNFQPQ--AMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNAT-VSVVHKPTP---KSNIPME----------NTSSINVKQIEIPASAL----------------KTQYYHV---------ITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            CT++EG +   +I   ++     L FP L E+TDY LL F      T  +IFPNL VIRG  L    AL+ Y       L    L SI  G V +  N  LC +  +DW  I     E+S      + K +K +  C N C   C E T+D++K R CW+   CQ I  C +  +     C   +  ICC   CLGGC G+T +DCVACK +      +  C   C  G YE++  RC+ + EC + N  +     T +P  C + CPS    S  + T  CV       +  + C    + + K   ++K C   E  +      G ++  +L +    +  VK  + I  S+ L SL F   L +I GQA   Q    L +  N  L +L+T D      I +GS+ F  NR LC   I  F++K+ +QN   + ++  +TNG    C    LNL VV V ++   L W+N + ++ + L G +  Y+      KN    D    CS  IWS  +   K+               D  EEF+   I SLKP T Y VY++ +  +  +  A+S  V+F T+   P+ P  ++     +  + ++W PP +P+G +T YI+Y+    L  E  +   Y  +  F + ET+   K  +   EK   +N +P    + + C+ C KT E+  +++ E L    F+ ++H+ + ++R  +     S  NSK   I   F +   N++      +P     + N P E          NTS      +E   +A+                +  YY V         ITNL +F +Y IE++AC +R       +++        CS+RA T  RT      D I        M +   + E+ V+W  P   NGLI+ Y + Y     NV             S  S  N H+   SY+   +     G Y  QI   +LA   N++
Sbjct:   60 CTVIEGHLQILLIEGATQEQYQQLEFPDLVEITDYFLL-FRVYGLKTLSHIFPNLSVIRGQRLFFDFALVAYEMMDLEELGLWGLTSIERGAVRLEKNPLLCYIDTVDWTKIAVGIKESSDH----FFKESKDVRECVNMCPRNCTETTLDNRKARRCWTLKHCQRILTCGNNINCASGMC---DNGICCDHNCLGGCRGRTKRDCVACKGVINVFNNQTVCAKQCLPGTYEYRKRRCLREEECIQTNNKLVKANHTSDPGVCAQNCPSGYMESQTDNTT-CVK---CADRCPRGCPSKRVDNVKSAQELKGCTVIEGHLEIRIKKGSNIGQELEENLGEIEEVKGHLWIHSSDALLSLNFFKRLRKIHGQALANQ-KFALLVNDNVNLQELFTEDVTNNLIISNGSIVFHYNRKLCLHKIMEFVDKVQMQNKSLN-DISKTTNGDHMPCKVSTLNLKVVRVSARIAFLRWQNFKVADPRHLFGYIINYKEAP--FKNVSIYDGRDACSEDIWSTKDVLNKS---------------DREEEFVSNLIVSLKPWTQYAVYIQTYTTSSAEYGAMSKVVYFRTAPAYPTVPVNLKVDPKMNGSLYVTWNPPTNPHGNVTHYIVYWRPRPLVAEKLYERNYCGEPLFSKEETDKRQKDDKKTVEK---ENTRPNTTGLSEHCA-CPKTKEQITEEENERLLQIEFENYLHNFVYIKRDTDK----SGLNSKKAKIL--FKSKASNSSNTDNAGQPRTRKRRDNPPAERYKREAQTQYNTSKSGDVIVEKDNNAMNITGDNDTDRNSTADKEGPYYTVIVENRRNILITNLGHFKDYNIEVIACQERDPRDPQKEKL--------CSSRAITMARTLPDKSADNIDS-NSVVVMELKNRSGEVLVSWDAPSNPNGLIVAYTIKYNKVMKNV----------QPISYCSPHNAHSVRQSYKLVKLE---PGNYSVQIRSISLARKANFT 981          

HSP 2 Score: 215.312 bits (547), Expect = 2.183e-136
Identity = 119/279 (42.65%), Postives = 165/279 (59.14%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYL--HQYAERSDKGMIDG-------------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFY 4135
            TV++ A+  + + FL EA  MK F   H+V L+G+    + +    Y  V+MELMENGDL N+L  H+  E   +    G             KQ +  A +IADGM YLA K++VHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK G+A  PVRWMAPESL+  ++T+ +DVWSYGVVL+E++TL + PY G+S+E V+++V   GK        P  L  +M  CW++    RPTF  I+E LVP ++  F ++  F+
Sbjct: 1100 TVNEHASFSERMNFLKEASTMKAFKCNHVVRLLGV----VSEGQPAY--VIMELMENGDLKNFLRMHRPDEEDMESTFAGYQASKIPRQPLSLKQIIKMAGEIADGMAYLADKKYVHRDLAARNCMVAGDLTVKIG-------------DFGMTRDIYETDYYRKGGKALLPVRWMAPESLKDGIFTSLSDVWSYGVVLWEMATLAAQPYQGLSNEEVLKYV-SAGKKMDKPEGCPDRLFSLMYQCWNYRPKQRPTFKEIIEMLVPQLDPSFKERSYFF 1358          

HSP 3 Score: 46.2098 bits (108), Expect = 2.183e-136
Identity = 32/115 (27.83%), Postives = 59/115 (51.30%), Query Frame = 3
Query: 3036 VLKITFSSTVFIMAVALISILIWYLA---WKKNQRYI--LTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSL 3353
            ++ +T S+   ++ +A+I++  W++A   + K   Y   ++ N  Y   G+    DEW ++   +KL+  +G+G+FG+VY G    L+   K +        KVAVK +N   S 
Sbjct: 1003 IIAVTVSAVFLLILMAVIAV--WFVARSRFSKVPDYADHISANPDYMHHGEVYQPDEWEVDRDKIKLIRELGQGSFGMVYEGLSIDLDGDGKEV--------KVAVKTVNEHASF 1107          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: Q86LZ8 (Receptor protein-tyrosine kinase OS=Schistosoma mansoni OX=6183 GN=IR-1 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 4.517e-129
Identity = 281/1150 (24.43%), Postives = 479/1150 (41.65%), Query Frame = 1
Query:   70 FILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMC--NSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRG-----------YELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYI----NDNRDEASKSTKKLYIKTN-KFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSI------------TFNPNRCVKECPSDLFASFINGT-KYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPL-----LEIQGQAFIGQTNVTLDITANNILSKLWTP-DPKFRILSGSVRFLANRNLCKTFIHNFINK-IGLQNSL--FDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSN--YQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC-------KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFEN--SFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQP------QAMCDTCSICKKTC------------ERNPQK----------------------------QEELLEMTRFDTHMHSVILVQRKKN----------NPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMND---------CSNRASTSTRTERSPDVDVI--------------------PP-----------------IYDKTYMNITGIN----------KEITVT---WKIPPKVNGLILFYQLNYRIKKDNVIF---------------QAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKET 2976
            F+++  C+++  +      ++   D+R P    ++L     C+ ++G + I +L    C  +      + E+T  +++   +CS D S   FPNL +IR            +  +    LI+ +   + +    L+S+ S  + +  N  +C V  ++W  +    N    ++ +S ++  ++ N    C + CS  CP    +D     CWS N+CQ+ C+ +C+   L CHV+N   CC  +C  GC G +   C++CK ++  + C+  CP  +Y      C+ + EC  +   +            TFN + C+  CP + +   ++G  ++C + + I     + CG + +    DL QV+ C +A+ ++IS++      + K  D F +L+ +   + I+ S+ L+SLTFL  L     L+  G    G T   L+I  N+ L  LW P      I  G V F  NRNLC  ++  FI+  + L  +L   + +LID +NG I +C   +LNL++  V  + V     N    N   Q+L    YYR I  +            S  W + E +C       +N+D    ++P SL       +  CE++ L PA  YQ Y+E R       A+S    F T  + PS P    + S   N+++L W  P +PNG I +Y ++Y +  LF N  S +N  S  D   S   +   T  +  +   N N         + +C +C+ C   C             RNP +                            + E L+M RF+  + +++L  R K+            +  +S++   +  P ++   PL     +  + +  SN  +EN  SIN   I +            I  L ++TEYL  I ACH            L  F+ N+         CS R+    RT+ S  VD I                    PP                 +++ T++N +  N           +I+V    W+ P + NGL L Y + YR      I                + W+  C+N+ ++  + N +     + S  + +  SG YEFQIM  +LAGNG+W+ ++ F+  +T
Sbjct:    8 FVVWFSCSIHVASCEYCSGRL--VDLRRP----NTLSSLTNCSSIQGPLTIRNLDDSCCLESYCNLSNVVEITGSLIVENGNCSGDLS-KFFPNLTIIRSQIITSTDLNNKHNQISSYNLIIRHTKLKGVGLWKLKSLNSNRIALIDNPMMCFVNTVNWNALTTSLNSVYTKSYRSVREQIVRYNLGEFCPDQCSASCPPFYRNDSSRFSCWSTNSCQAECNPVCTDNGLACHVDNPQKCCDSECSRGCTGPSPNRCLSCKHVKLNDLCLNHCPSSHYLLNNLYCITREECINRQEIVGSVNGKYLANFSTFN-STCIPTCPLE-YVRLVSGECQFCPDSNCI----KRACGDINVYKVSDLKQVRGCVTAQSILISIRDCEDGDTSKFMDAFSDLKEIHTSLHIISSDSLQSLTFLRSLRIIHGLKRDGSVPNGPTKTVLEIAWNSQLKSLWIPVSTNLIIKHGRVVFTLNRNLCPEYVKAFIHSNVNLSRNLSNLESDLIDKSNGTIGLCRTHRLNLSINYVHQRSVSFTIINTPAWNDFRQVLPTTVYYRYIGLDEPESDIQTICDKS--WHIHEPKCQKIIEPMRNSDLFHAIRPESL-------KLQCEVNYLNPAQRYQAYVEIRTMFNSEGALSEVFTFQTKQDKPSSPIDFHAFSLNSNKMQLYWNAPDNPNGQIVEYRLWYRR--LFVNIPSSDNGISCTDGRSSHLISSSTTYGNILKDNQNSNSHGTFSKTVKGIC-SCTSCAAFCFNPSIHLSNTDKNRNPLQRFNTHQSSIFSGKTAITDHFNGDYEKTTRVERLDMIRFEDSLQNLLLFPRIKSPVRIRGKRRIRIDDFNSFHFSKME-PRDYDHYPLKWDGHL--RISANSNT-VENHESINNNIIGVS-----------IDGLHHYTEYLFVISACHSPHDINGEPLNNLTYFNENNYNAIAEMPWCSTRSIIQQRTDASIGVDDIDSNSIQLVDENLGTDIDNNCPPSESLSSSMKRESNLCNQMFNFTFVNNSQFNHTKIGKLSSSAKISVKQLRWRPPTQPNGLTLRYWIRYRRLDGESISNKPSSILPNDGNHEERIWSLICLNAINLPVLINQNTVTDRFVSVQLYDLRSGVYEFQIMSVSLAGNGSWTSVKRFKVLDT 1117          

HSP 2 Score: 216.468 bits (550), Expect = 4.517e-129
Identity = 118/262 (45.04%), Postives = 162/262 (61.83%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSD--KGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFV--RXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFF 4117
            T+  A+T++DI +F +EA  MKQ    +IV  +GI      +  S +P+++ME M  GDL+ YL Q   + D  +G ID + ++ WAIQ+A GM YLA    +HRDLAARNCLV++ L +KI              DFGL + +N  +YYRK G+A+ PVRWMAPE+L SA +TTK+DVWSYGVVL+EI+T  SLPY G+SHE V++FV       L     K+P  LL +M  CW F  T+R TF  IL  L  + ++  +
Sbjct: 1254 TLFPASTMDDIREFYNEASFMKQLNCMYIVQFLGIAL----RQPSSHPVIIMEYMAFGDLATYLRQQMSKDDCPQGSIDTQLAINWAIQLATGMNYLAELHIIHRDLAARNCLVNSMLTVKIA-------------DFGLARLVNNQEYYRKIGQARLPVRWMAPETLSSAYFTTKSDVWSYGVVLWEIATFASLPYPGLSHEEVMKFVCDGGHLNLPECPTKLPVILLTLMNMCWEFEPTNRLTFSEILSRLKSFTSSSLY 1498          

HSP 3 Score: 33.8834 bits (76), Expect = 4.517e-129
Identity = 24/88 (27.27%), Postives = 46/88 (52.27%), Query Frame = 3
Query: 3033 YVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSG---QDEWNIEFQD--VKLLLPIGKGNFGVVYSGELKKLESPA 3281
            Y+L I F   + ++++A  ++ I     +K  +    R+  + L+     +EW I   D  +    P+G+G+FG+VY G + +L +PA
Sbjct: 1131 YILIIGFLFNIILLSLA--AVCIERRISRKRLQNNPWRDEEWELANAGISNEWIIPMNDLIIDTDTPLGRGSFGMVYKGCVLRLSTPA 1216          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A0C4UQS4 (Tyrosine-protein kinase receptor OS=Nilaparvata lugens OX=108931 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 1.172e-128
Identity = 270/992 (27.22%), Postives = 447/992 (45.06%), Query Frame = 1
Query:  124 RKICK-FDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSL---RFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNA-WRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK-----FICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIEC-----SKKNMSITFNP-------NRCVKECPSDLFASFINGTKYCVNGSTI------TTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQI-GGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDP----KFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDS--GCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICE-ISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSE-TNTGFKTSQSN-FEKATNDNFQPQAMCDTCSIC--KKTCERNPQKQEELLEMTRFDTHMHSVILVQRKK-NNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEIT-VTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGN--WSPLESFE 2964
            R +C+  DIR        L   + C +VEG V I  + K + +      FP LRE+T Y+LL +      T  N+FPNL VIRG  L    AL+V+     + +   SL  I  G V ++ N  LC V  IDW  I      A  S    +I  NK      IC  +   +CP    +D    +CW+   CQ  C S C  +   C  + T  CC K CLGGC G    +C+AC+   ++  CV +CPV  Y++   RCV + EC      ++ MS    P       N+C+ +CP +   + I+  +      T            KEC  L + S     +++ C +  +  + +QI GG ++  +L +    +  +  +++I+RS  L SL FL  L  I G+  +      L +  N  L +LW   P    + RI  G + F  N  LC   I N    +G+     D E+  ++NG    C    L+  V    S+ V + WK  +  + + L G   Y  I    +N    D    C    W VI+      D+    + T+L       + + + I+ LKP T Y  Y++ +    ++S A S  ++F T  ++PS PQ + +   + +EI+++W+PPL+PNG +T Y+I     A +E   +   + +++C+   T+    T+Q+  +    +D+       D C +C   K   +  Q+++E+    +F+  + +++ ++R    +   +S  + K+I   N+F      A   +  K  P S   +E     N  Q++I    L+ +  +VI  L +F +Y I + AC QR    + + +++M    N+CS  +  S RT++  + DV+  I+ +   N     + I  + WK PP  NGLI+ YQ+++ +  +N   Q    +CI+ +      N H          + N   G Y +Q+   +LAG  N   SPL  FE
Sbjct:   83 RGVCQSLDIRNAAREFHQL---QGCQVVEGFVQIVLMDKAVESEFANFSFPELREITGYLLL-YRIDGLRTLSNLFPNLAVIRGNTLFFNYALVVFEMLHLQEMGLKSLTDIVRGAVHISKNPMLCYVDTIDWDKI------ARSSQGGHFITGNKKKNECPICQTNA--VCPTSATNDN---LCWNIQHCQKFC-SKCE-EGTACMDDGT--CCDKNCLGGCNGTGPTNCIACRGYLFQGTCVATCPVQTYQYLQRRCVLEKECYDMPKPREIMSEEVRPQPWKPFMNQCLIDCPPNYAEAPIDNFRGLDPDRTYYRCEPCKGPCKKECEGLNVDSISSSQRLRGC-TYIKGSLEIQIRGGYNVVKELENNLNMIEEINGYLKIVRSFPLVSLNFLKKLKVIHGEK-LESGKYALVVLDNQNLVELWDFGPSREERLRITRGKLFFHFNPKLCYFKIDNLRKYLGMP-EFTDNEVARNSNGDKVACNISLLDARVETRSSKGVIIKWKEFEHYDPRTLLGYIIY-FIEAPYQNISLYDGRDACGGDGWRVIDVSPLEKDN----ETTTLNEDKNKTKHMSQLITQLKPYTQYAFYVKTYTIASENSGAQSPIIYFRTEPDIPSMPQNLVAKIESSSEIKVAWQPPLNPNGNVTHYLI----TAKWERDDSEFLAQRNYCEEPLTSIVDVTNQAGKWTLVNDDDVYTGGKPDDC-VCMDDKKVNKKKQQEKEIQFQIQFEDTLQNLVYIKRSSLRDKREISLRDGKTIT-ENHF------AESDIRMKTVPVST-DLEVQRLENEPQVKI---LLQGKTSYVIRGLHHFAQYTISVSACRQR----DETDKLIM---TNNCSTHSIISARTKKLANADVVSEIWHEVIENPVNHTQPIVKLYWKEPPAPNGLIVMYQISHWLVFENQ--QHKKTHCISRRQFLEEGNSHT---------LTNLAPGNYSYQVCATSLAGLANCSQSPLRYFE 1013          

HSP 2 Score: 222.246 bits (565), Expect = 1.172e-128
Identity = 120/272 (44.12%), Postives = 166/272 (61.03%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLL------WAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV++ A++ + V+FL+EA +MK    +H+V LIG+ +          P VVMELM NGDL +YL  +  R D  +   KQ          AI+IADGM YLA K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK  +   PVRWM+PESL+  V+T+ +DVWSYGVV++E++TL S PY G+S+E V+ +V+  G         P  L ++M  CW     DRPTFM+++  L+P+ +   F  +SFYH+
Sbjct: 1115 TVNENASLRERVEFLNEASVMKASNTHHVVRLIGVVS------QGQPPYVVMELMANGDLKSYLRLH--RPDATVEPHKQPPTLKRIRQMAIEIADGMAYLAAKKFVHRDLAARNCMVAEDLTVKIG-------------DFGMTRDIYETDYYRKGTKGLLPVRWMSPESLKDGVFTSSSDVWSYGVVIWEMATLASQPYQGLSNEQVLNYVK-TGGCMERPDNCPDVLYNLMRQCWQHKPADRPTFMQLVRCLLPFAHPS-FASLSFYHS 1363          

HSP 3 Score: 32.3426 bits (72), Expect = 1.172e-128
Identity = 24/109 (22.02%), Postives = 49/109 (44.95%), Query Frame = 3
Query: 3039 LKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSG---QDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            L+I F++ +    + L+  +++       Q  ++   N  ++S     D+W +    ++L   +G+G+FG+VY G          +  V      K A+K +N   SL+
Sbjct: 1023 LQIIFATFMTAGMLILLGFVVFLRNKSNKQTPLIAECNPEYVSTVYVPDDWEVPRSQIELDGELGQGSFGMVYEG--------IATNVVPGEPRKKCAIKTVNENASLR 1123          
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Match: A0A5K4F9S5 (Receptor protein-tyrosine kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.350e-128
Identity = 278/1152 (24.13%), Postives = 476/1152 (41.32%), Query Frame = 1
Query:   70 FILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMC--NSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRG-----------YELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYI----NDNRDEASKSTKKLYIKTN-KFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSI------------TFNPNRCVKECPSDLFASFINGT-KYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPL-----LEIQGQAFIGQTNVTLDITANNILSKLWTP-DPKFRILSGSVRFLANRNLCKTFIHNFINK-IGLQNSL--FDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSN--YQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC-------KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQP----------QAMCDTCSICKKTC------------ERNPQK----------------------------QEELLEMTRFDTHMHSVILVQRKKN----------NPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMND---------CSNRASTSTRTERSPDVDVI--------------------PP-----------------IYDKTYMNITGIN----------KEITVT---WKIPPKVNGLILFYQLNYRIKKDNVIF---------------QAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKET 2976
            F+++  C+++  +      ++   D+R P    ++L     C+ ++G + I +L    C  +      + E+T  +++   +CS D S   FPNL +IR            +  +    LI+ +   + +    L+S+ S  + +  N  +C V  ++W  +    N    ++ +S ++  ++ N    C + CS  CP    +D     CWS N+CQ+ C+ +C+   L CHV+N   CC  +C  GC G +   C++CK ++  + C+  CP  +Y      C+ + EC  +   +            TFN + C+  CP + +   ++G  ++C +   I     + CG + +    DL QV+ C +A+ ++IS++      + K  D F +L  +   + I+ S+ L+SLTFL  L     L+  G    G T   L+I  N+ L  LW P      I  G V F  NRNLC  ++  FI+  + L  +L   + +LID +NG I +C   +LNL++  V  + V     N    N   Q+L    YYR I  +            S  W + E +C       +N+D    ++P SL       +  CE++ L PA  YQ Y+E R       A+S    F T  + PS P    + S   N+++L W  P +PNG I +Y  + W   LF N  +++  N   C    ++   +S + +     DN             + +C +C+ C   C             RNP +                            + E L+M RF+  + +++L  R K+            +  +S++   +  P ++   PL     +  + +  SN  +EN  SIN   I +            I  L ++TEYL  I ACH            L  F+ N+         CS R+    RT+ S  VD I                    PP                 +++ T++N +  N           +I+V    W+ P + NGL L Y + YR      I                + W+  C+N+ ++  + N +     + S  + +  SG YEFQIM  +LAGNG+W+ ++ F+  +T
Sbjct:    8 FVVWFSCSIHVASCEYCSGRL--VDLRRP----NTLSSLTNCSSIQGTLTIRNLDDSCCLESYCNLSNVVEITGSLIVENGNCSGDLS-KFFPNLTIIRSQIITSTDLNNKHNQISSYNLIIRHTKLKGVGLWKLKSLNSNRIALIDNPMMCFVNTVNWNALTTSLNSVYTKSYRSVREQIVRYNLGEFCPDQCSASCPPFYRNDSSRFSCWSTNSCQAECNPVCTDNGLACHVDNPQKCCDSECSRGCTGPSPNQCLSCKHVKLNDLCLNHCPSSHYLLNNLYCITREECINRQEIVGSVNGKYLANFSTFN-STCIPTCPLE-YVRLVSGECQFCPDSKCI----KRACGDINVYKVSDLKQVRGCVTAQSILISIRDCEDGDTSKFMDAFSDLEEIHTSLHIISSDSLQSLTFLRSLRIIHGLKRDGSVPNGPTKTVLEIAWNSQLKSLWIPVSTNLIIKHGRVVFTLNRNLCPEYVKAFIHSNVNLSRNLSNLESDLIDKSNGAIGLCRTHRLNLSINYVHQRSVSFTIINTPAWNDFRQVLPTTVYYRYIGLDEPESNIQTICDKS--WHIHEPKCQKIIEPMRNSDLFHAIQPESL-------KLQCEVNYLNPAQRYQAYVEIRTMFNSEGALSEVFTFQTKQDKPSSPIDFHAFSLNSNKMQLYWNAPDNPNGQIVEY--HLWYRRLFVNIPSSD--NGISCTDGRSSHLISSSTTYGNILKDNQNSNSHGTFSKTVKGIC-SCTSCAAFCFNPSIHLSNTDKNRNPLQRFNTHQSSIFSGKTAITDHFNGDYEKTTRVERLDMIRFEDSLQNLLLFPRIKSPVRIRGKRRIRIDDFNSFHFSKME-PRDYDHYPLKWDGHL--RISANSNT-VENHESINNNIIGVS-----------IDGLHHYTEYLFVISACHSPHDINGEPLNNLTYFNENNYNAIAEMPWCSTRSIIQQRTDASIGVDDIDSNSIQLVDENLGTDIDNNCPPSESLSSSMKRESNLCNQMFNFTFVNNSQFNHTKIGKLSSSAKISVKQLRWRPPTQPNGLTLRYWIRYRRLDGESISNKPSSILPNDGNHEERIWSLICLNAINLPVLINQNTVTDRFVSVQLYDLRSGVYEFQIMSVSLAGNGSWTSVKRFKVLDT 1117          

HSP 2 Score: 215.698 bits (548), Expect = 1.350e-128
Identity = 118/262 (45.04%), Postives = 161/262 (61.45%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSD--KGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFV--RXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFF 4117
            T+  A+T++DI +F +EA  MKQ    +IV  +GI      +  S +P+++ME M  GDL+ YL Q   + D  +G ID + ++ WAIQ+A GM YLA    +HRDLAARNCLV++ L +KI              DFGL + +N  +YYRK G+A+ PVRWMAPE+L SA +TTK+DVWSYGVVL+EI+T  SLPY G+SHE V++FV       L     K+P  LL +M  CW F  T R TF  IL  L  + ++  +
Sbjct: 1254 TLFPASTMDDIREFYNEASFMKQLNCMYIVQFLGIAL----RQPSSHPVIIMEYMAFGDLATYLRQQMSKDDCPQGSIDTQLAINWAIQLATGMNYLAELHIIHRDLAARNCLVNSMLTVKIA-------------DFGLARLVNNQEYYRKIGQARLPVRWMAPETLSSAYFTTKSDVWSYGVVLWEIATFASLPYPGLSHEEVMKFVCDGGHLNLPECPTKLPVILLTLMNMCWEFEPTKRLTFSEILSRLKSFTSSSLY 1498          

HSP 3 Score: 33.8834 bits (76), Expect = 1.350e-128
Identity = 24/88 (27.27%), Postives = 46/88 (52.27%), Query Frame = 3
Query: 3033 YVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSG---QDEWNIEFQD--VKLLLPIGKGNFGVVYSGELKKLESPA 3281
            Y+L I F   + ++++A  ++ I     +K  +    R+  + L+     +EW I   D  +    P+G+G+FG+VY G + +L +PA
Sbjct: 1131 YILIIGFLFNIILLSLA--AVCIERRISRKRLQNKPWRDEEWELANAGISNEWIIPMNDLIIDTDTPLGRGSFGMVYKGCVLRLSTPA 1216          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: insra (insulin receptor [Source:NCBI gene;Acc:103039445])

HSP 1 Score: 237.654 bits (605), Expect = 3.446e-122
Identity = 265/1011 (26.21%), Postives = 416/1011 (41.15%), Query Frame = 1
Query:   64 VIFILYLLCNV-NCENVTLYKRKICKF-DIRIPGISMDSLIKAKECTIVEG--KVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK--FICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKN--------------MSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKEC-GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQA-FIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG-LTYYRSISTNMKNGGFSDSGCSSVIWSV--IEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYH----VITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            V  +L  +C V NC+  +    +IC   DIR    ++ +L   + CT++EG  K+++   +K      L FP L  VTDY+LL F     ++  ++FPNL VIRG  L    AL+++     + L   SL +I  G V V  N +LC +  +DW  I D       S +  YI  NK    C + C  M      CP+ TI+   +  CW+   CQ +C S C  K   C  +N   CCH QCLGGC   ++ + CVAC+   ++ ECV  CP G+Y FKG RCV    C   +                   +   C+ ECPS    + IN T   +N +       K C GL  + S      ++ C      ++    GG +++ +L      L  +  ++ + RS  L SL+FL  L  I+G+   +G  N +     N  L +LW        I  G + F  N  LC   I       G +N     ++   TNG  A C    L  T +   S  + + W+     +++ L G +  Y+               C S  W +  ++   +  D   + +P  L            I +LKP T Y + ++ + +  D      A S  ++  T+   PS P    S S++ ++I L WKPP  PNG IT Y+++  +       +  +Y  K     +  +   T   + E+   +  +       C  C KT ++  ++ EE      F+ ++H+ +   R      SL    +++ +   +F T P               +IP  NTSS    + E  A+ +    Y     VI+NL +FT Y IEI AC+                    CS  A  S RT  E   D D++ PI              + + W  P   NG+I+ Y++NY+   D         +C++ KS  +               +R    G Y  +I   +LAGNG+W+    F
Sbjct:    6 VAGLLLTVCAVWNCQQTS---GEICSSKDIRN---NVTNLRLLENCTVIEGHLKILLMFTTKPEDFRGLTFPKLTVVTDYLLL-FRVYGMESLSSLFPNLTVIRGNNLFFNYALVLFEMLQLKELGLHSLMNITRGAVRVEKNPDLCYLSTLDWSKILD-------SVEDNYIVANKNDGECGDVCPGMAKGKTTCPQTTINGHFSERCWTQKHCQRMCPSSC--KHRACTKDNQ--CCHDQCLGGCMEPSSPRKCVACRNFLHQGECVERCPAGFYTFKGWRCVDFAFCQALHNRCKQGKQGKGGECYEYVIHQGACIPECPSGY--TTINSTS--LNCTPCAGLCPKVCMGLKTVDSVTAAQGLRGCTVLNGSLVINIRGGNNIAAELEANLGQLEEITGYLTVRRSYALVSLSFLRKLRLIRGEVQEVG--NYSFYALDNQNLRQLWDWSKHNLTIQQGRMFFHHNSKLCMAEIRKMEEVTGTKNRHVKNDIATKTNGDQASCESQVLKFTTIRTLSDKIIIKWEPFWPPDFRDLLGFMVLYKDAPYKNVTEFDGQDACGSNSWVIADVDPPQRATDGKEQQEPGYL------------ILALKPWTQYAIMVKTQLSASDEHQVHGAKSEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFCQQQPEASELYKFDYCQKGM---KLPSRAPTQVDSGEEQKWNQTEEHGQGGRCCACPKTEKQLKKEAEETEYRKTFENYLHNEVFRIRPSRQRRSLVGVANQTHS---DFLTTP---------------SIP-PNTSSTPSPEEEAEANKITQLVYAKESTVISNLRHFTSYQIEIHACNHPTDPAR-------------CSMAAYVSARTMPEDHAD-DIMGPI------TFEVAEYSVHIRWIEPKAPNGMIILYEVNYKRLGDTEELH----HCVSRKSYITENGCK----------LRVVHPGNYTVRIRATSLAGNGSWTEPTHF 924          

HSP 2 Score: 202.601 bits (514), Expect = 3.446e-122
Identity = 113/270 (41.85%), Postives = 163/270 (60.37%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLH--QYAERSDKGMIDG--KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL +YL   +    ++ G      K+ +  A +IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+T  +D WS+GVVL+EISTL   PY G+S+E V++FV   G            L ++M  CW +    RPTF  I+E L   ++   F+++SF+++
Sbjct: 1035 TVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVVMELMTHGDLKSYLRCLRPESENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFV-MDGGYLDRPDNCADRLHNLMQMCWHYNPKMRPTFQEIIEMLKEELHPS-FQEMSFFYS 1283          

HSP 3 Score: 42.743 bits (99), Expect = 3.446e-122
Identity = 35/122 (28.69%), Postives = 54/122 (44.26%), Query Frame = 3
Query: 3021 VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQ------RYILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            VD   +LKI  +  + I  + L+  L  ++ +KK Q      R   + N  Y    +    DEW +    + LL  +G+G+FG+VY G  K +        V       VAVK +N   SL+
Sbjct:  931 VDPSNMLKIVIAPVICIFLLLLMG-LAGFIVFKKKQTEGPTGRLYTSPNPEYLSPDEVYEPDEWEVPRDKISLLRELGQGSFGMVYEGIAKDI--------VKGEPQTHVAVKTVNESASLR 1043          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: igf1ra (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:103037538])

HSP 1 Score: 221.861 bits (564), Expect = 7.543e-119
Identity = 230/969 (23.74%), Postives = 389/969 (40.14%), Query Frame = 1
Query:  181 KAKECTIVEGKVVI------THLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYIND----NRDEASKSTKKLYIKTNKFICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQP------QAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPL--NATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            K + CT+VEG + I       H       +L FP LR VTDY+LL   +  D  S+ +FPNL VIRG  L    AL+++   + + +   +L++I  G + +  N  LC + ++DW  I D    N    +K +K+         C + C  +      CP  + +D  +  CW+ N CQ  C   C  +   C  N    CCH QCLG C    N   C AC+   ++  CV  CP G Y F+G RC+    C++ ++        +   C+ ECP   F    + + +C   S      +K C    +K+   +D  ++      +  +L I    G +++ +L      ++ V  +++I  S+ L SL+FL  L  I G+  +           N  L  LW        I +G + F +N  LC + I     K  +   + + ++    NG  A C    L     + +S  ++L W+  +  +Y+ ++S + YY+              GC S  W++++      K  D GV L P                  LKP T Y ++++      +D     A S  V+  T    PS P+ + + +++ + + + W PP+ PNG  T Y++  W+    + S + E    ++C  E     + S +       D  +P       A    C  C KT E    + EE      F+  +H+ +                     + N      L  NAT    +   P+   P+   S   V           T++   I NL  FT Y I++ AC+                 +  CS  A   +RT+ +   D IP     T+     +   + + W  PP+ +GLIL Y++ +R+  +    +     C++ +    ++     N  +          G Y  ++   +LAGNG+W+   SF
Sbjct:   43 KLENCTVVEGYLQILLIGDKNHNPYQEFRTLSFPKLRMVTDYLLLFRVAGLDSLSM-LFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLKNITRGAIRIEKNPELCYLDSVDWSLIMDAEFNNYVAGNKQSKE---------CGDVCPGIMEDRPECPRTSFNDNYSYRCWTSNHCQKECAPKCDRR--VCTDNKE--CCHPQCLGSCTEPDNDMACAACQHYYHEGRCVPDCPPGTYRFEGWRCITMETCARVHLPSEVDFVIHNGECMPECPPG-FTRNDSQSMFC---SACDGLCDKVCE---IKTIDSVDAAQSLQGCTVIKGNLHINIRRGNNIASELESFMGLIQTVTGYVRIKHSHTLGSLSFLKSLRYINGEELLDNA-YAFSALDNQHLQYLWDWSQHNLTIRAGKLFFRSNPKLCVSEIRKMWEKTSIIERMEEDDI--RNNGERASCESHILKFKNNQTQSNRIKLTWERYRPPDYRDLISFIVYYKEAPFQNITEFDGQDGCGSSSWTMVDVDLPPDKATDPGVLLYP------------------LKPWTQYAIFVKAITLVVEDKHTLGAKSEVVYIRTKASEPSMPRDVRAYANSSSSLVVKWTPPISPNGNSTFYLV-RWQ----QQSEDRELYQHNYCSKELKIPIRISATALSDGEEDT-KPTKSDAGSAEKGACCPCPKTKEDLKAEAEERALSKVFENFLHNAVFTP------RPPDRRRRDLFGVANGTLARGLGRNATGQEGNMTDPELLEPVYPFSEFTV----------YTEFTE-IHNLQPFTVYRIDVHACNHE---------------VERCSAAAFVFSRTKPAEKADDIPGTV--THEKDERVEDTVVLRWPEPPRPSGLILMYEIKFRLGTEPEKHE-----CVSRQQYRELRGARLTNLGF----------GNYSVRVRATSLAGNGSWTEPVSF 914          

HSP 2 Score: 204.142 bits (518), Expect = 7.543e-119
Identity = 112/274 (40.88%), Postives = 163/274 (59.49%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSD----KGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRIL----EYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +           LV+MELM  GDL +YL     +      + +   K+ +  A +I+DGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY GMS+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+    E L P      F++VSF+++
Sbjct: 1027 TVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRSKQQGSCSQPLPSLKKMIQMAGEISDGMAYLNANKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFV-MEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEELEPS-----FQEVSFFYS 1275          

HSP 3 Score: 45.8246 bits (107), Expect = 7.543e-119
Identity = 37/129 (28.68%), Postives = 58/129 (44.96%), Query Frame = 3
Query: 2997 AYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRY-----ILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            AY N L+       L IT    V +  +ALIS +I+    + N R        + N  YF + +    DEW +  + + L   +G+G+FG+VY G  K +        V      KVA+K +N   S++
Sbjct:  922 AYENMLY-------LAITIPIIVLLALIALISSIIFIRKKRNNDRLGNGVLYASVNPEYFSAAEMYVPDEWEVSREKITLCRELGQGSFGMVYEGIAKGV--------VKDEPETKVAIKTVNESASMR 1035          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: igf1ra (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:103037538])

HSP 1 Score: 221.861 bits (564), Expect = 1.278e-113
Identity = 230/969 (23.74%), Postives = 389/969 (40.14%), Query Frame = 1
Query:  181 KAKECTIVEGKVVI------THLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYIND----NRDEASKSTKKLYIKTNKFICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNK-DCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIG---GRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDS---AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQP------QAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPL--NATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            K + CT+VEG + I       H       +L FP LR VTDY+LL   +  D  S+ +FPNL VIRG  L    AL+++   + + +   +L++I  G + +  N  LC + ++DW  I D    N    +K +K+         C + C  +      CP  + +D  +  CW+ N CQ  C   C  +   C  N    CCH QCLG C    N   C AC+   ++  CV  CP G Y F+G RC+    C++ ++        +   C+ ECP   F    + + +C   S      +K C    +K+   +D  ++      +  +L I    G +++ +L      ++ V  +++I  S+ L SL+FL  L  I G+  +           N  L  LW        I +G + F +N  LC + I     K  +   + + ++    NG  A C    L     + +S  ++L W+  +  +Y+ ++S + YY+              GC S  W++++      K  D GV L P                  LKP T Y ++++      +D     A S  V+  T    PS P+ + + +++ + + + W PP+ PNG  T Y++  W+    + S + E    ++C  E     + S +       D  +P       A    C  C KT E    + EE      F+  +H+ +                     + N      L  NAT    +   P+   P+   S   V           T++   I NL  FT Y I++ AC+                 +  CS  A   +RT+ +   D IP     T+     +   + + W  PP+ +GLIL Y++ +R+  +    +     C++ +    ++     N  +          G Y  ++   +LAGNG+W+   SF
Sbjct:   43 KLENCTVVEGYLQILLIGDKNHNPYQEFRTLSFPKLRMVTDYLLLFRVAGLDSLSM-LFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLKNITRGAIRIEKNPELCYLDSVDWSLIMDAEFNNYVAGNKQSKE---------CGDVCPGIMEDRPECPRTSFNDNYSYRCWTSNHCQKECAPKCDRR--VCTDNKE--CCHPQCLGSCTEPDNDMACAACQHYYHEGRCVPDCPPGTYRFEGWRCITMETCARVHLPSEVDFVIHNGECMPECPPG-FTRNDSQSMFC---SACDGLCDKVCE---IKTIDSVDAAQSLQGCTVIKGNLHINIRRGNNIASELESFMGLIQTVTGYVRIKHSHTLGSLSFLKSLRYINGEELLDNA-YAFSALDNQHLQYLWDWSQHNLTIRAGKLFFRSNPKLCVSEIRKMWEKTSIIERMEEDDI--RNNGERASCESHILKFKNNQTQSNRIKLTWERYRPPDYRDLISFIVYYKEAPFQNITEFDGQDGCGSSSWTMVDVDLPPDKATDPGVLLYP------------------LKPWTQYAIFVKAITLVVEDKHTLGAKSEVVYIRTKASEPSMPRDVRAYANSSSSLVVKWTPPISPNGNSTFYLV-RWQ----QQSEDRELYQHNYCSKELKIPIRISATALSDGEEDT-KPTKSDAGSAEKGACCPCPKTKEDLKAEAEERALSKVFENFLHNAVFTP------RPPDRRRRDLFGVANGTLARGLGRNATGQEGNMTDPELLEPVYPFSEFTV----------YTEFTE-IHNLQPFTVYRIDVHACNH---------------EVERCSAAAFVFSRTKPAEKADDIPGTV--THEKDERVEDTVVLRWPEPPRPSGLILMYEIKFRLGTEPEKHE-----CVSRQQYRELRGARLTNLGF----------GNYSVRVRATSLAGNGSWTEPVSF 914          

HSP 2 Score: 186.808 bits (473), Expect = 1.278e-113
Identity = 95/211 (45.02%), Postives = 136/211 (64.45%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSD----KGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFV 3964
            TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +   Q   +L   V+MELM  GDL +YL     +      + +   K+ +  A +I+DGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY GMS+E V+ FV
Sbjct: 1027 TVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVS---QGQPTL---VIMELMTRGDLKSYLRSLRSKQQGSCSQPLPSLKKMIQMAGEISDGMAYLNANKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFV 1218          

HSP 3 Score: 45.4394 bits (106), Expect = 1.278e-113
Identity = 37/129 (28.68%), Postives = 58/129 (44.96%), Query Frame = 3
Query: 2997 AYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRY-----ILTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            AY N L+       L IT    V +  +ALIS +I+    + N R        + N  YF + +    DEW +  + + L   +G+G+FG+VY G  K +        V      KVA+K +N   S++
Sbjct:  922 AYENMLY-------LAITIPIIVLLALIALISSIIFIRKKRNNDRLGNGVLYASVNPEYFSAAEMYVPDEWEVSREKITLCRELGQGSFGMVYEGIAKGV--------VKDEPETKVAIKTVNESASMR 1035          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: insra (insulin receptor [Source:NCBI gene;Acc:103039445])

HSP 1 Score: 238.424 bits (607), Expect = 3.598e-63
Identity = 253/966 (26.19%), Postives = 396/966 (40.99%), Query Frame = 1
Query:  193 CTIVEG--KVVITHLSK-HMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK--FICSNSCSNM------CPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTN-KDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKN--------------MSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKEC-GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQA-FIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG-LTYYRSISTNMKNGGFSDSGCSSVIWSV--IEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYH----VITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESF 2961
            CT++EG  K+++   +K      L FP L  VTDY+LL F     ++  ++FPNL VIRG  L    AL+++     + L   SL +I  G V V  N +LC +  +DW  I D       S +  YI  NK    C + C  M      CP+ TI+   +  CW+   CQ +C S C  K   C  +N   CCH QCLGGC   ++ + CVAC+   ++ ECV  CP G+Y FKG RCV    C   +                   +   C+ ECPS    + IN T   +N +       K C GL  + S      ++ C      ++    GG +++ +L      L  +  ++ + RS  L SL+FL  L  I+G+   +G  N +     N  L +LW        I  G + F  N  LC   I       G +N     ++   TNG  A C    L  T +   S  + + W+     +++ L G +  Y+               C S  W +  ++   +  D   + +P  L            I +LKP T Y + ++ + +  D      A S  ++  T+   PS P    S S++ ++I L WKPP  PNG IT Y+++  +       +  +Y  K     +  +   T   + E+   +  +       C  C KT ++  ++ EE      F+ ++H+ +   R      SL    +++ +   +F T P               +IP  NTSS    + E  A+ +    Y     VI+NL +FT Y IEI AC+                    CS  A  S RT  E   D D++ PI              + + W  P   NG+I+ Y++NY+   D  +      +C++ KS  +               +R    G Y  +I   +LAGNG+W+    F
Sbjct:   25 CTVIEGHLKILLMFTTKPEDFRGLTFPKLTVVTDYLLL-FRVYGMESLSSLFPNLTVIRGNNLFFNYALVLFEMLQLKELGLHSLMNITRGAVRVEKNPDLCYLSTLDWSKILD-------SVEDNYIVANKNDGECGDVCPGMAKGKTTCPQTTINGHFSERCWTQKHCQRMCPSSC--KHRACTKDNQ--CCHDQCLGGCMEPSSPRKCVACRNFLHQGECVERCPAGFYTFKGWRCVDFAFCQALHNRCKQGKQGKGGECYEYVIHQGACIPECPSGY--TTINSTS--LNCTPCAGLCPKVCMGLKTVDSVTAAQGLRGCTVLNGSLVINIRGGNNIAAELEANLGQLEEITGYLTVRRSYALVSLSFLRKLRLIRGEVQEVG--NYSFYALDNQNLRQLWDWSKHNLTIQQGRMFFHHNSKLCMAEIRKMEEVTGTKNRHVKNDIATKTNGDQASCESQVLKFTTIRTLSDKIIIKWEPFWPPDFRDLLGFMVLYKDAPYKNVTEFDGQDACGSNSWVIADVDPPQRATDGKEQQEPGYL------------ILALKPWTQYAIMVKTQLSASDEHQVHGAKSEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFCQQQPEASELYKFDYCQKGM---KLPSRAPTQVDSGEEQKWNQTEEHGQGGRCCACPKTEKQLKKEAEETEYRKTFENYLHNEVFRIRPSRQRRSLVGVANQTHS---DFLTTP---------------SIP-PNTSSTPSPEEEAEANKITQLVYAKESTVISNLRHFTSYQIEIHACNHPTDPAR-------------CSMAAYVSARTMPEDHAD-DIMGPI------TFEVAEYSVHIRWIEPKAPNGMIILYEVNYKRLGDTELH-----HCVSRKSYITENGCK----------LRVVHPGNYTVRIRATSLAGNGSWTEPTHF 903          

HSP 2 Score: 202.601 bits (514), Expect = 6.558e-56
Identity = 113/270 (41.85%), Postives = 163/270 (60.37%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLH--QYAERSDKGMIDG--KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL +YL   +    ++ G      K+ +  A +IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+T  +D WS+GVVL+EISTL   PY G+S+E V++FV   G            L ++M  CW +    RPTF  I+E L   ++   F+++SF+++
Sbjct:  985 TVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVVMELMTHGDLKSYLRCLRPESENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFV-MDGGYLDRPDNCADRLHNLMQMCWHYNPKMRPTFQEIIEMLKEELHPS-FQEMSFFYS 1233          

HSP 3 Score: 37.3502 bits (85), Expect = 6.558e-56
Identity = 21/61 (34.43%), Postives = 30/61 (49.18%), Query Frame = 3
Query: 3174 DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            DEW +    + LL  +G+G+FG+VY G  K +        V       VAVK +N   SL+
Sbjct:  941 DEWEVPRDKISLLRELGQGSFGMVYEGIAKDI--------VKGEPQTHVAVKTVNESASLR 993          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Match: insrb (insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-020503-4])

HSP 1 Score: 234.572 bits (597), Expect = 4.160e-62
Identity = 252/956 (26.36%), Postives = 389/956 (40.69%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCP----------ERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKD-CVACKKLRYKEECVLSCPVGYYEFKGSRCVHKI-------ECSKKNMS----ITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQA-FIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLT--YYRSISTNMKNGGFSDSGCSSVIWSV--IEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFK--TSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            CT++EG + I  + K      R   FP L  +TDY+LL F     ++  ++FPNL VIRG  L    AL+++     + +   SL +I  G V +  N +LC +  +DW  I D       S +  YI  NK      C ++CP          + TI+      CW+ + CQ IC + C  K   C +++   CCH +CLGGC    N   CVAC+ L Y   CV  CP  +Y FKG RCV           C +K  S       +   C+ ECPS    + ++ T  C   + +  K     GL  + S      ++ C      ++    GG +++ +L      L  +  ++ I R+  L SL+FL  L  I+G+   IG  N +     N  L +LW        IL G + F  N  LC + I       G ++     ++   TNG  A C   QLN T + V S+ + + W+     +++ L G    Y  +   N+      D+ C S  W +  +E   +  D           P D G    C +  LKP T Y + ++ + +  D      A S  ++  T+   PS P    S S++ ++I L WKPP  PNG IT Y + Y K        ++E    D+CQ       +  T  +  E+   +  + Q    +C  C KT     ++ EE      F+ ++H+ +   +      SL   NS    I     T P    VS     + K +I                          VI++L +FT Y IEI AC       N+   I        CS     S RT   P+V         T+  +    + + + W+ P   NG+I+ Y++NYR   D         +C++  S    +             +R    G Y  +I   +LAGNG+W+
Sbjct:    4 CTVIEGHLKILLMFKTRAEDFRGLSFPKLVMITDYLLL-FRVYGLESLSDLFPNLTVIRGNNLFFNYALVMFEMLQLKEVGLHSLMNITRGAVRMEKNPDLCYLSTLDWSKILD-------SVEDNYIVANK--NERECGDICPGTIVGKITCVQTTINGHFGERCWNQDNCQRICPAAC--KHRACTLDDR--CCHDKCLGGCSEPGNASACVACRNLLYGNMCVDRCPPDHYIFKGWRCVSFAFCQDLHNRCKQKKASDCHQYVIHNGACIPECPSGF--TIVDATLNCKPCAGLCPKLCT--GLQTIDSVTAAQALRGCTVLNGSLVIKIRGGNNIAAELEANLGQLEEITGYLTIRRAYALVSLSFLRKLRLIRGETQEIG--NYSFYALDNQNLRQLWDWSKHNLTILQGRMFFHYNAKLCLSEIRKMEEVTGTKDRHTKNDIALRTNGDQASCENRQLNFTQIRVSSKNIMIRWEPFWPPDFRDLLGFMVLYKEAPYKNVTEFDGQDA-CGSNSWVITDVEPPPRATDGNK--------PGDPG----CVLMPLKPWTQYAIMVKTQLSVSDEHQVHGAKSEIIYVLTNQTRPSVPLDPISSSNSSSQIILKWKPPADPNGNITHYRVAYQKQ-----EEDSELYKFDYCQKGMKLPSRAPTHYTTEEEQKWNQTEEQGETSSCCACPKTETELKKEAEETEFRKTFENYIHNEVFEPKPSRRRRSLGIANSTHSTI---LITPPTFPNVSAPTIVSSKESI--------------------------VISHLHHFTSYQIEIQAC-------NHLTDIAF------CSMATYVSART--MPEVKADDIFGAVTHEILPEEPEFVYIHWQEPKAPNGMIVLYEINYRRVSDTEELH----HCVSRISYEKTRGCK----------LRVGHPGNYSVRIRATSLAGNGSWT 863          

HSP 2 Score: 202.601 bits (514), Expect = 8.130e-57
Identity = 115/272 (42.28%), Postives = 162/272 (59.56%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDG------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL +YL     R D     G      K+ +  A +IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+T  +D WS+GVVL+EISTL   PY G+S+E V++FV   G            + ++M  CW +    RPTF  I+E L   ++   F++VSF+++
Sbjct:  926 TVNESASLRERIEFLNEASVMKAFSCHHVVRLLGV----VSKGQPT--LVVMELMTHGDLKSYLRSL--RPDAENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDGWSFGVVLWEISTLAEQPYQGLSNEQVLKFV-MDGGYLDRPESCAERINNLMQMCWQYNPKMRPTFNEIIEMLKDDLHPS-FQEVSFFYS 1174          

HSP 3 Score: 40.0466 bits (92), Expect = 8.130e-57
Identity = 22/67 (32.84%), Postives = 35/67 (52.24%), Query Frame = 3
Query: 3156 YFLSGQDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            YFL   D+W +  + + +L  +G+G+FG+VY G  K +        V      +VAVK +N   SL+
Sbjct:  876 YFLYVPDDWEVAREKITVLRELGQGSFGMVYEGIAKDI--------VKGEPETRVAVKTVNESASLR 934          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.616 bits (540), Expect = 1.659e-59
Identity = 119/276 (43.12%), Postives = 164/276 (59.42%), Query Frame = 2
Query: 3329 RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYP-LVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQ----IADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            R  + TV++ AT+ +  +FL+EA +MK F  +H+V L+G+        S   P LV+MELM  GDL +YL      ++K       SL   +Q    IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+T    PY G+S+E V++FV   G L +     P  L +++  CW +    RPTF+ IL+ L P ++  F  + SFYH+
Sbjct:   91 RVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVV-------SQAQPILVIMELMTRGDLKSYLRSLRPDAEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFV-MDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEILDGLAPDLHPSFH-EFSFYHS 344          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 3.393e-59
Identity = 123/299 (41.14%), Postives = 171/299 (57.19%), Query Frame = 2
Query: 3287 NLCKCIFTHESCC*RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYP-LVVMELMENGDLSNYLHQY---AERSDKGMIDGKQS----------LLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
             L + I   E    R  + TV++ AT+ +  +FL+EA +MK F  +H+V L+G+        S   P LV+MELM  GDL +YL      AE   + ++  K+           L  A +IADGM YL  K+FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+T    PY G+S+E V++FV   G L +     P  L +++  CW +    RPTF+ IL+ L P ++  F  + SFYH+
Sbjct:   30 GLARGIVKGEDET-RVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLGVV-------SQAQPILVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFV-MDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEILDGLAPDLHPSFH-EFSFYHS 305          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: INSR (insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091])

HSP 1 Score: 168.318 bits (425), Expect = 4.200e-43
Identity = 186/776 (23.97%), Postives = 305/776 (39.30%), Query Frame = 1
Query:  733 CCHKQCLGGCY-GKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKK---NMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTS-NYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNH------VFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDT------CSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKN--NPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHK----PTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITG------INKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYK 2970
            CCH++CLGGC+   +   C+AC+   +K  CVL CP+G Y + G RCV    C      +     +   C+ +CPS    +    +  C        K  K  G + + S     ++  C   +  +     GG +++ +L      + +V  +++I RS+ L +L FL  L  I+G   + + N +  +  N  L +LW        +L G + F  N  LC + I+      G        +L    NG    C    L  T  E  S  ++L W +     +  +LS   YY+       +       C S  W+  + + +            L PQ+     I  + SLKP T Y +++        S  I+N       V+  T     S P  + + S++  ++ + W+ P +PNG +T YI+ + +         ++Y NK            TS  + E     N   Q+  DT      C  C KT  +  Q+ EE   M  F+  +H+ I   R +N   P+       +      + TT   N+T S++      PTP      E       ++I              IT L +FT Y I+I AC       N++ +++       CS  A  S RT+   D D           NITG      +   I + WK P   NGL++ Y++ Y++      F     +C++  S    K           F +R+   G Y   I   +L+GNG+W+  E F ++
Sbjct:   17 CCHEECLGGCHQAGSEHHCLACRHYWHKGICVLDCPLGTYRYDGWRCVTAEFCQAPYDYSTQNVLHHGDCLPDCPSGYIRNVTRNSMTCTKCDGPCPKVCKY-GNVNINSLTAAQELYGCTELDGNLTIDIRGGNNIAAELETNLGLIEMVTGYVKIKRSSALVTLAFLKNLRIIRGD-MLDEGNYSFYVLDNQNLQQLWDWTKHNLTVLRGKLYFAFNHKLCMSEIYRMEVVTGTYGRQSRTDLNPKENGDRTSCESKFLRFTGNETSSDKIKLEWYHTWPKYDRDLLSYTVYYKEAPFKNVSEFDQQDACGSNSWTARDLEFR----------AGLNPQEMSNPSII-LLSLKPWTQYAIFVRAFTLTTTSGDINNQGAKSEVVYIRTKANASSIPLDVIAGSNSSTQLVVKWRAPAYPNGNVTHYIVRWQRQHEDPELRKHDYCNKVLKVPRREPA--TSSIDMEPGARGN---QSELDTSLAPEKCCACPKTQAQLRQEAEEAQFMKTFENFLHNQIFATRLRNMHRPD-----RKRRDMFGTDNTTDSGNSTSSLIGSEEVIPTPVVYTFAEEM-VFGKERI-------------TITGLRHFTAYRIQIQAC-------NHASELV------GCSAPAYVSARTQPHFDAD-----------NITGHVKCEVVKNIIYLQWKEPSDPNGLVVLYEVKYQLGGSRFNFSQIQQHCVSRSSYREGK----------GFQVRHLLPGDYTAHIRAISLSGNGSWT--EPFHFR 719          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009736.1 (pep scaffold:Pmarinus_7.0:GL479388:5844:12989:-1 gene:ENSPMAG00000008798.1 transcript:ENSPMAT00000009736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.14 bits (383), Expect = 1.418e-41
Identity = 90/247 (36.44%), Postives = 132/247 (53.44%), Query Frame = 2
Query: 3365 IEDIVQFLSEACLMKQFLGYHIVHLIGI---YAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYY--RKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYL 4090
            +E++ QFL E  LMK F   +++ L+GI     G         PLVV+  M++GDL ++L Q         + G     + +Q+A GM YLA K+FVHRDLAARNC++D    +K+              DFGL + I   +YY  R   RAK P++W+A ESL++  +TTK+DVWS+GV+L+E+ T G+ PY  +    +  F+R  G+        P  L + M  CW     DRP F  ++  L
Sbjct:    4 VEEVEQFLREGLLMKNFQHENVLSLLGICMPLHGT--------PLVVLPYMKHGDLGHFLRQETHNPTVKDLIG-----FGLQVARGMEYLASKKFVHRDLAARNCMLDESYTVKVA-------------DFGLARDIYNKEYYSIRNHQRAKLPIKWIALESLQTQRFTTKSDVWSFGVLLWELQTRGAPPYPDVDPFDMARFLR-QGRRLPQPEYCPDELFERMLDCWGPTAGDRPGFPELVRRL 223          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 5.094e-40
Identity = 97/258 (37.60%), Postives = 131/258 (50.78%), Query Frame = 2
Query: 3377 VQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQS-------------------LLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLV 4093
              F  EA LM +F   +IV L+G+ A  + K   L    + E M +GDL+ YL + +  S+ G+                         L  A Q+A GM YLA ++FVHRDLA RNCLV   L +KI              DFGL++SI   DYY+       P+RWM PES+    YT+++DVW++GVVL+EI + G  PY GMSHE VI FVR  G +       P  L ++M  CW+    DRP+F  +   L 
Sbjct:    6 ANFHREAALMAEFTHPNIVKLLGVCA--VGKPFCL----LFEFMPHGDLNEYLRRCS--SEAGLAASSPPARAPTSSGSEPVSLCCADKLFVATQVAAGMAYLAERKFVHRDLATRNCLVGNRLVVKIS-------------DFGLSQSIYAADYYKANENDAIPIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSHGLQPYFGMSHEEVIYFVR-DGNVLACPDGCPLDLYNLMRLCWAHAPADRPSFASVQHVLA 241          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 69.707 bits (169), Expect = 2.752e-12
Identity = 55/189 (29.10%), Postives = 86/189 (45.50%), Query Frame = 2
Query: 3392 EACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINE-NDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVI 3955
            E  L+K+    +IV     Y G  Q+  +L   + +E +  G +S+ L+ Y    +  + +      +  QI  G+ YL  K  +HRD+   N L+D      I GC  I        DFG++K ++  N    KR   +  V WM+PE ++    T K D+WS G V+ E+ T G  P+   S    I
Sbjct:  504 EMNLLKELHHENIV----TYYGASQEGGNLN--IFLEYVPGGSVSSMLNNYGPFEESLITN------FTRQILIGVAYLHKKNIIHRDIKGANILID------IKGCVKI-------TDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFT-GKHPFPDFSQMQAI 666          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 67.0106 bits (162), Expect = 4.968e-12
Identity = 61/241 (25.31%), Postives = 108/241 (44.81%), Query Frame = 2
Query: 3368 EDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYL 4090
            E++   ++E  L+K     +IV     Y G I+K+  LY  +++E   NG L     +   RS  G+ +  +S  +  Q   G+ YL  +  +HRD+ A N L+ AD  +K+              DFG++  +N +            + WMAPE L +   +T +D+WS G  + E+ T    PY  ++  ++   V +           P  L D ++ C+      RPT  ++L+++
Sbjct:   62 EELNDIMAEISLLKNLNHNNIVK----YHGFIRKSYELY--ILLEYCANGSL----RRLISRSSTGLSEN-ESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLA-------------DFGVSTIVNSSAL-----TLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNP-PYHNLTDANIYYAVENDTYYPPSSFSEP--LKDFLSKCFVKNMYKRPTADQLLKHV 270          

HSP 2 Score: 22.3274 bits (46), Expect = 4.968e-12
Identity = 7/12 (58.33%), Postives = 10/12 (83.33%), Query Frame = 3
Query: 3219 IGKGNFGVVYSG 3254
            IG+G++GVVY  
Sbjct:   31 IGRGSYGVVYKA 42          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 63.1586 bits (152), Expect = 9.725e-12
Identity = 61/200 (30.50%), Postives = 95/200 (47.50%), Query Frame = 2
Query: 3350 SQAATIEDI---VQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLAC---KRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVY-TTKTDVWSYGVVLYEISTLGSLPY 3928
            S +  +ED+   +QFL+    +KQ      +  I  Y G+  K++SL+  ++ME    G L + L         G ID K      + + + +  L C      +HRD+ A N L+  + N+K+  C           DFG+   +N+    R++  A  P  WMAPE +   VY  TK D+WS G+  YEI+T G+ PY
Sbjct:   58 SDSDEVEDVQREIQFLAS---LKQ------ISNITRYYGSYLKDTSLW--IIMEHCAGGSLRSLLR-------PGKIDEK---YIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKL--C-----------DFGVAAQVNQTSL-RRQTMAGTPY-WMAPEVIMEGVYYDTKVDIWSLGITTYEIAT-GNPPY 220          

HSP 2 Score: 25.0238 bits (53), Expect = 9.725e-12
Identity = 9/12 (75.00%), Postives = 10/12 (83.33%), Query Frame = 3
Query: 3219 IGKGNFGVVYSG 3254
            IG+G FGVVY G
Sbjct:   29 IGRGKFGVVYKG 40          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 64.6994 bits (156), Expect = 1.002e-10
Identity = 54/189 (28.57%), Postives = 80/189 (42.33%), Query Frame = 2
Query: 3383 FLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIA-------DGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPY 3928
             ++E  +MK     +IV+ +  Y   ++ +  L+  VVME ME G L++ +            D   S L   QIA        G+ +L  K  +HRD+ + N L+D    +KI              DFG    +   D   KR        WMAPE ++   Y  K DVWS G++  E+   G  PY
Sbjct:  607 IVNEILVMKDSRHKNIVNFLEAY---LRTDDDLW--VVMEFMEGGSLTDIIENSPTN------DNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKI-------------TDFGFCARLT--DKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEM-LEGEPPY 768          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 60.4622 bits (145), Expect = 1.927e-9
Identity = 60/253 (23.72%), Postives = 115/253 (45.45%), Query Frame = 2
Query: 3344 TVSQAATIEDIV--QFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESL--RSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYL 4090
            TV++A+   +    + LSE  + K     +IV  I  +    + +S++Y  +++E+  NG L   L +      + ++   +   +  QI   + Y+  +R +HRDL   N   D++ N+KIG             DFGL  ++  N+  RK      P  ++APE L  + + ++ + D+WS GV+LY +  +G  P+      ++ E ++        D  I      ++    S    +RP+   I++Y+
Sbjct:  111 TVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCF----EDDSNVY--ILLEICPNGSLMELLKR------RKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIG-------------DFGLA-AVLANESERKYTICGTP-NYIAPEVLMGKHSGHSFEVDIWSLGVMLYAL-LIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 230.335 bits (586), Expect = 1.009e-67
Identity = 122/270 (45.19%), Postives = 169/270 (62.59%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAER----SDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TVS+ A+I D ++FL EA +MK F   H+V L+G+ +           LVVMELM+NGDL N+L  +       SD+     +Q L  A +IADGM YLA ++FVHRDLAARNC+V+A+L +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+T+ +DVWS+GVV++E++TL S PY G S+E V+++V   G +       P  L D+MT CW F    RPTF+ I+  +   ++ E F++ SFYH+
Sbjct:   53 TVSENASIRDRIEFLQEASIMKAFQCNHVVRLLGVVSDGQPT------LVVMELMDNGDLKNFLRSHRPEVTMESDEPPPTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNANLTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQPYPGKSNEEVLKYV-VDGGVMPKPDDCPDRLFDLMTLCWQFSPKARPTFLSIISLIEEDLSQE-FRENSFYHS 301          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO49126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW8])

HSP 1 Score: 140.198 bits (352), Expect = 4.659e-36
Identity = 101/266 (37.97%), Postives = 147/266 (55.26%), Query Frame = 2
Query: 3359 ATIEDIVQFLSEACLMKQFLGYH--IVHLIG--IYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAER-----SDKGMIDGKQS-----LLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINEN-DYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNE 4111
            AT+ED   FLSE  +MKQ LG H  IV ++G   +AG +         ++ E    GDL NYL    ++     S  G   G++      L +A QIA GM YL+ K FVHRDLAARN L+  D  +KI              DFGLT+ + E+ +Y++     K P++WMAPE++   V+TTK+DVW++GVVL+EI TLG  PY G S +   + +++G +++  D+  P  L  +M  CW+    DRPTF ++   L   ++ E
Sbjct:   60 ATMEDRRNFLSEIEMMKQ-LGKHLNIVSILGCVTHAGQL--------CLITEYCPYGDLRNYLRAIRDKVSTRDSLAGRAPGRELTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILICEDNLVKIS-------------DFGLTRDVYESSEYHKMHNTGKLPLKWMAPEAIFQNVHTTKSDVWAFGVVLWEIVTLGGSPYPGQSGKEFYKKLKNGYRMEKPDMCSP-ELYAMMRSCWASSPEDRPTFTKLRNQLEQLMDRE 302          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO34087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQB4])

HSP 1 Score: 132.109 bits (331), Expect = 3.100e-35
Identity = 70/162 (43.21%), Postives = 94/162 (58.02%), Query Frame = 2
Query: 3596 AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRIL 4081
            A QIA GM +LA K+ +HRDLAARN LVD    +KIG             DFGL + I + D Y K+G    PV+WMAPE+L    Y++KTDVW++GVVL+EI TLG  PY G+  E +++++   GK        P  +  +M  CWS     RPTF  ++
Sbjct:   15 AYQIAQGMDFLASKKCIHRDLAARNVLVDEGYALKIG-------------DFGLARDIYKTDLYVKKGAGLLPVKWMAPEALFDREYSSKTDVWAFGVVLWEILTLGGSPYPGVPLEQLLDYIN-EGKRMAQPRDCPPEIYAIMCDCWSLEQDRRPTFAELV 162          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO44269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW90])

HSP 1 Score: 133.265 bits (334), Expect = 1.142e-34
Identity = 88/261 (33.72%), Postives = 131/261 (50.19%), Query Frame = 2
Query: 3353 QAATIEDIVQ-FLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPL-VVMELMENGDLSNYLHQYAERSDKGMIDGK---QSLLW-AIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGS-LPYSGMSHESVIEFVRXXXXXXXXXXXI--------PSSLLDVMTWCWSFYDTDRPTFMRILEYL 4090
            +A   ++I Q F  E  +M      ++V L+G+   +        P+ +++E MENGDL+ +L Q    S       K   Q+LL+ A+Q+A GM Y+A  +FVHRDLA RNCLV     +KI              DFG+++ +    YYR +GR   P+RWMAPE +    +T+ +DVW++GV L+EI TL +  PY  ++ E VIE V+        D           P  +   M  CW+   + RP F  I  +L
Sbjct:    3 KAGVDKNIKQDFFKEVKIMAGVRHENVVRLLGVCKDD--------PMCMIVEYMENGDLNQFLKQRELASGNSADPNKVTYQALLYMALQLAAGMKYIASHQFVHRDLATRNCLVGHSFTVKIA-------------DFGMSRHLYSKHYYRIQGRVILPIRWMAPECILQGKFTSASDVWAFGVTLWEILTLAAEYPYGDLTDEKVIENVQLMFFRPKSDAITFLSRPEICPPDVYAKMRSCWAIEPSARPDFHDIHSFL 242          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Match: EDO35594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL46])

HSP 1 Score: 131.724 bits (330), Expect = 4.470e-34
Identity = 91/265 (34.34%), Postives = 135/265 (50.94%), Query Frame = 2
Query: 3356 AATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLH--------QYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRI---LEYLV----PYVN 4105
             A  E   +FL E  LMK+ LG H  +++     +  K   +   +V+E +  GDL +YL         +  E+ D+ MI  +  L ++ QIA GM YL+ K FVHRDLAARN LV  +  +K+              DFGLT+ + E   Y+     K P++WM+PE++   ++TT++DVWSYGVVL+EI+TLG  PY  +S   V   +R  G            +  +M  CW      RPTF  +    EY++    PY++
Sbjct:    5 TAGPEQGEEFLKEISLMKK-LGSH-KNIVNFLCCSTVKEPFM---LVVEFLPKGDLLDYLRRNRSKQNDETGEQEDE-MITPQDLLSFSYQIAAGMEYLSKKGFVHRDLAARNVLVADNKQVKVA-------------DFGLTRDLYEESAYQGHSNRKLPIKWMSPEAIYDQIFTTESDVWSYGVVLWEIATLGGAPYPTISTRDVFVMLR-SGYRMEKPDICSDEVYTIMKHCWEDQPKKRPTFSDLRMKFEYMLEADNPYLD 249          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: insra (insulin receptor [Source:NCBI gene;Acc:101166254])

HSP 1 Score: 243.047 bits (619), Expect = 3.582e-126
Identity = 249/961 (25.91%), Postives = 401/961 (41.73%), Query Frame = 1
Query:  193 CTIVEGKVVITHLSKHMCNSLR---FPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYN-AWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNK--FICSNSCSN------MCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGK-TNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNR---------------CVKECPSDLFASFINGTKYCVNGSTITTKYNKEC-GLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQA-FIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSG--LTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDS-GVK--LKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDS----AAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMH-SVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRT--ERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWS 2946
            CT++EG + I  + K    + R   FP LR VTDY+LL F     ++  ++FPNL VIRG  L    AL+V+     R L   SL +I  G V +  N +LC +  +DW  I D  ++        YI  NK    C + C        +CP  T++   +  CW+   CQ +C   C     +    +   CCH QCLGGC    +  DCVAC+ L+++  CV  CP  +  +KG RCV    C + +        R               C+ ECPS     +       +N S       K C GL  + S      ++ C      ++    GG +++ +L      L  +  ++ + RS  L SL+F   L  I+G+   +G  N +     N  L +LW     K  IL G + F  N  LC + I       GL++     E+   TNG  A C    L  T +   S  + + WK    S+++ L G  + Y  +   N+      D+ C S  W + +       S G K   +P  L            I  LKP T Y + ++ + +  D      A S  ++  T+   PS P    S S++ ++I L WKPP  PNG IT Y+++Y +       +  +Y  K     +  +   T   + E+   +  + +     C  C KT +   +++E+      F+ ++H  V  ++R +   +++   N           T+P   T      P+P + IP E+  +    +  +   A ++    VI+NL +FT Y IEI AC++               ++  CS  A  S RT  E   D D++ PI  +   N       + + W+ P   NG+I+ Y++ Y+   D+         C++ K    +     K        + +P  G Y  +I   +LAGNG+W+
Sbjct:   76 CTVIEGHLKILLMFKTKPENFRGISFPKLRVVTDYLLL-FRVYGLESLSDLFPNLTVIRGNNLFFNYALVVFEMLQLRELGLHSLMNITRGAVRIEKNPDLCYLSTLDWSKILDTVEDN-------YIVANKNDRECGDVCPGVPRGETLCPTTTLNGHFSERCWTQKFCQKMCPVQCK----HGACTDGGQCCHDQCLGGCLKPNSTSDCVACRGLQHEGRCVEQCPKKFVVYKGWRCVSSDFCQELHHRCRREKERSKSAECHEYVIHNGACIPECPS----GYTTVNSSALNCSPCAGLCPKVCIGLKTVDSVTAAQALRGCTILNGSLVINLRGGNNIAAELEASLGQLEEITGYLTVRRSYALVSLSFFRKLRVIRGEEQEVG--NYSFYALDNQNLRQLWDWSKHKLAILQGRMFFHYNSKLCMSEIRRMEEVTGLKDRRVKNEIALKTNGDRASCENHVLTFTQIRTMSDKIMIKWKPFWPSDFRDLLGFMVLYKEAPFQNVTEFDGQDA-CGSNSWVIADVDPPRRASEGEKDQTEPGHL------------IMPLKPWTQYAIMVKTQLSASDEHQVNGAKSEIIYVRTNATRPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFYQRQPEASELYKFDYCQKGM---KLPSRVPTQVDSGEEKKWNQTEEEGQGKQCCTCPKTDKELKKEKEDSEYRKTFENYLHNEVFEIKRPRQRRSAMGVANQ----------TLPFLTTA-----PSP-TGIPDEDEKTFESTKTVVTVHAKEST---VISNLRHFTSYQIEIHACNK---------------AIPTCSMAAFVSARTMPEEKAD-DILGPIRSEVTENT------VHIEWQEPATPNGIIILYEVIYKRLVDSEDLHY----CVSRKMYKKMHGCKLK--------VMHP--GNYSVKIRATSLAGNGSWT 947          

HSP 2 Score: 208.379 bits (529), Expect = 3.582e-126
Identity = 117/272 (43.01%), Postives = 163/272 (59.93%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDG------KQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHN 4141
            TV+++A++ + ++FL+EA +MK F  +H+V L+G+    + K      LVVMELM +GDL +YL     R D     G      K+ +  A +IADGM YL  K+FVHRDLAARNC+V  DL +KIG             DFG+T+ I E DYYRK G+   PVRWMAPESL+  V+T  +D WS+GVVL+EISTL   PY G+S+E V++FV   G         P  L ++M  CW +    RP F  I+E L   ++   F++VSF+++
Sbjct: 1062 TVNESASLRERIEFLNEASVMKAFTCHHVVRLLGV----VSKGQPT--LVVMELMTHGDLKSYLRSL--RPDAENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDLTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFV-MEGGFLDRPENCPDRLHNLMQMCWQYNPKMRPAFQEIIEMLRDDLHPS-FQEVSFFYS 1310          

HSP 3 Score: 45.0542 bits (105), Expect = 3.582e-126
Identity = 35/121 (28.93%), Postives = 57/121 (47.11%), Query Frame = 3
Query: 3024 DVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRY-----ILTRNNHYFLSG-----QDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            D  YV+KI     +  + + L+S+   ++ +KKNQ       I   +N  +LS      +DEW +    + +L  +G+G+FG+VY G  K +        V       VAVK +N   SL+
Sbjct:  959 DPLYVVKIIIGPIICFVLLLLVSV-AGFVVFKKNQTQGPSGPIYASSNPEYLSANDVYEEDEWEVPRDKIHILRELGQGSFGMVYEGLAKDI--------VKGEGETHVAVKTVNESASLR 1070          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: igf1rb (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:101163560])

HSP 1 Score: 216.468 bits (550), Expect = 6.330e-117
Identity = 231/987 (23.40%), Postives = 395/987 (40.02%), Query Frame = 1
Query:  127 KICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLS-------KHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSC------SNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGK-TNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQD---SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSL------SSYNSKSIAIPNNFTTMPLN--ATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKE 2973
            KIC   I I G  ++     + CT+VEG + I  +        + +  SL FP L  +TDY+LL F     D+   +FPNL VIRG  L    AL+++   + + +   +LR+I  G + +  N  LC + +IDW  I D       +    YI  NK    CS+ C      + +C +  I +  +  CW+ N CQ  C   C  +   C       CCH QCLG C    ++  C AC    ++  C+  CP G Y F+G RC+    CSK +     +   +   C+ ECPS    S  N + +C     +    +K C    + S      +K C   +  +      G ++  +L      ++ V  +++I  S+ L SL FL  L  I G+  + +         N  L  LW        I +G + F AN  LC + I     K G++    + +     NG  A C    L       +S  + L W+  +  +Y+ ++S + YY+              GC S  W++++ +    K++D GV L                  S LKP T Y ++++      +D     A S  V+  TS   P+ P+ + + S++  ++ + W PP+ PNG  T Y+I + + A     F + Y +K+                 E     +    A    C +C K+ E    +  +      F+  +H+ I   R  +           S+Y  +  ++ N     P +     S   +P P          S+  ++++             I+ L  FT Y +++ AC+++               + +CS      +RT+ +   D +P       +   G    + + W  P   NGLIL Y++ Y++  ++   +     C++ +   + + +   N S           G Y  ++   +LAGNG+W+P   F   E
Sbjct:   30 KICGPSIDI-GNDINEFRLLENCTVVEGYLQILLIGDKNNNANQEVFRSLSFPKLTMITDYLLL-FRVSGLDSLSTLFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSIDWSSIMD-------AEFNNYIAGNKQSKECSDVCLGVTENNPLCRKAMIRNSYSYHCWNSNQCQKECPPSCGRR--ACTAEGK--CCHPQCLGSCTAPDSDAACAACVHYFHQGRCMADCPPGTYRFEGWRCISAKVCSKVHHPDFDTFVIHGGECMPECPSGYTRSATN-SMHCTACDGLC---DKVCDGKVIDSMDAAQSLKGCTVIKGNLHINIRRGHNMVAELESFTGLIQRVTGYVRITHSHTLTSLAFLRSLRYIDGETLL-EDMYAFSAFDNQQLQYLWDWKQHNLTIKTGKLFFRANPKLCMSEIRKMWTKTGIREHFQETDF--RNNGDRASCESTILRFKSNSTQSTRIILTWERYRPPDYRDLISFIVYYKEAPFQNITEFEGQDGCGSNSWNMVDVELRPEKDSDPGVLL------------------SGLKPWTQYAIFVKAVTLMVEDKFMPGAKSKVVYIRTSPSPPTMPRDVRAYSNSSTQLVVRWLPPVSPNGNRTYYLIRWQQQAEDRELFQHNYCSKELKIPVRIAARGVGDQEEETKPTKSDTEGANKGPCCLCPKSPEVLEAEAADASYRKVFENFLHNSIFTPRPADRRRRDVFGIANSTYAGRHKSLSNTSADPPPHTAGNSSGAAEPEPADQEYEFLEQSVTERELQ-------------ISGLQPFTVYRVDVHACNRQ---------------VKECSAAEFVFSRTKPAEKADDVP-----GPVTWEGHKDWVFLRWPEPSHPNGLILLYEIKYKLAAESEKHE-----CVSRQLYQTQQGVRLTNLS----------PGNYSVRVRATSLAGNGSWTPPLDFYVAE 930          

HSP 2 Score: 208.379 bits (529), Expect = 6.330e-117
Identity = 113/271 (41.70%), Postives = 163/271 (60.15%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDK----GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNG 4144
            TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +           LV+MELM  GDL +YL     +  +     +   K+ L  A QIADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY G+S+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+  +   ++   FK+VSFY++ 
Sbjct: 1036 TVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPKEQQWSSLSLPPLKKMLQMAGQIADGMAYLNSNKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV-MEGGLLEKPQNCPDMLFELMRMCWQYNPKMRPSFVEIIGSVKDELDPS-FKEVSFYYSA 1285          

HSP 3 Score: 40.4318 bits (93), Expect = 6.330e-117
Identity = 30/135 (22.22%), Postives = 61/135 (45.19%), Query Frame = 3
Query: 2982 YFIASAYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYI------LTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            +++A  Y + L+         + F   + ++ ++ + +++  L  K+N   +       + N  YF + +    DEW +  + + L   +G+G+FG+VY G  K +        V      KVAVK +N   S++
Sbjct:  926 FYVAERYESALY--------AMVFVPIIIVILISCMVVMLVALNRKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITLCRELGQGSFGMVYEGVAKGV--------VKDEPETKVAVKTVNESASMR 1044          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: igf1rb (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:101163560])

HSP 1 Score: 216.468 bits (550), Expect = 6.330e-117
Identity = 231/987 (23.40%), Postives = 395/987 (40.02%), Query Frame = 1
Query:  127 KICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLS-------KHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSC------SNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGK-TNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQD---SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSL------SSYNSKSIAIPNNFTTMPLN--ATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKE 2973
            KIC   I I G  ++     + CT+VEG + I  +        + +  SL FP L  +TDY+LL F     D+   +FPNL VIRG  L    AL+++   + + +   +LR+I  G + +  N  LC + +IDW  I D       +    YI  NK    CS+ C      + +C +  I +  +  CW+ N CQ  C   C  +   C       CCH QCLG C    ++  C AC    ++  C+  CP G Y F+G RC+    CSK +     +   +   C+ ECPS    S  N + +C     +    +K C    + S      +K C   +  +      G ++  +L      ++ V  +++I  S+ L SL FL  L  I G+  + +         N  L  LW        I +G + F AN  LC + I     K G++    + +     NG  A C    L       +S  + L W+  +  +Y+ ++S + YY+              GC S  W++++ +    K++D GV L                  S LKP T Y ++++      +D     A S  V+  TS   P+ P+ + + S++  ++ + W PP+ PNG  T Y+I + + A     F + Y +K+                 E     +    A    C +C K+ E    +  +      F+  +H+ I   R  +           S+Y  +  ++ N     P +     S   +P P          S+  ++++             I+ L  FT Y +++ AC+++               + +CS      +RT+ +   D +P       +   G    + + W  P   NGLIL Y++ Y++  ++   +     C++ +   + + +   N S           G Y  ++   +LAGNG+W+P   F   E
Sbjct:   30 KICGPSIDI-GNDINEFRLLENCTVVEGYLQILLIGDKNNNANQEVFRSLSFPKLTMITDYLLL-FRVSGLDSLSTLFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSIDWSSIMD-------AEFNNYIAGNKQSKECSDVCLGVTENNPLCRKAMIRNSYSYHCWNSNQCQKECPPSCGRR--ACTAEGK--CCHPQCLGSCTAPDSDAACAACVHYFHQGRCMADCPPGTYRFEGWRCISAKVCSKVHHPDFDTFVIHGGECMPECPSGYTRSATN-SMHCTACDGLC---DKVCDGKVIDSMDAAQSLKGCTVIKGNLHINIRRGHNMVAELESFTGLIQRVTGYVRITHSHTLTSLAFLRSLRYIDGETLL-EDMYAFSAFDNQQLQYLWDWKQHNLTIKTGKLFFRANPKLCMSEIRKMWTKTGIREHFQETDF--RNNGDRASCESTILRFKSNSTQSTRIILTWERYRPPDYRDLISFIVYYKEAPFQNITEFEGQDGCGSNSWNMVDVELRPEKDSDPGVLL------------------SGLKPWTQYAIFVKAVTLMVEDKFMPGAKSKVVYIRTSPSPPTMPRDVRAYSNSSTQLVVRWLPPVSPNGNRTYYLIRWQQQAEDRELFQHNYCSKELKIPVRIAARGVGDQEEETKPTKSDTEGANKGPCCLCPKSPEVLEAEAADASYRKVFENFLHNSIFTPRPADRRRRDVFGIANSTYAGRHKSLSNTSADPPPHTAGNSSGAAEPEPADQEYEFLEQSVTERELQ-------------ISGLQPFTVYRVDVHACNRQ---------------VKECSAAEFVFSRTKPAEKADDVP-----GPVTWEGHKDWVFLRWPEPSHPNGLILLYEIKYKLAAESEKHE-----CVSRQLYQTQQGVRLTNLS----------PGNYSVRVRATSLAGNGSWTPPLDFYVAE 930          

HSP 2 Score: 208.379 bits (529), Expect = 6.330e-117
Identity = 113/271 (41.70%), Postives = 163/271 (60.15%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDK----GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNG 4144
            TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +           LV+MELM  GDL +YL     +  +     +   K+ L  A QIADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY G+S+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+  +   ++   FK+VSFY++ 
Sbjct: 1036 TVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPKEQQWSSLSLPPLKKMLQMAGQIADGMAYLNSNKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV-MEGGLLEKPQNCPDMLFELMRMCWQYNPKMRPSFVEIIGSVKDELDPS-FKEVSFYYSA 1285          

HSP 3 Score: 40.4318 bits (93), Expect = 6.330e-117
Identity = 30/135 (22.22%), Postives = 61/135 (45.19%), Query Frame = 3
Query: 2982 YFIASAYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYI------LTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            +++A  Y + L+         + F   + ++ ++ + +++  L  K+N   +       + N  YF + +    DEW +  + + L   +G+G+FG+VY G  K +        V      KVAVK +N   S++
Sbjct:  926 FYVAERYESALY--------AMVFVPIIIVILISCMVVMLVALNRKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITLCRELGQGSFGMVYEGVAKGV--------VKDEPETKVAVKTVNESASMR 1044          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: igf1rb (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:101163560])

HSP 1 Score: 216.468 bits (550), Expect = 5.464e-115
Identity = 232/988 (23.48%), Postives = 396/988 (40.08%), Query Frame = 1
Query:  127 KICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLS-------KHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFI--CSNSC------SNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYG-KTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQD---SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSL------SSYNSKSIAIPNNFTTMPLN--ATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKE 2973
            KIC   I I G  ++     + CT+VEG + I  +        + +  SL FP L  +TDY+LL F     D+   +FPNL VIRG  L    AL+++   + + +   +LR+I  G + +  N  LC + +IDW  I D       +    YI  NK    CS+ C      + +C +  I +  +  CW+ N CQ  C   C  +   C       CCH QCLG C    ++  C AC    ++  C+  CP G Y F+G RC+    CSK +     +   +   C+ ECPS    S  N + +C     +    +K C    + S      +K C   +  +      G ++  +L      ++ V  +++I  S+ L SL FL  L  I G+  + +         N  L  LW        I +G + F AN  LC + I     K G++    + +     NG  A C    L       +S  + L W+  +  +Y+ ++S + YY+              GC S  W++++ +    K++D GV L                  S LKP T Y ++++      +D     A S  V+  TS   P+ P+ + + S++  ++ + W PP+ PNG  T Y+I + + A     F + Y +K+                 E     +    A    C +C K+ E    +  +      F+  +H+ I   R  +           S+Y  +  ++ N     P +     S   +P P          S+  ++++             I+ L  FT Y +++ AC+++               + +CS      +RT+ +   D +P P+         G    + + W  P   NGLIL Y++ Y++  ++   +     C++ +   + + +   N S           G Y  ++   +LAGNG+W+P   F   E
Sbjct:   30 KICGPSIDI-GNDINEFRLLENCTVVEGYLQILLIGDKNNNANQEVFRSLSFPKLTMITDYLLL-FRVSGLDSLSTLFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSIDWSSIMD-------AEFNNYIAGNKQSKECSDVCLGVTENNPLCRKAMIRNSYSYHCWNSNQCQKECPPSCGRR--ACTAEGK--CCHPQCLGSCTAPDSDAACAACVHYFHQGRCMADCPPGTYRFEGWRCISAKVCSKVHHPDFDTFVIHGGECMPECPSGYTRSATN-SMHCTACDGLC---DKVCDGKVIDSMDAAQSLKGCTVIKGNLHINIRRGHNMVAELESFTGLIQRVTGYVRITHSHTLTSLAFLRSLRYIDGETLL-EDMYAFSAFDNQQLQYLWDWKQHNLTIKTGKLFFRANPKLCMSEIRKMWTKTGIREHFQETDF--RNNGDRASCESTILRFKSNSTQSTRIILTWERYRPPDYRDLISFIVYYKEAPFQNITEFEGQDGCGSNSWNMVDVELRPEKDSDPGVLL------------------SGLKPWTQYAIFVKAVTLMVEDKFMPGAKSKVVYIRTSPSPPTMPRDVRAYSNSSTQLVVRWLPPVSPNGNRTYYLIRWQQQAEDRELFQHNYCSKELKIPVRIAARGVGDQEEETKPTKSDTEGANKGPCCLCPKSPEVLEAEAADASYRKVFENFLHNSIFTPRPADRRRRDVFGIANSTYAGRHKSLSNTSADPPPHTAGNSSGAAEPEPADQEYEFLEQSVTERELQ-------------ISGLQPFTVYRVDVHACNRQ---------------VKECSAAEFVFSRTKPAEKADDVPGPV------TWEGHKDWVFLRWPEPSHPNGLILLYEIKYKLAAESEKHE-----CVSRQLYQTQQGVRLTNLS----------PGNYSVRVRATSLAGNGSWTPPLDFYVAE 930          

HSP 2 Score: 202.216 bits (513), Expect = 5.464e-115
Identity = 107/250 (42.80%), Postives = 151/250 (60.40%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDK----GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRIL 4081
            TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +           LV+MELM  GDL +YL     +  +     +   K+ L  A QIADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY G+S+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+
Sbjct: 1036 TVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPKEQQWSSLSLPPLKKMLQMAGQIADGMAYLNSNKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV-MEGGLLEKPQNCPDMLFELMRMCWQYNPKMRPSFVEII 1265          

HSP 3 Score: 40.0466 bits (92), Expect = 5.464e-115
Identity = 30/135 (22.22%), Postives = 61/135 (45.19%), Query Frame = 3
Query: 2982 YFIASAYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYI------LTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            +++A  Y + L+         + F   + ++ ++ + +++  L  K+N   +       + N  YF + +    DEW +  + + L   +G+G+FG+VY G  K +        V      KVAVK +N   S++
Sbjct:  926 FYVAERYESALY--------AMVFVPIIIVILISCMVVMLVALNRKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITLCRELGQGSFGMVYEGVAKGV--------VKDEPETKVAVKTVNESASMR 1044          
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Match: igf1rb (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:101163560])

HSP 1 Score: 215.698 bits (548), Expect = 6.889e-115
Identity = 231/990 (23.33%), Postives = 397/990 (40.10%), Query Frame = 1
Query:  127 KICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLS-------KHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVY-YNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYIND----NRDEASKSTKKLYIKTNKFICSNSC------SNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYG-KTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNM----SITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWT-PDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQ-ILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQC---KNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQD---SAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSL------SSYNSKSIAIPNNFTTMPLN--ATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIP-PIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKE 2973
            KIC   I I G  ++     + CT+VEG + I  +        + +  SL FP L  +TDY+LL F     D+   +FPNL VIRG  L    AL+++   + + +   +LR+I  G + +  N  LC + +IDW  I D    N    +K +K+         CS+ C      + +C +  I +  +  CW+ N CQ  C   C  +   C       CCH QCLG C    ++  C AC    ++  C+  CP G Y F+G RC+    CSK +     +   +   C+ ECPS    S  N + +C     +    +K C    + S      +K C   +  +      G ++  +L      ++ V  +++I  S+ L SL FL  L  I G+  + +         N  L  LW        I +G + F AN  LC + I     K G++    + +     NG  A C    L       +S  + L W+  +  +Y+ ++S + YY+              GC S  W++++ +    K++D GV L                  S LKP T Y ++++      +D     A S  V+  TS   P+ P+ + + S++  ++ + W PP+ PNG  T Y+I + + A     F + Y +K+                 E     +    A    C +C K+ E    +  +      F+  +H+ I   R  +           S+Y  +  ++ N     P +     S   +P P          S+  ++++             I+ L  FT Y +++ AC+++               + +CS      +RT+ +   D +P P+         G    + + W  P   NGLIL Y++ Y++  ++   +     C++ +   + + +   N S           G Y  ++   +LAGNG+W+P   F   E
Sbjct:   30 KICGPSIDI-GNDINEFRLLENCTVVEGYLQILLIGDKNNNANQEVFRSLSFPKLTMITDYLLL-FRVSGLDSLSTLFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSIDWSSIMDAEFNNYIAGNKQSKE---------CSDVCLGVTENNPLCRKAMIRNSYSYHCWNSNQCQKECPPSCGRRA--CTAEGK--CCHPQCLGSCTAPDSDAACAACVHYFHQGRCMADCPPGTYRFEGWRCISAKVCSKVHHPDFDTFVIHGGECMPECPSGYTRSATN-SMHCTACDGLC---DKVCDGKVIDSMDAAQSLKGCTVIKGNLHINIRRGHNMVAELESFTGLIQRVTGYVRITHSHTLTSLAFLRSLRYIDGETLL-EDMYAFSAFDNQQLQYLWDWKQHNLTIKTGKLFFRANPKLCMSEIRKMWTKTGIREHFQETDF--RNNGDRASCESTILRFKSNSTQSTRIILTWERYRPPDYRDLISFIVYYKEAPFQNITEFEGQDGCGSNSWNMVDVELRPEKDSDPGVLL------------------SGLKPWTQYAIFVKAVTLMVEDKFMPGAKSKVVYIRTSPSPPTMPRDVRAYSNSSTQLVVRWLPPVSPNGNRTYYLIRWQQQAEDRELFQHNYCSKELKIPVRIAARGVGDQEEETKPTKSDTEGANKGPCCLCPKSPEVLEAEAADASYRKVFENFLHNSIFTPRPADRRRRDVFGIANSTYAGRHKSLSNTSADPPPHTAGNSSGAAEPEPADQEYEFLEQSVTERELQ-------------ISGLQPFTVYRVDVHACNRQ---------------VKECSAAEFVFSRTKPAEKADDVPGPV------TWEGHKDWVFLRWPEPSHPNGLILLYEIKYKLAAESEKHE-----CVSRQLYQTQQGVRLTNLS----------PGNYSVRVRATSLAGNGSWTPPLDFYVAE 930          

HSP 2 Score: 202.601 bits (514), Expect = 6.889e-115
Identity = 107/250 (42.80%), Postives = 151/250 (60.40%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDK----GMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRIL 4081
            TV+++A++ + ++FL+EA +MK+F  +H+V L+G+ +           LV+MELM  GDL +YL     +  +     +   K+ L  A QIADGM YL   +FVHRDLAARNC+V  D  +KIG             DFG+T+ I E DYYRK G+   PVRWM+PESL+  V+TT +DVWS+GVVL+EI+TL   PY G+S+E V+ FV   G L       P  L ++M  CW +    RP+F+ I+
Sbjct: 1036 TVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPT------LVIMELMTRGDLKSYLRSLRPKEQQWSSLSLPPLKKMLQMAGQIADGMAYLNSNKFVHRDLAARNCMVAEDFTVKIG-------------DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFV-MEGGLLEKPQNCPDMLFELMRMCWQYNPKMRPSFVEII 1265          

HSP 3 Score: 40.0466 bits (92), Expect = 6.889e-115
Identity = 30/135 (22.22%), Postives = 61/135 (45.19%), Query Frame = 3
Query: 2982 YFIASAYFNYLFPVDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYI------LTRNNHYFLSGQ----DEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLK 3356
            +++A  Y + L+         + F   + ++ ++ + +++  L  K+N   +       + N  YF + +    DEW +  + + L   +G+G+FG+VY G  K +        V      KVAVK +N   S++
Sbjct:  926 FYVAERYESALY--------AMVFVPIIIVILISCMVVMLVALNRKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITLCRELGQGSFGMVYEGVAKGV--------VKDEPETKVAVKTVNESASMR 1044          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000041357.1 (SMESG000041357.1)

HSP 1 Score: 1988.39 bits (5150), Expect = 0.000e+0
Identity = 977/977 (100.00%), Postives = 977/977 (100.00%), Query Frame = 1
Query:   49 MLNYYVIFILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETN 2979
            MLNYYVIFILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMPSPPQIIESISSAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETN
Sbjct:    1 MLNYYVIFILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMPSPPQIIESISSAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETN 977          

HSP 2 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 322/347 (92.80%), Postives = 325/347 (93.66%), Query Frame = 2
Query: 3296 KCIFTHESCC*RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSKTTCETQDIVTFSV 4336
            K IF + S   +  + TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIG             DFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRDGGKLDLDDLKIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSKTTCETQDIVTFSV
Sbjct: 1065 KSIFVNASLPMKVAVKTVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIG-------------DFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRDGGKLDLDDLKIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSKTTCETQDIVTFSV 1398          

HSP 3 Score: 214.157 bits (544), Expect = 1.135e-55
Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 3
Query: 3021 VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVK 3329
            VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVK
Sbjct:  978 VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVK 1080          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000041357.1 (SMESG000041357.1)

HSP 1 Score: 1907.11 bits (4939), Expect = 0.000e+0
Identity = 938/938 (100.00%), Postives = 938/938 (100.00%), Query Frame = 1
Query:  166 MDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETN 2979
            MDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMPSPPQIIESISSAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETN
Sbjct:    1 MDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFIHNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYWKNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISNHVFFTTSTEMPSPPQIIESISSAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETN 938          

HSP 2 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 322/347 (92.80%), Postives = 325/347 (93.66%), Query Frame = 2
Query: 3296 KCIFTHESCC*RYEL*TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSKTTCETQDIVTFSV 4336
            K IF + S   +  + TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIG             DFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRDGGKLDLDDLKIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSKTTCETQDIVTFSV
Sbjct: 1026 KSIFVNASLPMKVAVKTVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIG-------------DFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRDGGKLDLDDLKIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVCDVCCDQSKTTCETQDIVTFSV 1359          

HSP 3 Score: 213.772 bits (543), Expect = 1.173e-55
Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 3
Query: 3021 VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVK 3329
            VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVK
Sbjct:  939 VDVDYVLKITFSSTVFIMAVALISILIWYLAWKKNQRYILTRNNHYFLSGQDEWNIEFQDVKLLLPIGKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVK 1041          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000042173.1 (SMESG000042173.1)

HSP 1 Score: 300.442 bits (768), Expect = 2.118e-94
Identity = 278/1042 (26.68%), Postives = 473/1042 (45.39%), Query Frame = 1
Query:   31 ICFIFIMLNYYVIFILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECS----------KKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTP-------DPK-------FRILSGSVRFLANRNLCKTFIHNFIN---KIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEV--KSQCVRLYWKNKQTS-NYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNP-----QKQEELLEMTRFDTHMHSVILVQRK--KNNPNSLSS---------YNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMND------CSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFII---------RNPFSGTYEFQIMIRTLAGNGNWSPLESFEYK 2970
            I  IF ++N Y             ++  L   K+C+  I I   S  SL+    CT++EG + I  ++  + +   FP L+E+T  +++ +   +    L  FPNL +IRG  L    A+++      ++   +LR +  G V +  N +LC V  I+W  I        +    + +   +  C   C N CP     +   + CW +NTCQ++C   C+  + YC +N+ + CCH +CLGGCYG+ ++ CV+CK +     CV  C   +Y++K  RC+ + EC           ++        + CVK+C      + I G +  + GS  + KY   CG + + S  D  + + CYS E + IS++ GG  LS  L   F  L I++  ++I++S+ + SL FL  L  I+G +     N T + +  +I+ +++         D K         IL GSV F  NR LC   I +F+N   +   + S  D+ +I+ +NG +A C   +L + V+ +   S  V+ + K    S     L+ L   +  + N+      +S CS   W  +E        G   KP               I +L PA  Y  Y E  R   ++   IS+ ++ TT  + PS P  +++ + + +EIRL+W PPL PNG +T+YII+Y    +F + F  E  +  F +S++    ++  +N    TN+  Q Q  CD C  C ++C +N       K + +++    D ++    + Q +  K+N   + S         YN +++ +    T +P    +S + KP+      +EN ++   K +++PA+    + Y   TNL ++TEY  EI AC   Q+  +   + L K   +       CS+++  S  T    ++D I    +++ +N       + + W  P   NG IL Y + YR           +  C+      +  N+ AKNSS  + II         R+   G YEFQI    +A  G W+  +S+ +K
Sbjct:   13 ISLIFNIINLYQAITF-------TDSFKLSNEKVCQ-SIDIRKRSHVSLLT--NCTVIEGDLYIAMVT--LTSEYSFPTLKEITGSLVIYYVKGTKTLGL-YFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSI------VRQHGAPIKLINMRNFCLEFCPNNCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITG-RCEICGSECSKKY---CGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNS-CSEQNWRTVE--------GYIGKPVV-------------IDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFME--DVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECD-CDKCMESCNKNQILINIDKDDTIMQF--LDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYN-QTVRVDEVVTNLPA-TDISTISKPS------IENLTNHFKKMVQVPAN----ETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNI----NESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWT--KSYHFK 983          

HSP 2 Score: 49.6766 bits (117), Expect = 2.118e-94
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 3
Query: 3078 VALISILIWYLAWK--KNQRYILTRNNHYFLSGQDEWNIEFQDVKLL---LPIGKGNFGVVYSGELKKLESPAKSIFVNA--SLPMKVAVKDMN 3338
             AL  ++ +Y   K  +  R++ +  +++ +   D W I+ +DV +L    P+G+G+FG+VY G LK L +PA+  ++       M VAVK +N
Sbjct: 1009 CALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLN 1102          

HSP 3 Score: 39.2762 bits (90), Expect = 2.118e-94
Identity = 17/37 (45.95%), Postives = 26/37 (70.27%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYA 3454
            T++  +TI +  +F++EAC MKQF  YH+V L GI +
Sbjct: 1100 TLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVS 1136          

HSP 4 Score: 68.9366 bits (167), Expect = 2.855e-11
Identity = 35/71 (49.30%), Postives = 45/71 (63.38%), Query Frame = 2
Query: 3440 IGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHR 3652
             G +   I ++    PLV+MELME GDL+ YL +  E  + G +   QS LWAIQIADGM YL+  +FVHR
Sbjct: 1201 FGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGE-GFVSENQSHLWAIQIADGMLYLSEMKFVHR 1270          

HSP 5 Score: 62.3882 bits (150), Expect = 3.017e-9
Identity = 38/94 (40.43%), Postives = 52/94 (55.32%), Query Frame = 2
Query: 3878 SYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSS-LLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEF 4156
            SYGV+L+EI TL SLPY GMSH  VI++V  GG L        S  LL +M  CW +   DRP+F  I++ L  Y +  F     ++    ++F
Sbjct: 1271 SYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDF 1364          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000042173.1 (SMESG000042173.1)

HSP 1 Score: 300.442 bits (768), Expect = 2.715e-94
Identity = 278/1042 (26.68%), Postives = 473/1042 (45.39%), Query Frame = 1
Query:   31 ICFIFIMLNYYVIFILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECS----------KKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTP-------DPK-------FRILSGSVRFLANRNLCKTFIHNFIN---KIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEV--KSQCVRLYWKNKQTS-NYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNP-----QKQEELLEMTRFDTHMHSVILVQRK--KNNPNSLSS---------YNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMND------CSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFII---------RNPFSGTYEFQIMIRTLAGNGNWSPLESFEYK 2970
            I  IF ++N Y             ++  L   K+C+  I I   S  SL+    CT++EG + I  ++  + +   FP L+E+T  +++ +   +    L  FPNL +IRG  L    A+++      ++   +LR +  G V +  N +LC V  I+W  I        +    + +   +  C   C N CP     +   + CW +NTCQ++C   C+  + YC +N+ + CCH +CLGGCYG+ ++ CV+CK +     CV  C   +Y++K  RC+ + EC           ++        + CVK+C      + I G +  + GS  + KY   CG + + S  D  + + CYS E + IS++ GG  LS  L   F  L I++  ++I++S+ + SL FL  L  I+G +     N T + +  +I+ +++         D K         IL GSV F  NR LC   I +F+N   +   + S  D+ +I+ +NG +A C   +L + V+ +   S  V+ + K    S     L+ L   +  + N+      +S CS   W  +E        G   KP               I +L PA  Y  Y E  R   ++   IS+ ++ TT  + PS P  +++ + + +EIRL+W PPL PNG +T+YII+Y    +F + F  E  +  F +S++    ++  +N    TN+  Q Q  CD C  C ++C +N       K + +++    D ++    + Q +  K+N   + S         YN +++ +    T +P    +S + KP+      +EN ++   K +++PA+    + Y   TNL ++TEY  EI AC   Q+  +   + L K   +       CS+++  S  T    ++D I    +++ +N       + + W  P   NG IL Y + YR           +  C+      +  N+ AKNSS  + II         R+   G YEFQI    +A  G W+  +S+ +K
Sbjct:   13 ISLIFNIINLYQAITF-------TDSFKLSNEKVCQ-SIDIRKRSHVSLLT--NCTVIEGDLYIAMVT--LTSEYSFPTLKEITGSLVIYYVKGTKTLGL-YFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSI------VRQHGAPIKLINMRNFCLEFCPNNCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITG-RCEICGSECSKKY---CGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNS-CSEQNWRTVE--------GYIGKPVV-------------IDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFME--DVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECD-CDKCMESCNKNQILINIDKDDTIMQF--LDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYN-QTVRVDEVVTNLPA-TDISTISKPS------IENLTNHFKKMVQVPAN----ETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNI----NESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWT--KSYHFK 983          

HSP 2 Score: 49.6766 bits (117), Expect = 2.715e-94
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 3
Query: 3078 VALISILIWYLAWK--KNQRYILTRNNHYFLSGQDEWNIEFQDVKLL---LPIGKGNFGVVYSGELKKLESPAKSIFVNA--SLPMKVAVKDMN 3338
             AL  ++ +Y   K  +  R++ +  +++ +   D W I+ +DV +L    P+G+G+FG+VY G LK L +PA+  ++       M VAVK +N
Sbjct: 1009 CALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLN 1102          

HSP 3 Score: 38.891 bits (89), Expect = 2.715e-94
Identity = 17/37 (45.95%), Postives = 26/37 (70.27%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYA 3454
            T++  +TI +  +F++EAC MKQF  YH+V L GI +
Sbjct: 1100 TLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVS 1136          

HSP 4 Score: 177.178 bits (448), Expect = 2.735e-44
Identity = 87/174 (50.00%), Postives = 115/174 (66.09%), Query Frame = 2
Query: 3443 GIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFV 3964
            G +   I ++    PLV+MELME GDL+ YL +  E  + G +   QS LWAIQIADGM YL+  +FVHRDLAARNC++++ L IKIG             DFG+ + +  + YYRK  + + PVRWMAPESL S  ++  +D+WSYGV+L+EI TL SLPY GMSH  VI++V
Sbjct: 1202 GSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGE-GFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIG-------------DFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYV 1361          
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Match: SMESG000042173.1 (SMESG000042173.1)

HSP 1 Score: 300.442 bits (768), Expect = 2.736e-94
Identity = 278/1042 (26.68%), Postives = 473/1042 (45.39%), Query Frame = 1
Query:   31 ICFIFIMLNYYVIFILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECS----------KKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQGQAFIGQTNVTLDITANNILSKLWTP-------DPK-------FRILSGSVRFLANRNLCKTFIHNFIN---KIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEV--KSQCVRLYWKNKQTS-NYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMXXXXXXXXXXXXAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNP-----QKQEELLEMTRFDTHMHSVILVQRK--KNNPNSLSS---------YNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMND------CSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFII---------RNPFSGTYEFQIMIRTLAGNGNWSPLESFEYK 2970
            I  IF ++N Y             ++  L   K+C+  I I   S  SL+    CT++EG + I  ++  + +   FP L+E+T  +++ +   +    L  FPNL +IRG  L    A+++      ++   +LR +  G V +  N +LC V  I+W  I        +    + +   +  C   C N CP     +   + CW +NTCQ++C   C+  + YC +N+ + CCH +CLGGCYG+ ++ CV+CK +     CV  C   +Y++K  RC+ + EC           ++        + CVK+C      + I G +  + GS  + KY   CG + + S  D  + + CYS E + IS++ GG  LS  L   F  L I++  ++I++S+ + SL FL  L  I+G +     N T + +  +I+ +++         D K         IL GSV F  NR LC   I +F+N   +   + S  D+ +I+ +NG +A C   +L + V+ +   S  V+ + K    S     L+ L   +  + N+      +S CS   W  +E        G   KP               I +L PA  Y  Y E  R   ++   IS+ ++ TT  + PS P  +++ + + +EIRL+W PPL PNG +T+YII+Y    +F + F  E  +  F +S++    ++  +N    TN+  Q Q  CD C  C ++C +N       K + +++    D ++    + Q +  K+N   + S         YN +++ +    T +P    +S + KP+      +EN ++   K +++PA+    + Y   TNL ++TEY  EI AC   Q+  +   + L K   +       CS+++  S  T    ++D I    +++ +N       + + W  P   NG IL Y + YR           +  C+      +  N+ AKNSS  + II         R+   G YEFQI    +A  G W+  +S+ +K
Sbjct:   13 ISLIFNIINLYQAITF-------TDSFKLSNEKVCQ-SIDIRKRSHVSLLT--NCTVIEGDLYIAMVT--LTSEYSFPTLKEITGSLVIYYVKGTKTLGL-YFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSI------VRQHGAPIKLINMRNFCLEFCPNNCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITG-RCEICGSECSKKY---CGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNS-CSEQNWRTVE--------GYIGKPVV-------------IDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFME--DVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECD-CDKCMESCNKNQILINIDKDDTIMQF--LDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYN-QTVRVDEVVTNLPA-TDISTISKPS------IENLTNHFKKMVQVPAN----ETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNI----NESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWT--KSYHFK 983          

HSP 2 Score: 49.6766 bits (117), Expect = 2.736e-94
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 3
Query: 3078 VALISILIWYLAWK--KNQRYILTRNNHYFLSGQDEWNIEFQDVKLL---LPIGKGNFGVVYSGELKKLESPAKSIFVNA--SLPMKVAVKDMN 3338
             AL  ++ +Y   K  +  R++ +  +++ +   D W I+ +DV +L    P+G+G+FG+VY G LK L +PA+  ++       M VAVK +N
Sbjct: 1009 CALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLN 1102          

HSP 3 Score: 38.891 bits (89), Expect = 2.736e-94
Identity = 17/37 (45.95%), Postives = 26/37 (70.27%), Query Frame = 2
Query: 3344 TVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIGIYA 3454
            T++  +TI +  +F++EAC MKQF  YH+V L GI +
Sbjct: 1100 TLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVS 1136          

HSP 4 Score: 194.897 bits (494), Expect = 9.722e-50
Identity = 105/239 (43.93%), Postives = 143/239 (59.83%), Query Frame = 2
Query: 3443 GIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGGCKFIHFNI*VSLDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRXXXXXXXXXXXIPSS-LLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQVSFYHNGCSEF 4156
            G +   I ++    PLV+MELME GDL+ YL +  E  + G +   QS LWAIQIADGM YL+  +FVHRDLAARNC++++ L IKIG             DFG+ + +  + YYRK  + + PVRWMAPESL S  ++  +D+WSYGV+L+EI TL SLPY GMSH  VI++V  GG L        S  LL +M  CW +   DRP+F  I++ L  Y +  F     ++    ++F
Sbjct: 1202 GSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGE-GFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIG-------------DFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDF 1426          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
INSRR3.611e-11123.65insulin receptor related receptor [Source:HGNC Sym... [more]
INSR2.030e-6726.43insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091... [more]
INSR1.879e-6526.32insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091... [more]
IGF1R1.070e-5624.59insulin like growth factor 1 receptor [Source:HGNC... [more]
IGF1R9.590e-5424.59insulin like growth factor 1 receptor [Source:HGNC... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daf-28.973e-4522.18Insulin-like receptor Insulin-like receptor subuni... [more]
daf-28.973e-4522.18Insulin-like receptor Insulin-like receptor subuni... [more]
daf-21.105e-4422.18Insulin-like receptor Insulin-like receptor subuni... [more]
daf-21.239e-4422.18Insulin-like receptor Insulin-like receptor subuni... [more]
daf-24.899e-4336.50Insulin-like receptor Insulin-like receptor subuni... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
InR1.357e-10843.62gene:FBgn0283499 transcript:FBtr0290232[more]
InR1.357e-10843.62gene:FBgn0283499 transcript:FBtr0290230[more]
InR1.357e-10843.62gene:FBgn0283499 transcript:FBtr0084121[more]
InR1.357e-10843.62gene:FBgn0283499 transcript:FBtr0290231[more]
Alk1.374e-3835.46gene:FBgn0040505 transcript:FBtr0087118[more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insrb2.951e-7027.39insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-02050... [more]
insra8.528e-6225.16insulin receptor a [Source:ZFIN;Acc:ZDB-GENE-02050... [more]
igf1ra2.124e-6024.17insulin-like growth factor 1a receptor [Source:ZFI... [more]
igf1ra2.845e-6024.17insulin-like growth factor 1a receptor [Source:ZFI... [more]
igf1rb1.205e-5824.02insulin-like growth factor 1b receptor [Source:ZFI... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
INSRR1.783e-12725.00insulin receptor related receptor [Source:NCBI gen... [more]
INSRR3.001e-12424.79insulin receptor related receptor [Source:NCBI gen... [more]
INSR9.606e-6926.30insulin receptor [Source:NCBI gene;Acc:100492718][more]
INSR3.885e-6725.62insulin receptor [Source:NCBI gene;Acc:100492718][more]
INSR1.117e-6425.59insulin receptor [Source:NCBI gene;Acc:100492718][more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Insrr1.809e-11424.10insulin receptor-related receptor [Source:MGI Symb... [more]
Insrr1.809e-11424.10insulin receptor-related receptor [Source:MGI Symb... [more]
Insr3.199e-6526.33insulin receptor [Source:MGI Symbol;Acc:MGI:96575][more]
Igf1r2.584e-5624.28insulin-like growth factor I receptor [Source:MGI ... [more]
Axl3.781e-3836.89AXL receptor tyrosine kinase [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O73798|IGF1R_XENLA1.347e-12125.80Insulin-like growth factor 1 receptor OS=Xenopus l... [more]
sp|Q9WTL4|INSRR_MOUSE1.106e-11324.10Insulin receptor-related protein OS=Mus musculus O... [more]
sp|Q64716|INSRR_RAT1.211e-11323.83Insulin receptor-related protein OS=Rattus norvegi... [more]
sp|P14616|INSRR_HUMAN1.608e-11023.65Insulin receptor-related protein OS=Homo sapiens O... [more]
sp|P09208|INSR_DROME1.041e-10743.62Insulin-like receptor OS=Drosophila melanogaster O... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZZ126.913e-14127.65Tyrosine-protein kinase receptor (Fragment) OS=Lot... [more]
R4IS902.183e-13628.22Tyrosine-protein kinase receptor OS=Pinctada fucat... [more]
Q86LZ84.517e-12924.43Receptor protein-tyrosine kinase OS=Schistosoma ma... [more]
A0A0C4UQS41.172e-12827.22Tyrosine-protein kinase receptor OS=Nilaparvata lu... [more]
A0A5K4F9S51.350e-12824.13Receptor protein-tyrosine kinase OS=Schistosoma ma... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insra3.446e-12226.21insulin receptor [Source:NCBI gene;Acc:103039445][more]
igf1ra7.543e-11923.74insulin-like growth factor 1 receptor [Source:NCBI... [more]
igf1ra1.278e-11323.74insulin-like growth factor 1 receptor [Source:NCBI... [more]
insra3.598e-6326.19insulin receptor [Source:NCBI gene;Acc:103039445][more]
insrb4.160e-6226.36insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-02050... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009481.11.659e-5943.12pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
ENSPMAT00000009485.13.393e-5941.14pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
INSR4.200e-4323.97insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091... [more]
ENSPMAT00000009736.11.418e-4136.44pep scaffold:Pmarinus_7.0:GL479388:5844:12989:-1 g... [more]
ENSPMAT00000001705.15.094e-4037.60pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE112.752e-1229.10Signal transducing MEK kinase; involved in pheromo... [more]
CDC154.968e-1225.31Protein kinase of the Mitotic Exit Network; locali... [more]
KIC19.725e-1230.50Protein kinase of the PAK/Ste20 family, required f... [more]
CLA41.002e-1028.57Cdc42p-activated signal transducing kinase; member... [more]
CDC51.927e-923.72Polo-like kinase; controls targeting and activatio... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476521.009e-6745.19Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO491264.659e-3637.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340873.100e-3543.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442691.142e-3433.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355944.470e-3434.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insra3.582e-12625.91insulin receptor [Source:NCBI gene;Acc:101166254][more]
igf1rb6.330e-11723.40insulin-like growth factor 1 receptor [Source:NCBI... [more]
igf1rb6.330e-11723.40insulin-like growth factor 1 receptor [Source:NCBI... [more]
igf1rb5.464e-11523.48insulin-like growth factor 1 receptor [Source:NCBI... [more]
igf1rb6.889e-11523.33insulin-like growth factor 1 receptor [Source:NCBI... [more]
back to top
BLAST of Tyrosine-protein kinase receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041357.11.135e-55100.00SMESG000041357.1[more]
SMESG000041357.11.173e-55100.00SMESG000041357.1[more]
SMESG000042173.12.118e-9426.68SMESG000042173.1[more]
SMESG000042173.12.715e-9426.68SMESG000042173.1[more]
SMESG000042173.12.736e-9426.68SMESG000042173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009509 ID=SMED30009509|Name=Tyrosine-protein kinase receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=4604bp
AATATAAATTTTAATTTATAAGTTAAAAGTATTTGTTTCATTTTTATTAT
GCTAAATTATTATGTTATATTTATTTTATATTTATTATGTAACGTTAATT
GTGAAAATGTAACTTTATATAAAAGAAAAATTTGTAAATTCGATATTAGA
ATACCTGGTATTTCGATGGACTCTTTGATTAAGGCTAAAGAATGTACAAT
TGTCGAAGGTAAAGTTGTCATAACACATTTGAGCAAACATATGTGCAACT
CTCTCCGGTTTCCAGTCTTAAGAGAAGTTACAGATTATATATTATTAGCC
TTTTCATCTTGCAGCGATGATACCTCTTTAAACATTTTCCCGAATTTAAT
GGTTATTAGGGGTTACGAGTTGTTACAAGGATGTGCCCTTATAGTGTATT
ATAATGCTTGGCGACATTTGAATTTTACTAGTTTACGGTCAATTGCTAGC
GGTAATGTTTTAGTGGCTCTAAACTCAAATTTGTGCAACGTTGGAAATAT
CGATTGGAAATATATAAACGACAATAGAGATGAAGCAAGTAAAAGTACCA
AAAAATTATACATTAAAACAAACAAATTTATATGCTCAAATTCCTGTTCT
AATATGTGCCCGGAAAGGACAATTGATGATCAGAAAACTCGAGTATGCTG
GTCGTACAATACTTGCCAATCTATTTGCGATTCTATCTGTTCATCTAAAG
ATCTTTATTGTCACGTTAATAACACTTCAATTTGTTGTCACAAACAGTGT
TTGGGAGGTTGTTATGGCAAAACGAATAAGGATTGTGTCGCTTGTAAAAA
ATTACGATATAAAGAAGAATGTGTATTATCTTGTCCGGTGGGATATTACG
AGTTCAAAGGCTCTCGCTGTGTGCATAAAATTGAATGTTCGAAAAAAAAT
ATGTCAATAACATTCAATCCTAATAGATGTGTAAAAGAGTGTCCATCTGA
TCTTTTTGCCTCTTTTATAAATGGAACCAAATATTGTGTGAACGGGTCTA
CAATTACTACAAAGTATAACAAAGAATGTGGTCTCTTATTTCTAAAATCC
TTCAAAGATCTTGATCAAGTCAAAAATTGTTATTCGGCTGAAAGAGTTAT
TATTAGCTTACAAATAGGTGGACGAGATTTGTCACTAAAATTGAGAGATG
TATTCAAAAATCTCAGAATCGTGAAACAGTTCATACAAATTATGCGATCG
AATTTTTTAGAATCTCTTACATTTTTAAATCCTCTTTTGGAAATACAGGG
CCAAGCATTTATTGGTCAGACGAATGTAACGTTAGATATAACAGCAAATA
ATATTCTATCAAAGTTATGGACTCCTGATCCAAAATTTCGAATTTTATCT
GGCTCTGTAAGATTTCTTGCGAATAGAAATCTTTGCAAAACATTTATTCA
TAATTTCATTAATAAAATTGGACTACAGAATTCATTATTCGACAAAGAAT
TAATAGATTCTACGAATGGGCATATTGCTATATGTACTTTTATTCAATTA
AATTTAACTGTAGTGGAAGTTAAGTCTCAGTGTGTTCGTCTTTACTGGAA
AAATAAACAAACTTCCAATTATCAAATATTAAGTGGTCTCACATATTATC
GATCTATTTCAACTAATATGAAAAATGGAGGCTTTTCTGACAGCGGGTGC
TCTTCTGTCATATGGTCAGTAATCGAAGCCCAATGTAAAAATAATGATTC
CGGGGTAAAATTAAAGCCAACCTCATTATGGCCTCAAGATGGAGGAGAAG
AATTTATATGTGAAATTTCGTCTTTGAAACCTGCAACGAGCTACCAAGTT
TACCTAGAATTTCGTTTCACTAGACAAGATTCAGCGGCCATTAGCAATCA
TGTTTTCTTTACTACATCTACTGAAATGCCATCACCACCACAAATAATCG
AATCTATTTCATCGGCTCATAATGAAATCCGTTTATCATGGAAGCCACCT
CTTCATCCTAATGGTTTAATAACAAAATATATAATATATTATTGGAAAAA
TGCATTATTTGAGAACTCGTTCAATAACGAATATTCGAATAAAGATTTTT
GTCAATCAGAAACGAATACTGGATTTAAAACTAGTCAATCGAATTTTGAG
AAAGCAACGAATGATAACTTTCAGCCACAAGCAATGTGTGACACATGTTC
TATTTGCAAAAAAACTTGTGAGCGAAATCCACAAAAACAAGAAGAACTCC
TGGAAATGACGCGATTTGATACTCACATGCATTCAGTTATTCTTGTTCAA
AGAAAAAAGAATAATCCCAATTCTCTGTCATCTTATAATTCAAAATCAAT
AGCCATTCCTAATAACTTCACGACTATGCCACTCAATGCAACCGTTTCTG
TGGTTCATAAACCAACTCCAAAGTCTAACATTCCTATGGAGAATACATCA
TCGATAAACGTTAAGCAAATCGAAATACCAGCTTCAGCATTAAAAACTCA
ATATTATCACGTTATAACAAATTTAGATTACTTTACCGAATATTTAATTG
AAATAGTCGCTTGCCACCAAAGGCAAAGTAATTTCAACTATTCTCAACAA
ATACTGATGAAATTTTCTATGAACGATTGTAGCAATCGAGCTAGCACAAG
CACAAGAACTGAACGCAGTCCAGATGTTGATGTTATCCCACCTATATATG
ACAAAACATATATGAATATTACTGGAATTAATAAAGAAATTACTGTTACT
TGGAAGATTCCTCCTAAAGTTAATGGATTAATTCTCTTTTATCAATTAAA
TTACCGCATTAAAAAGGATAATGTGATCTTTCAAGCATGGACACCTAATT
GTATTAACTCTAAATCAATCACATCTATTAAAAATCTTCATGCTAAGAAT
TCCAGTTATCAAAGTTTTATTATTCGTAATCCGTTTTCTGGAACGTATGA
GTTTCAAATTATGATACGTACTTTAGCCGGAAATGGAAACTGGTCACCCC
TGGAATCGTTTGAATACAAAGAAACTAACGGTATTTTATAGCATCTGCTT
ATTTCAATTATCTTTTTCCAGTTGATGTTGATTACGTACTAAAAATCACA
TTTAGCTCTACGGTTTTCATAATGGCCGTTGCGTTGATATCGATTTTAAT
ATGGTATTTAGCTTGGAAAAAAAACCAGCGGTATATATTAACTAGAAATA
ATCACTATTTCCTCAGTGGGCAAGATGAATGGAATATTGAATTTCAAGAT
GTTAAATTGCTCCTTCCTATTGGAAAGGGAAATTTCGGTGTAGTTTATAG
TGGTGAATTAAAGAAATTAGAATCTCCTGCAAAATCAATCTTTGTAAATG
CATCTTTACCCATGAAAGTTGCTGTTAAAGATATGAATTATAGACTGTCT
CTCAAGCTGCAACCATCGAGGACATAGTACAATTTCTTTCAGAAGCATGT
TTAATGAAACAGTTTCTCGGATACCACATTGTGCATTTAATAGGAATATA
TGCGGGTAATATCCAAAAGAATAGTTCCCTATATCCATTGGTTGTAATGG
AATTGATGGAAAATGGGGATTTATCAAATTATCTACATCAGTATGCCGAA
CGCAGTGACAAAGGAATGATTGACGGTAAACAAAGTCTTTTGTGGGCAAT
ACAGATTGCTGATGGAATGTGCTACTTGGCATGCAAAAGGTTTGTTCATC
GTGATCTTGCAGCAAGAAACTGTTTAGTTGATGCTGATCTTAATATTAAA
ATTGGAGGTTGTAAATTTATTCATTTCAATATATAAGTCTCATTAGACTT
TGGATTGACAAAATCAATAAATGAAAATGATTATTATCGCAAAAGAGGAC
GTGCAAAAGCCCCTGTTAGATGGATGGCTCCAGAATCTCTCCGGTCGGCA
GTTTATACTACAAAAACAGATGTATGGTCTTATGGAGTAGTTTTATACGA
AATATCAACTCTTGGTAGTCTCCCGTATTCTGGAATGAGTCATGAAAGTG
TCATAGAATTTGTTCGTGACGGTGGTAAACTTGATTTAGATGATCTTAAA
ATCCCATCATCCCTGCTTGATGTCATGACTTGGTGTTGGTCATTCTATGA
CACAGACCGACCGACCTTCATGAGAATTCTGGAATATCTCGTTCCATATG
TCAACAATGAATTCTTTAAACAAGTTTCATTTTACCACAATGGATGTTCT
GAATTTGATCAATGTTATACTTGTACAAAGATGAACTGTGTTGATAATTC
AATTTTACTGCCGGAATTGCAGGTTTGCAAGCATATTTATAAATGCAATT
GCTCTAATTCATTATCGGTGTGTGACGTATGCTGCGATCAGTCAAAAACA
ACATGTGAAACTCAAGATATTGTCACTTTCAGTGTTAACGATTTACTGCA
GCAACAATATAATAATAATAATAATCACAATGACAATCTTAATGATAATA
TCTGAAATTGTCTCGCTTTCTTCTCAAAACTAAAATGGGTTTTATTTAAA
AGTGCTGAAATGGTTGAGAAACTTTTCCTGTTTATTTTCGTTTTGTTTTT
AAATTATTTAAATAATTTTTGTTTTATTGGAAAGAAATGTGTCAACGCGT
CTTCTGATTATAATGAACTTTTATGTTTGTATATATTTATTTCTATGATA
ATTA
back to top

protein sequence of SMED30009509-orf-1

>SMED30009509-orf-1 ID=SMED30009509-orf-1|Name=SMED30009509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MAVALISILIWYLAWKKNQRYILTRNNHYFLSGQDEWNIEFQDVKLLLPI
GKGNFGVVYSGELKKLESPAKSIFVNASLPMKVAVKDMNYRLSLKLQPSR
T*
back to top

protein sequence of SMED30009509-orf-2

>SMED30009509-orf-2 ID=SMED30009509-orf-2|Name=SMED30009509-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRDG
GKLDLDDLKIPSSLLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEFFKQ
VSFYHNGCSEFDQCYTCTKMNCVDNSILLPELQVCKHIYKCNCSNSLSVC
DVCCDQSKTTCETQDIVTFSVNDLLQQQYNNNNNHNDNLNDNI*
back to top

protein sequence of SMED30009509-orf-3

>SMED30009509-orf-3 ID=SMED30009509-orf-3|Name=SMED30009509-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=981bp
MLNYYVIFILYLLCNVNCENVTLYKRKICKFDIRIPGISMDSLIKAKECT
IVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNL
MVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGN
IDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVC
WSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACK
KLRYKEECVLSCPVGYYEFKGSRCVHKIECSKKNMSITFNPNRCVKECPS
DLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERV
IISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEIQ
GQAFIGQTNVTLDITANNILSKLWTPDPKFRILSGSVRFLANRNLCKTFI
HNFINKIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEVKSQCVRLYW
KNKQTSNYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNND
SGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLEFRFTRQDSAAISN
HVFFTTSTEMPSPPQIIESISSAHNEIRLSWKPPLHPNGLITKYIIYYWK
NALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTC
SICKKTCERNPQKQEELLEMTRFDTHMHSVILVQRKKNNPNSLSSYNSKS
IAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKT
QYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMNDCSNRAST
STRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQL
NYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQSFIIRNPFSGTY
EFQIMIRTLAGNGNWSPLESFEYKETNGIL*
back to top

protein sequence of SMED30009509-orf-4

>SMED30009509-orf-4 ID=SMED30009509-orf-4|Name=SMED30009509-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MKQFLGYHIVHLIGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAER
SDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKI
GGCKFIHFNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036941Rcpt_L-dom_sf
IPR036116FN3_sf
IPR009030Growth_fac_rcpt_cys_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
IPR003961FN3_dom
IPR006212Furin_repeat
IPR006211Furin-like_Cys-rich_dom
IPR013783Ig-like_fold
IPR000494Rcpt_L-dom
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0005515protein binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 479..595
e-value: 41.0
score: 6.1
coord: 862..963
e-value: 30.0
score: 7.3
coord: 611..827
e-value: 4.2E-5
score: 33.0
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 865..976
score: 9.263
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 610..709
score: 10.699
IPR003961Fibronectin type IIICDDcd00063FN3coord: 611..650
e-value: 4.29169E-8
score: 49.8023
IPR003961Fibronectin type IIICDDcd00063FN3coord: 880..971
e-value: 1.01446E-5
score: 42.8687
IPR006212Furin-like repeatSMARTSM00261furin_3coord: 226..268
e-value: 1.3E-9
score: 47.9
IPR006212Furin-like repeatCDDcd00064FUcoord: 229..275
e-value: 6.15907E-8
score: 47.8988
IPR000494Receptor L-domainPFAMPF01030Recep_L_domaincoord: 48..156
e-value: 9.6E-17
score: 61.1
coord: 354..450
e-value: 1.5E-8
score: 34.7
IPR006211Furin-like cysteine-rich domainPFAMPF00757Furin-likecoord: 181..317
e-value: 2.2E-21
score: 76.3
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 257..324
e-value: 3.2E-6
score: 29.3
NoneNo IPR availablePANTHERPTHR24416:SF106INSULIN-LIKE GROWTH FACTOR 1 RECEPTORcoord: 20..734
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 20..734
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.714
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 324..480
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 27..239
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 24..256
e-value: 1.0E-48
score: 167.7
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 325..480
e-value: 1.3E-20
score: 75.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 870..978
e-value: 1.8E-11
score: 46.1
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 230..310
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 801..972
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 484..824