Phosphatidylinositol 4-kinase alpha

Overview
NamePhosphatidylinositol 4-kinase alpha
Smed IDSMED30009508
Length (bp)6928
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol 4-kinase alpha (SMED30009508) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol 4-kinase alpha (SMED30009508) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol 4-kinase alpha (SMED30009508) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol 4-kinase alpha (SMED30009508) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009508

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009508SMESG000072628.1 SMESG000070312.1 SMESG000053741.1 SMESG000053027.1 SMESG000049171.1 SMESG000012168.1 SMESG000003338.1 SMESG000001039.1 SMESG000076404.1 SMESG000042804.1 SMESG000016739.1 Contig3856GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009508SMESG000041715.1 Contig3856GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30009508SMESG000041715.1 dd_Smed_v4_7201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009508SMESG000041715.1 dd_Smed_v4_7201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30009508SMESG000041715.1 SMED30009508smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30009508SMESG000041715.1 dd_Smed_v4_7201_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Human
Match: PI4KA (phosphatidylinositol 4-kinase alpha [Source:HGNC Symbol;Acc:HGNC:8983])

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 691/1501 (46.04%), Postives = 952/1501 (63.42%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY+KQ+    A      TQLS+ +P+  +K D S+FMA+LNLR+RY GE+ GM+        M D  +N +                 +DL   L + +         ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K    + F+ EM  AW  T++ K G+F+ +++E  PL   E  + KP      PH IW  FL +R  +A+  S  QVEI S L+ RS+S         +++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LP+RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  L+ ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D+E++ + Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V+++C    R+ TYD IQY+QN IPY
Sbjct:  699 DHGYRHCSLAVINALANIAANIQDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGA------TQLSE-RPA-CVKKDYSNFMASLNLRNRYAGEVYGMIRFSGTTGQMSD--LNKM---------------MVQDLHSALDRSHP---QHYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKDGVEVPFMREMAGAWHMTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------TVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLDQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRS----DSEDECSTQEA----------------------------DGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDIPY 2102          

HSP 2 Score: 125.946 bits (315), Expect = 6.394e-28
Identity = 113/414 (27.29%), Postives = 199/414 (48.07%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + +N +    Y S+S PL L +  +LRD +   Y K          S +KE+      +      EL K           L+    +H+    +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      N IK+   N    ++    + ++ Q        ++E++RD AI ++CR L    T DP  ++ FLA LS R + + ESD+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  329 LRELLNLVKKIVEEAVLKSLDAIVASVMEANPSADLYYTSFSDPLYLTMFKMLRDTLY--YMK------DLPTSFVKEIHDFVLEQFNTSQGELQKI----------LHDADRIHNELSPLKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGNDIKISVTNEHSESTLNVMSGKKSQ------PSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 703          

HSP 3 Score: 53.9138 bits (128), Expect = 4.724e-6
Identity = 29/79 (36.71%), Postives = 49/79 (62.03%), Query Frame = 3
Query:   66 LKLARALIYSNEEDI--VKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIV 296
            L LAR+L       +  V+K +C CP  +  G F L+ + + A++++GI+L+ES+L+ K+ ++PYLL + K L K   V
Sbjct:   36 LSLARSLAVQRPASLEKVQKLLCMCPV-DFHGIFQLDERRRDAVIALGIFLIESDLQHKDCVVPYLLRLLKGLPKVYWV 113          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Human
Match: PI4KA (phosphatidylinositol 4-kinase alpha [Source:HGNC Symbol;Acc:HGNC:8983])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 279/469 (59.49%), Postives = 353/469 (75.27%), Query Frame = 1
Query: 5383 MGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            MGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  L+ ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D+E++ + Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE   +  +AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V+++C    R+ TYD IQY+QN IPY
Sbjct:    1 MGYVREYILWAASKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLDQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRS----DSEDECSTQEA----------------------------DGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDEALSA--QARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDIPY 435          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Human
Match: PI4KB (phosphatidylinositol 4-kinase beta [Source:HGNC Symbol;Acc:HGNC:8984])

HSP 1 Score: 194.897 bits (494), Expect = 1.847e-52
Identity = 106/258 (41.09%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G  TT ++  A+RNFV S A Y +VCYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG +D   F +++ L +Q  +  R + + +V +V +M   S LPCF G  TI+ L++RF   M++ +      +++           YD  QY  N I
Sbjct:  228 SVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSP-RNLGFETSAFKLTTEFVDVMGG-LDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGI 483          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Human
Match: PI4KB (phosphatidylinositol 4-kinase beta [Source:HGNC Symbol;Acc:HGNC:8984])

HSP 1 Score: 195.282 bits (495), Expect = 2.468e-50
Identity = 106/258 (41.09%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G  TT ++  A+RNFV S A Y +VCYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG +D   F +++ L +Q  +  R + + +V +V +M   S LPCF G  TI+ L++RF   M++ +      +++           YD  QY  N I
Sbjct:  545 SVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSP-RNLGFETSAFKLTTEFVDVMGG-LDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGI 800          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Human
Match: PI4KB (phosphatidylinositol 4-kinase beta [Source:HGNC Symbol;Acc:HGNC:8984])

HSP 1 Score: 195.282 bits (495), Expect = 2.468e-50
Identity = 106/258 (41.09%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G  TT ++  A+RNFV S A Y +VCYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG +D   F +++ L +Q  +  R + + +V +V +M   S LPCF G  TI+ L++RF   M++ +      +++           YD  QY  N I
Sbjct:  545 SVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSP-RNLGFETSAFKLTTEFVDVMGG-LDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGI 800          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Celegans
Match: Y75B8A.24 (pep chromosome:WBcel235:III:12251494:12273692:-1 gene:WBGene00013557.1 transcript:Y75B8A.24.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y75B8A.24)

HSP 1 Score: 994.571 bits (2570), Expect = 0.000e+0
Identity = 579/1544 (37.50%), Postives = 875/1544 (56.67%), Query Frame = 1
Query: 2359 HLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRN----VKTNIKNSI-AGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLE-RERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPR-TNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGML--------DAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX---------------------------XXXXXXXXXAIGVRFRMLSMGLSILQHMNENSIC-----KSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGY--SGAASIASTKKSTLGGK--RSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCP---------GLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFS-RMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAAS-----STEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            H+S +V      +AA +  ++    LL RLLE +V L +E RR      K+ +K S  AGNLG ++P IA +L+R+  I E + +L  LFRDFW Y  ++GF    + LWP EWY  VCE ATK+P+L+ TE L+SEL  N+A+ S++++  EL +M+  ++  +    E  PL+ + +     +L+SV+R+E++ + H+N  +A    FKYIED  + KDK G+WTC+     +IF  + ++M     N E  E  +  HAQFLL KFNH  + VR +AD  L+ + KAFP+++W+  VL T+L + Q L   L+ D     P + +     + + + DS + R  ++ DF    K IL+  ++W P    S+L++Y+ K       FG     A+      TS G  K                            S S++ +L  RS YLG+++GML        D     N +IDRL  D ++ C   +D+                        ++ ++  + AL V S   ++ ++L  L   PL++FT   +      W WLL+A+ +A  +FL E   A+  +    +G+F ++V   SPL   +  +  P   N  PH+ W +F+ ER  VA  SS +Q+++L  +  ++LS                             + +++   A+GVRFR+LS  L ++Q       C       ++R+++Y+  F YF+  P+   Q     ++DI  + +F+  ++++K Y+ + + ++    +     +S   +  N+     S L +   + A + GT ++ L     P ST   N    S   S+A+T  S   GK   + L+  +D   + ++K+RN++++L+A EI+RLS W +    A+ +C            +  +    EK I    WRE A+LAW +SPELA+ LPSRF+GS +L + ++ LV+  PE V HIPEAL       +   +  ++ +V TW   +PV+ALS  + R+YP HP++ QYAV+VL  Y  D L+ Y+PQ+VQ +RYD MGY++E ++ +   S +L+HQLIWNM+TNM+ DE+ ++KDP +   L  I+++I     G +  F E EF  F ++T +SG I+PFPKG  R++ACL+AL  ++++   YLPSNP+A++L++DY SG P+QSAAKAP+LA+F+VKRCGV+ LE   ++A S     +TE D E     Q  RV                                 QA IFKVGDDVRQD+LALQ+++L KN+    GL   ++PYRVVATSPGCGVIECVP+SKSRDQ+GR TD G+Y+YF + +GDE++ ++QEARRNFV SMA+YSV  +LLQIKDRHNGNIM+D  GHIIHIDFGFMFESSPG N+GFEPD KL++EMV +MGGK+++  F+ F  L V AYL +RPY ++ V+LVSLMLD+ LPCFRG+TI  LR RF P M++++AA +   V+  C  + R+  YD +QYFQN+IPY
Sbjct:  671 HVSLAVDVAMSRMAAGVANEDDKMTLLVRLLELFVQLGIEGRRVGEKVSKSTVKMSTSAGNLGVLMPKIASLLRRMQPISEPTTKLRSLFRDFWFYCTVLGFDVESSSLWPEEWYNAVCETATKTPVLIATENLRSELIDNAAIRSDSISPQELQEMRNTVLAELSHQAEAVPLINRFDFANCTYLLSVHRMETMRLIHANHVDAFSSFFKYIEDKTMRKDKSGLWTCMLAAAPRIFLEWCEKMMKRRDNDEPTEEALVWHAQFLLFKFNHHLREVRKVADACLSQLVKAFPYLLWNTKVLTTILRLLQELEDNLQKDPTCREPQFTIEGFGGWTIQLQDSIEGRRSVVKDFSMRVKQILKEALRWAPASTHSNLLEYVSK-------FGSERDAAMQLAIDATSEGSGK----------------------------SGSYLTSLYKRSNYLGQVKGMLATTLSGDIDQVTAENQLIDRLEKDFQRACKSGKDM-----------------------EMEQAVLLLTALFV-SLRSLNERILSLLVRTPLLNFTESTVSLCTMAWNWLLSARPEAHSLFLHEQARAFADSSRFGLGLFEKEVVGGSPLC--QKLERPPPSANFRPHREWIEFIGERCDVASYSSREQLDVLEMMFSQTLSAHIGTGHLHGSTACSNPASLAGPSRKETINQVTRGIEAVGVRFRLLSCVLGMVQQ----DACLLRPTNVLIRQRVYSCAFHYFTIAPQGPTQPEERLREDIRLLTRFFEHLKNDKHYMQKEALAKTDKNLVMSSTMSQ--MQTNFEK---SLLISGTPVTATAAGTPNTSLML---PPSTNYANTLTLSSQKSMAATSASIRSGKSIETKLSIEEDRRIKTWMKQRNMLMLLVANEIERLSAWLHPLALAQEDCALDSEEFLRGAFTQAKATGGEKNI----WREQAQLAWDISPELAIQLPSRFRGSPELVKYVDVLVRGQPEPVAHIPEALPLFLGNGSTVFETSDMSHVLTWARCSPVMALSLLTPRIYPMHPISMQYAVRVLRSYSADELLLYIPQIVQAVRYDTMGYISELIIWLAGHSQLLSHQLIWNMQTNMFTDEESKVKDPVLFEALNDIMQKILSQLEGAARRFHEAEFKLFHQLTAISGTIKPFPKGDARKKACLKALADVKIETITYLPSNPEAVLLDLDYSSGTPMQSAAKAPFLARFRVKRCGVRELEHIGLQAQSEHGGKTTEADLEELKKVQDSRV-------------------------------CWQAAIFKVGDDVRQDMLALQLMQLMKNVWAGLGLPVRVFPYRVVATSPGCGVIECVPNSKSRDQLGRQTDFGLYEYFKTQYGDESSETFQEARRNFVRSMAAYSVFSFLLQIKDRHNGNIMIDLDGHIIHIDFGFMFESSPGGNLGFEPDFKLSEEMVAIMGGKMEAAPFRQFASLCVHAYLAVRPYHKSFVSLVSLMLDTHLPCFRGKTINQLRARFAPEMNEKDAAKYMYSVITNCFLNIRSKMYDQLQYFQNEIPY 2106          

HSP 2 Score: 72.0182 bits (175), Expect = 5.729e-12
Identity = 64/248 (25.81%), Postives = 123/248 (49.60%), Query Frame = 3
Query: 1614 KQLIISNAGVLLAVLECCAYLTQAFPHLAKSN-LDTLSDFLLNPNQVLSFL-NRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTT----DPSYIQNFLADLSRRFFNAVESDR-DTTLMYFNTVFTLGSMGVLLKDIGGTQ--EAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYRWNNAFIMI 2330
            ++ IIS   + L  +   A L + FP +A +  +  L  FLL P  +L+ L +   L+  +S  ++I+    ++  + + ++R+        +  + +R++AI ++CR L +    +   +Q  LA LS + F    ++    +L+  N + TLG +GV L D    +  E V+Q + Q  +  N PS L   +I  L  M IAG  +IY+ +  +FT I ++S+    +Q  +E +  R+ +  + +
Sbjct:  439 QKTIISQLPLYLKAISSMATLAEKFPAVATTAVIQNLQRFLLEPAPMLTKLASDSTLERGKSAGDVIQHSKSSNNLIDAITKRK--------LSLDALRNSAIKAICRALKSSIRMESDSVQQCLAGLSTKLFVCSNANNFVVSLVCENAIQTLGGIGVGLVDSTAVEVPEMVVQIYLQ--RFANPPSQLDVTMIRCLAEMWIAGARSIYENVWKLFTQICIESSNRVYSQGNNESNDQRYTHVSLAV 676          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Celegans
Match: Y75B8A.24 (pep chromosome:WBcel235:III:12251492:12273692:-1 gene:WBGene00013557.1 transcript:Y75B8A.24.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y75B8A.24)

HSP 1 Score: 994.571 bits (2570), Expect = 0.000e+0
Identity = 579/1544 (37.50%), Postives = 875/1544 (56.67%), Query Frame = 1
Query: 2359 HLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRN----VKTNIKNSI-AGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLE-RERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPR-TNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGML--------DAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX---------------------------XXXXXXXXXAIGVRFRMLSMGLSILQHMNENSIC-----KSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGY--SGAASIASTKKSTLGGK--RSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCP---------GLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFS-RMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAAS-----STEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            H+S +V      +AA +  ++    LL RLLE +V L +E RR      K+ +K S  AGNLG ++P IA +L+R+  I E + +L  LFRDFW Y  ++GF    + LWP EWY  VCE ATK+P+L+ TE L+SEL  N+A+ S++++  EL +M+  ++  +    E  PL+ + +     +L+SV+R+E++ + H+N  +A    FKYIED  + KDK G+WTC+     +IF  + ++M     N E  E  +  HAQFLL KFNH  + VR +AD  L+ + KAFP+++W+  VL T+L + Q L   L+ D     P + +     + + + DS + R  ++ DF    K IL+  ++W P    S+L++Y+ K       FG     A+      TS G  K                            S S++ +L  RS YLG+++GML        D     N +IDRL  D ++ C   +D+                        ++ ++  + AL V S   ++ ++L  L   PL++FT   +      W WLL+A+ +A  +FL E   A+  +    +G+F ++V   SPL   +  +  P   N  PH+ W +F+ ER  VA  SS +Q+++L  +  ++LS                             + +++   A+GVRFR+LS  L ++Q       C       ++R+++Y+  F YF+  P+   Q     ++DI  + +F+  ++++K Y+ + + ++    +     +S   +  N+     S L +   + A + GT ++ L     P ST   N    S   S+A+T  S   GK   + L+  +D   + ++K+RN++++L+A EI+RLS W +    A+ +C            +  +    EK I    WRE A+LAW +SPELA+ LPSRF+GS +L + ++ LV+  PE V HIPEAL       +   +  ++ +V TW   +PV+ALS  + R+YP HP++ QYAV+VL  Y  D L+ Y+PQ+VQ +RYD MGY++E ++ +   S +L+HQLIWNM+TNM+ DE+ ++KDP +   L  I+++I     G +  F E EF  F ++T +SG I+PFPKG  R++ACL+AL  ++++   YLPSNP+A++L++DY SG P+QSAAKAP+LA+F+VKRCGV+ LE   ++A S     +TE D E     Q  RV                                 QA IFKVGDDVRQD+LALQ+++L KN+    GL   ++PYRVVATSPGCGVIECVP+SKSRDQ+GR TD G+Y+YF + +GDE++ ++QEARRNFV SMA+YSV  +LLQIKDRHNGNIM+D  GHIIHIDFGFMFESSPG N+GFEPD KL++EMV +MGGK+++  F+ F  L V AYL +RPY ++ V+LVSLMLD+ LPCFRG+TI  LR RF P M++++AA +   V+  C  + R+  YD +QYFQN+IPY
Sbjct:  671 HVSLAVDVAMSRMAAGVANEDDKMTLLVRLLELFVQLGIEGRRVGEKVSKSTVKMSTSAGNLGVLMPKIASLLRRMQPISEPTTKLRSLFRDFWFYCTVLGFDVESSSLWPEEWYNAVCETATKTPVLIATENLRSELIDNAAIRSDSISPQELQEMRNTVLAELSHQAEAVPLINRFDFANCTYLLSVHRMETMRLIHANHVDAFSSFFKYIEDKTMRKDKSGLWTCMLAAAPRIFLEWCEKMMKRRDNDEPTEEALVWHAQFLLFKFNHHLREVRKVADACLSQLVKAFPYLLWNTKVLTTILRLLQELEDNLQKDPTCREPQFTIEGFGGWTIQLQDSIEGRRSVVKDFSMRVKQILKEALRWAPASTHSNLLEYVSK-------FGSERDAAMQLAIDATSEGSGK----------------------------SGSYLTSLYKRSNYLGQVKGMLATTLSGDIDQVTAENQLIDRLEKDFQRACKSGKDM-----------------------EMEQAVLLLTALFV-SLRSLNERILSLLVRTPLLNFTESTVSLCTMAWNWLLSARPEAHSLFLHEQARAFADSSRFGLGLFEKEVVGGSPLC--QKLERPPPSANFRPHREWIEFIGERCDVASYSSREQLDVLEMMFSQTLSAHIGTGHLHGSTACSNPASLAGPSRKETINQVTRGIEAVGVRFRLLSCVLGMVQQ----DACLLRPTNVLIRQRVYSCAFHYFTIAPQGPTQPEERLREDIRLLTRFFEHLKNDKHYMQKEALAKTDKNLVMSSTMSQ--MQTNFEK---SLLISGTPVTATAAGTPNTSLML---PPSTNYANTLTLSSQKSMAATSASIRSGKSIETKLSIEEDRRIKTWMKQRNMLMLLVANEIERLSAWLHPLALAQEDCALDSEEFLRGAFTQAKATGGEKNI----WREQAQLAWDISPELAIQLPSRFRGSPELVKYVDVLVRGQPEPVAHIPEALPLFLGNGSTVFETSDMSHVLTWARCSPVMALSLLTPRIYPMHPISMQYAVRVLRSYSADELLLYIPQIVQAVRYDTMGYISELIIWLAGHSQLLSHQLIWNMQTNMFTDEESKVKDPVLFEALNDIMQKILSQLEGAARRFHEAEFKLFHQLTAISGTIKPFPKGDARKKACLKALADVKIETITYLPSNPEAVLLDLDYSSGTPMQSAAKAPFLARFRVKRCGVRELEHIGLQAQSEHGGKTTEADLEELKKVQDSRV-------------------------------CWQAAIFKVGDDVRQDMLALQLMQLMKNVWAGLGLPVRVFPYRVVATSPGCGVIECVPNSKSRDQLGRQTDFGLYEYFKTQYGDESSETFQEARRNFVRSMAAYSVFSFLLQIKDRHNGNIMIDLDGHIIHIDFGFMFESSPGGNLGFEPDFKLSEEMVAIMGGKMEAAPFRQFASLCVHAYLAVRPYHKSFVSLVSLMLDTHLPCFRGKTINQLRARFAPEMNEKDAAKYMYSVITNCFLNIRSKMYDQLQYFQNEIPY 2106          

HSP 2 Score: 72.0182 bits (175), Expect = 5.729e-12
Identity = 64/248 (25.81%), Postives = 123/248 (49.60%), Query Frame = 3
Query: 1614 KQLIISNAGVLLAVLECCAYLTQAFPHLAKSN-LDTLSDFLLNPNQVLSFL-NRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTT----DPSYIQNFLADLSRRFFNAVESDR-DTTLMYFNTVFTLGSMGVLLKDIGGTQ--EAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYRWNNAFIMI 2330
            ++ IIS   + L  +   A L + FP +A +  +  L  FLL P  +L+ L +   L+  +S  ++I+    ++  + + ++R+        +  + +R++AI ++CR L +    +   +Q  LA LS + F    ++    +L+  N + TLG +GV L D    +  E V+Q + Q  +  N PS L   +I  L  M IAG  +IY+ +  +FT I ++S+    +Q  +E +  R+ +  + +
Sbjct:  439 QKTIISQLPLYLKAISSMATLAEKFPAVATTAVIQNLQRFLLEPAPMLTKLASDSTLERGKSAGDVIQHSKSSNNLIDAITKRK--------LSLDALRNSAIKAICRALKSSIRMESDSVQQCLAGLSTKLFVCSNANNFVVSLVCENAIQTLGGIGVGLVDSTAVEVPEMVVQIYLQ--RFANPPSQLDVTMIRCLAEMWIAGARSIYENVWKLFTQICIESSNRVYSQGNNESNDQRYTHVSLAV 676          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Celegans
Match: pifk-1 (PhosphoInositide Four Kinase (PI-4 Kinase) [Source:UniProtKB/TrEMBL;Acc:Q20077])

HSP 1 Score: 178.718 bits (452), Expect = 5.011e-46
Identity = 102/269 (37.92%), Postives = 150/269 (55.76%), Query Frame = 1
Query: 6022 CIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQI-----------GRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLM-LDSGLPCFR--GQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
             I K GDD+ Q+  A Q++  FK++   EG+  YL PY++V      G+IE V D+ S  QI           G  T   +  +F ++FG   + +Y  A++NF+ S A+YS+V Y LQ+KDRHNGNI+LD  GH+IHID+GF+  SSP  N+GFE    KLT E++ VMGG IDS  F +F+ L ++  +  R +   IV+L  +M   S + CFR   +T++ L  RF    +D +       ++    D +    YD  QY+ N I
Sbjct:  399 VIVKTGDDLSQEAFAQQLLFTFKDLWHEEGVPLYLRPYKIVCIGSDAGLIEPVLDTLSLHQIKRHLTNVFRMNGNVTTPSLKHHFENVFGPVNSETYVNAQKNFIQSTAAYSLVSYYLQLKDRHNGNILLDMDGHLIHIDYGFLLSSSP-RNLGFETAPFKLTTEIIDVMGG-IDSDMFLYFKSLLLRGLMAARKHHRRIVSLAEIMSAGSKMQCFRAGAETVRALEARFHVSSTDEQLQQLVDTLVEGSRDSYTTRFYDSFQYYTNGI 665          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Celegans
Match: vps-34 (Phosphatidylinositol 3-kinase catalytic subunit type 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXI7])

HSP 1 Score: 125.561 bits (314), Expect = 7.689e-29
Identity = 91/277 (32.85%), Postives = 134/277 (48.38%), Query Frame = 1
Query: 5977 KPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLF-----GDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKL---LRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            +PN     +   E   IFK GDD+RQD L  Q++RL   IL++  LD  L PY V++T  G G ++C+  SK    I     +   D           GD           N+V S+A YSV+ Y+L + DRH  N++L ++G + H+DFGF+      +     P +KLT EMV VMGG + S  F  F Q    AY +LR +   ++ L SLMLD+G+P    +  K    + QR    +SD  A  H    + +  +   A   D I  ++  +
Sbjct:  378 QPNGKADRNIPEEYTVIFKTGDDLRQDQLIQQMVRLIDIILKKGQLDLKLTPYLVLSTGVGQGFVQCI-KSKPLRAIQEQYKAHKMDCIREAMKELRPGDGPFGIEPNVIDNYVRSLAGYSVIMYILGLGDRHLDNLLLCENGKLFHVDFGFILGR---DPKPMPPPMKLTSEMVQVMGG-VKSKQFLEFVQHVDSAYRILRRHSNVLLNLFSLMLDAGIPDIAAEPDKAIFKIEQRLRLDLSDEAATKHIFTQIESSLNAKMAMISDIIHAYKQNL 649          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Celegans
Match: vps-34 (Phosphatidylinositol 3-kinase catalytic subunit type 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXI7])

HSP 1 Score: 124.405 bits (311), Expect = 3.772e-28
Identity = 91/277 (32.85%), Postives = 134/277 (48.38%), Query Frame = 1
Query: 5977 KPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLF-----GDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKL---LRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            +PN     +   E   IFK GDD+RQD L  Q++RL   IL++  LD  L PY V++T  G G ++C+  SK    I     +   D           GD           N+V S+A YSV+ Y+L + DRH  N++L ++G + H+DFGF+      +     P +KLT EMV VMGG + S  F  F Q    AY +LR +   ++ L SLMLD+G+P    +  K    + QR    +SD  A  H    + +  +   A   D I  ++  +
Sbjct:  629 QPNGKADRNIPEEYTVIFKTGDDLRQDQLIQQMVRLIDIILKKGQLDLKLTPYLVLSTGVGQGFVQCI-KSKPLRAIQEQYKAHKMDCIREAMKELRPGDGPFGIEPNVIDNYVRSLAGYSVIMYILGLGDRHLDNLLLCENGKLFHVDFGFILGR---DPKPMPPPMKLTSEMVQVMGG-VKSKQFLEFVQHVDSAYRILRRHSNVLLNLFSLMLDAGIPDIAAEPDKAIFKIEQRLRLDLSDEAATKHIFTQIESSLNAKMAMISDIIHAYKQNL 900          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Fly
Match: PI4KIIIalpha (gene:FBgn0267350 transcript:FBtr0331587)

HSP 1 Score: 1144.41 bits (2959), Expect = 0.000e+0
Identity = 646/1496 (43.18%), Postives = 917/1496 (61.30%), Query Frame = 1
Query: 2353 LRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVK----TNIKNSIAGNLGEMIPVIAIILKRLNKIE-ASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKS---ELEHNSALVSNTLNQTELHDMKTKLIQLI-GKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYN--DMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRX--XXXXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNG-LDPNYNHNSWSKLNTINLMK--ANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
              H+S +VV+  GNIAANIQGD  + +LL +LLE +V + L+  R+          +S AGNLG +IPVIA++++RL  I+    RL+KLF+DFW Y V+MGF +   +LWP +WY+GV +IA KSPLL+     KS   EL +  A+ S+++N     +++++++ L+    D ++  + K++  Q  +L+SVY LE L VE++ D  +L  I  Y+ D  + +DK G+W C+  +  ++FE +   +  H++   RE+++++ A  LLV FNH+ K ++++AD +L+ +   FPH++W+  VL  MLDI QLL+  L +D N+  P   V  T + L ++DS   RE  L DF   C+ I+   M+W P   RSHL +Y  ++   V     H GLA+A  +V++S+     ++    S  N               SD+  F++ L LRS+Y GEI G+L   +  D   + DRLV+DV + C +  D                        R + +L+R  A ++I  + +SRKLLH +  + L  FT   ME  V CW W+L A+ D  L F+ EM +AWQ T + ++G+F  + E   PL   E  K+        PH IW + L E +  A+  +  +VE+   L+ R   + KSS  ++  S +G RF++L  GLS+LQ +    S+ +++LRE++Y++   YF   P    Q      +DIM +++FW  MRSEKK+L  S   E  DY     +VS    L    N  + S ++   L+     S+  + + +            +G+      +++  S    +   L    DS  + Y+KKRNLIL LLAVE++ L  W N N   +   PG   +  W + +  +   WR++ARLAW  +P LAV LP R K +E + EE+ +LV  +P  VCHIPEAL++L T  N+  + P+L Y+ +W PV P+ AL++FSR YP HPLT QYAVK LS YP ++++ Y+PQLVQ +R+D MGY+ EF+  I   S I+AHQLIWNM+TNMY DED Q KDP++   L+ + + I  SFSG +  F EREFDFF KIT VSG IR F KG +R+ ACL AL +I++Q GCYLPSNP+A+VL+IDY SG P+QSAAKAPYLA+F+V RCG+  LE  A+  +++                     N+ +   ++LGVE               QA IFKVGDDVRQD+LALQVI +FKNI ++ GLD +L+PYRVVAT+PGCGVIECVP++KSRDQ+GR TDSG+ +YF   +GDE++  +Q AR NFV SMA+YS++ YLLQIKDRHNGNIM+DK GHIIHIDFGFMFESSPG N+GFEPD+KLT EMVM+MGGK+DSPAF+WF +L VQA+L +RPYQ+AIV+LVSLMLD+GLPCFRGQTI LL+QRF    +++EAA H L V+R    ++R  TYD IQY+QNQIPY
Sbjct:  747 FHHVSDAVVNALGNIAANIQGDAEMLELLGKLLELFVQIGLDGERSYDNTPGAQKASSRAGNLGMLIPVIAVLVRRLPPIKNPRQRLHKLFKDFWAYCVVMGFTNA--RLWPADWYQGVQQIAAKSPLLISQTAHKSDMRELNYTLAIKSDSVN-----ELRSQILVLLEHSSDNVATAINKLSFAQCTYLLSVYWLEMLRVENA-DEPSLEPIMSYLCDTALQRDKTGIWQCVKCVADQVFEKFRNVLYAHDEI--REKVLESQATLLLVYFNHIHKPIQMVADQYLSFLVDRFPHLLWNRRVLWCMLDILQLLAYSLSLDPNEETPTLRVVSTPYTLQLMDSLPARELRLKDFADRCQGIVNEAMKWAPRSTRSHLQEYPNQIPTPV--LAHHSGLALAFDSVVSSSAQHTGTMSKRPSCVN---------------SDTPRFVSVLCLRSKYAGEISGLLSVLSEKDKAGLADRLVSDVWEACAEKSD-----------------------ARHRGALWRATAYLIIC-SEISRKLLHAVASSQLELFTESAMETAVECWQWVLTARQDLELCFIQEMVSAWQTTFEKRMGLFAWETEVTHPLAAYEGCKLVSKPILIAPHLIWLQLLSEMVDTAKYCNRDKVEMFCLLLHRCLPVLKSSKQNRQVSTVGCRFKLLQCGLSLLQGNTIPKSLSRNILRERIYSNALDYFCGPPTCPNQSREQLLEDIMILLKFWQTMRSEKKHLVTS---EVGDYDLTNASVSSTQMLAVRNNPETASLISGGGLVNDYTRSMSASGNAVGMGMGVAGGGSSSGWYNTIPHSTSTLSKRSNRSKRLQYQKDSYDKDYMKKRNLILELLAVELEFLITWYNPNSLPDLIVPGEEQITEW-RNRPYKSTVWRDYARLAWCYNPALAVFLPQRIKNAEIIDEEVSRLVCSDPIAVCHIPEALKYLCTTKNLLQESPDLVYILSWSPVTPIQALAYFSRQYPSHPLTAQYAVKTLSSYPAESVLPYIPQLVQALRHDTMGYVVEFIKNISRRSQIVAHQLIWNMQTNMYMDEDQQHKDPNLYEALDQLSQSIIASFSGAAKRFYEREFDFFGKITAVSGEIRSFAKGIERKNACLAALSRIKVQGGCYLPSNPEAMVLDIDYSSGTPMQSAAKAPYLARFRVYRCGITELETRAMEVSNN--------------------PNSQEDAKMTLGVESW-------------QAAIFKVGDDVRQDMLALQVITIFKNIFQQVGLDLFLFPYRVVATAPGCGVIECVPNAKSRDQLGRQTDSGLSEYFQHQYGDESSKEFQAARANFVKSMAAYSLIGYLLQIKDRHNGNIMIDKDGHIIHIDFGFMFESSPGGNIGFEPDMKLTDEMVMIMGGKMDSPAFKWFCELCVQAFLAVRPYQDAIVSLVSLMLDTGLPCFRGQTINLLKQRFVATKNNKEAAAHMLAVIRNSYQNFRTRTYDMIQYYQNQIPY 2154          

HSP 2 Score: 88.5817 bits (218), Expect = 7.330e-17
Identity = 72/290 (24.83%), Postives = 138/290 (47.59%), Query Frame = 3
Query: 1554 NDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMI--------------------FEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDT-------TLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPT-IYQQIMTIFTDIRVKSTR-SYATQIESEESHYRWNNAFI 2324
             +A+ L  RL++++ +++   ++++ +  +L+  LE    L   FP++A +++  L DFL+ P+ +L  L+   ++++         +    KE+T      Q    R  ++                    FE +RD AI +L   L    T D   +   +A++S R F A +S  ++        L+  N +  LG + V LKD   T + +LQFF Q  +   +PS     I++QLG MII+ C T ++ +IM +F+ + V+S   +Y +  E  +  +  ++A +
Sbjct:  477 KEADKLCGRLSQKL-NLELSHKIVMDHMPLLMVCLEGLGKLAHKFPNIAGTSISYLRDFLVAPSPILGKLHDHAMQSL--------AQQKKEKELTPFKIAVQHSDSRTAVVIYGDNQKPPGSGTGRSGHAAFESLRDAAIENLSIALRAAHTLDQFCVPALVANVSNRLFTAEKSGSESQGECHKSNLVSLNIIVMLGHVAVALKDTSKTTQNILQFFIQ--RFCKVPSEQNALIVDQLGCMIISQCETHVFDEIMKMFSRVTVQSASLAYTSDPEHRKQFHHVSDAVV 755          

HSP 3 Score: 65.0846 bits (157), Expect = 1.057e-9
Identity = 56/195 (28.72%), Postives = 100/195 (51.28%), Query Frame = 3
Query:   33 TTQNYILNSPYLKLARAL--IYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYK--EIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQ 605
             +  Y      L LAR L  I     D V+    YCP+ N +G F L+ + Q A++++GIY +E   + +  I+PYLL + K L K+  + D +  ++ +  +  AE FSF L +LLS+ +A   D   ++I   +++L A  N ++ + +       + +    + P L G+ R +GR A +   ++ R+FP +
Sbjct:    5 ASDKYTYQRTVLCLARVLAGIQPTPWDKVQTLFRYCPQENAAGVFCLDTRAQDAVIALGIYFLEGGCQHEGQIVPYLLRLAKCLPKAVWIDDARSNKVERVRIPSAEKFSFCLNTLLSDIAAKCPDSREEIILNQVETLSALANIVKSSRDSSSAPPPIILCKATV-PLLFGLARSMGRYASNDPPLLCRIFPPE 198          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Fly
Match: PI4KIIIalpha (gene:FBgn0267350 transcript:FBtr0307158)

HSP 1 Score: 1143.64 bits (2957), Expect = 0.000e+0
Identity = 646/1494 (43.24%), Postives = 917/1494 (61.38%), Query Frame = 1
Query: 2359 HLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVK----TNIKNSIAGNLGEMIPVIAIILKRLNKIE-ASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKS---ELEHNSALVSNTLNQTELHDMKTKLIQLI-GKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYN--DMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRX--XXXXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNG-LDPNYNHNSWSKLNTINLMK--ANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            H+S +VV+  GNIAANIQGD  + +LL +LLE +V + L+  R+          +S AGNLG +IPVIA++++RL  I+    RL+KLF+DFW Y V+MGF +   +LWP +WY+GV +IA KSPLL+     KS   EL +  A+ S+++N     +++++++ L+    D ++  + K++  Q  +L+SVY LE L VE++ D  +L  I  Y+ D  + +DK G+W C+  +  ++FE +   +  H++   RE+++++ A  LLV FNH+ K ++++AD +L+ +   FPH++W+  VL  MLDI QLL+  L +D N+  P   V  T + L ++DS   RE  L DF   C+ I+   M+W P   RSHL +Y  ++   V     H GLA+A  +V++S+     ++    S  N               SD+  F++ L LRS+Y GEI G+L   +  D   + DRLV+DV + C +  D                        R + +L+R  A ++I  + +SRKLLH +  + L  FT   ME  V CW W+L A+ D  L F+ EM +AWQ T + ++G+F  + E   PL   E  K+        PH IW + L E +  A+  +  +VE+   L+ R   + KSS  ++  S +G RF++L  GLS+LQ +    S+ +++LRE++Y++   YF   P    Q      +DIM +++FW  MRSEKK+L  S   E  DY     +VS    L    N  + S ++   L+     S+  + + +            +G+      +++  S    +   L    DS  + Y+KKRNLIL LLAVE++ L  W N N   +   PG   +  W + +  +   WR++ARLAW  +P LAV LP R K +E + EE+ +LV  +P  VCHIPEAL++L T  N+  + P+L Y+ +W PV P+ AL++FSR YP HPLT QYAVK LS YP ++++ Y+PQLVQ +R+D MGY+ EF+  I   S I+AHQLIWNM+TNMY DED Q KDP++   L+ + + I  SFSG +  F EREFDFF KIT VSG IR F KG +R+ ACL AL +I++Q GCYLPSNP+A+VL+IDY SG P+QSAAKAPYLA+F+V RCG+  LE  A+  +++                     N+ +   ++LGVE               QA IFKVGDDVRQD+LALQVI +FKNI ++ GLD +L+PYRVVAT+PGCGVIECVP++KSRDQ+GR TDSG+ +YF   +GDE++  +Q AR NFV SMA+YS++ YLLQIKDRHNGNIM+DK GHIIHIDFGFMFESSPG N+GFEPD+KLT EMVM+MGGK+DSPAF+WF +L VQA+L +RPYQ+AIV+LVSLMLD+GLPCFRGQTI LL+QRF    +++EAA H L V+R    ++R  TYD IQY+QNQIPY
Sbjct:  729 HVSDAVVNALGNIAANIQGDAEMLELLGKLLELFVQIGLDGERSYDNTPGAQKASSRAGNLGMLIPVIAVLVRRLPPIKNPRQRLHKLFKDFWAYCVVMGFTNA--RLWPADWYQGVQQIAAKSPLLISQTAHKSDMRELNYTLAIKSDSVN-----ELRSQILVLLEHSSDNVATAINKLSFAQCTYLLSVYWLEMLRVENA-DEPSLEPIMSYLCDTALQRDKTGIWQCVKCVADQVFEKFRNVLYAHDEI--REKVLESQATLLLVYFNHIHKPIQMVADQYLSFLVDRFPHLLWNRRVLWCMLDILQLLAYSLSLDPNEETPTLRVVSTPYTLQLMDSLPARELRLKDFADRCQGIVNEAMKWAPRSTRSHLQEYPNQIPTPV--LAHHSGLALAFDSVVSSSAQHTGTMSKRPSCVN---------------SDTPRFVSVLCLRSKYAGEISGLLSVLSEKDKAGLADRLVSDVWEACAEKSDA-----------------------RHRGALWRATAYLIIC-SEISRKLLHAVASSQLELFTESAMETAVECWQWVLTARQDLELCFIQEMVSAWQTTFEKRMGLFAWETEVTHPLAAYEGCKLVSKPILIAPHLIWLQLLSEMVDTAKYCNRDKVEMFCLLLHRCLPVLKSSKQNRQVSTVGCRFKLLQCGLSLLQGNTIPKSLSRNILRERIYSNALDYFCGPPTCPNQSREQLLEDIMILLKFWQTMRSEKKHLVTS---EVGDYDLTNASVSSTQMLAVRNNPETASLISGGGLVNDYTRSMSASGNAVGMGMGVAGGGSSSGWYNTIPHSTSTLSKRSNRSKRLQYQKDSYDKDYMKKRNLILELLAVELEFLITWYNPNSLPDLIVPGEEQITEW-RNRPYKSTVWRDYARLAWCYNPALAVFLPQRIKNAEIIDEEVSRLVCSDPIAVCHIPEALKYLCTTKNLLQESPDLVYILSWSPVTPIQALAYFSRQYPSHPLTAQYAVKTLSSYPAESVLPYIPQLVQALRHDTMGYVVEFIKNISRRSQIVAHQLIWNMQTNMYMDEDQQHKDPNLYEALDQLSQSIIASFSGAAKRFYEREFDFFGKITAVSGEIRSFAKGIERKNACLAALSRIKVQGGCYLPSNPEAMVLDIDYSSGTPMQSAAKAPYLARFRVYRCGITELETRAMEVSNN--------------------PNSQEDAKMTLGVESW-------------QAAIFKVGDDVRQDMLALQVITIFKNIFQQVGLDLFLFPYRVVATAPGCGVIECVPNAKSRDQLGRQTDSGLSEYFQHQYGDESSKEFQAARANFVKSMAAYSLIGYLLQIKDRHNGNIMIDKDGHIIHIDFGFMFESSPGGNIGFEPDMKLTDEMVMIMGGKMDSPAFKWFCELCVQAFLAVRPYQDAIVSLVSLMLDTGLPCFRGQTINLLKQRFVATKNNKEAAAHMLAVIRNSYQNFRTRTYDMIQYYQNQIPY 2134          

HSP 2 Score: 91.2781 bits (225), Expect = 1.103e-17
Identity = 77/316 (24.37%), Postives = 153/316 (48.42%), Query Frame = 3
Query: 1482 FKYNLIN--SCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMI--------------------FEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDT-------TLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPT-IYQQIMTIFTDIRVKSTR-SYATQIESEESHYRWNNAFI 2324
            +K N++   +C+ ++V+    +I +  +A+ L  RL++++ +++   ++++ +  +L+  LE    L   FP++A +++  L DFL+ P+ +L  L+   ++++         +    KE+T      Q    R  ++                    FE +RD AI +L   L    T D   +   +A++S R F A +S  ++        L+  N +  LG + V LKD   T + +LQFF Q  +   +PS     I++QLG MII+ C T ++ +IM +F+ + V+S   +Y +  E  +  +  ++A +
Sbjct:  435 YKVNVMANAACVDLLVW----AIRDETEADKLCGRLSQKL-NLELSHKIVMDHMPLLMVCLEGLGKLAHKFPNIAGTSISYLRDFLVAPSPILGKLHDHAMQSL--------AQQKKEKELTPFKIAVQHSDSRTAVVIYGDNQKPPGSGTGRSGHAAFESLRDAAIENLSIALRAAHTLDQFCVPALVANVSNRLFTAEKSGSESQGECHKSNLVSLNIIVMLGHVAVALKDTSKTTQNILQFFIQ--RFCKVPSEQNALIVDQLGCMIISQCETHVFDEIMKMFSRVTVQSASLAYTSDPEHRKQFHHVSDAVV 735          

HSP 3 Score: 65.0846 bits (157), Expect = 1.046e-9
Identity = 56/195 (28.72%), Postives = 100/195 (51.28%), Query Frame = 3
Query:   33 TTQNYILNSPYLKLARAL--IYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYK--EIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQ 605
             +  Y      L LAR L  I     D V+    YCP+ N +G F L+ + Q A++++GIY +E   + +  I+PYLL + K L K+  + D +  ++ +  +  AE FSF L +LLS+ +A   D   ++I   +++L A  N ++ + +       + +    + P L G+ R +GR A +   ++ R+FP +
Sbjct:    5 ASDKYTYQRTVLCLARVLAGIQPTPWDKVQTLFRYCPQENAAGVFCLDTRAQDAVIALGIYFLEGGCQHEGQIVPYLLRLAKCLPKAVWIDDARSNKVERVRIPSAEKFSFCLNTLLSDIAAKCPDSREEIILNQVETLSALANIVKSSRDSSSAPPPIILCKATV-PLLFGLARSMGRYASNDPPLLCRIFPPE 198          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Fly
Match: fwd (gene:FBgn0004373 transcript:FBtr0072517)

HSP 1 Score: 179.104 bits (453), Expect = 1.704e-44
Identity = 95/260 (36.54%), Postives = 156/260 (60.00%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSG-LPCFR---GQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ+++A Q++++FK I + E +D ++ PY++V  S   G+IE + ++ S  QI + ++  + +YF+  +G  +  S++ A++NFV S A+Y ++ YLLQ+KDRHNGNI+    GHIIHIDFGF+   SP  N+GFE    KLT E V VMGG   S  ++ F +L +   +  R + + I+  V +M  +  LPCF+     T++ LR+RF   ++++E      ++++          YD  QY+ N I
Sbjct: 1080 SAIVKCGDDLRQELMATQLLQMFKIIWQEEQVDLWVRPYKIVCLSNDSGLIEPILNTVSLHQIKKNSNKSLKEYFIDEYGSPSGESFRRAQKNFVQSCAAYCLISYLLQVKDRHNGNILFHSDGHIIHIDFGFILSISP-KNLGFEQSPFKLTPEFVEVMGG-TSSEHWREFNKLLLVGMMSARKHMDRIINFVEIMRSNAHLPCFKNGCSGTVQNLRKRFHMNLTEQEMERKVEQLVQDSLKSLSTKLYDGYQYYTNGI 1337          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Fly
Match: fwd (gene:FBgn0004373 transcript:FBtr0072516)

HSP 1 Score: 178.718 bits (452), Expect = 2.363e-44
Identity = 95/260 (36.54%), Postives = 156/260 (60.00%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSG-LPCFR---GQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ+++A Q++++FK I + E +D ++ PY++V  S   G+IE + ++ S  QI + ++  + +YF+  +G  +  S++ A++NFV S A+Y ++ YLLQ+KDRHNGNI+    GHIIHIDFGF+   SP  N+GFE    KLT E V VMGG   S  ++ F +L +   +  R + + I+  V +M  +  LPCF+     T++ LR+RF   ++++E      ++++          YD  QY+ N I
Sbjct: 1416 SAIVKCGDDLRQELMATQLLQMFKIIWQEEQVDLWVRPYKIVCLSNDSGLIEPILNTVSLHQIKKNSNKSLKEYFIDEYGSPSGESFRRAQKNFVQSCAAYCLISYLLQVKDRHNGNILFHSDGHIIHIDFGFILSISP-KNLGFEQSPFKLTPEFVEVMGG-TSSEHWREFNKLLLVGMMSARKHMDRIINFVEIMRSNAHLPCFKNGCSGTVQNLRKRFHMNLTEQEMERKVEQLVQDSLKSLSTKLYDGYQYYTNGI 1673          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Fly
Match: fwd (gene:FBgn0004373 transcript:FBtr0072515)

HSP 1 Score: 178.718 bits (452), Expect = 2.363e-44
Identity = 95/260 (36.54%), Postives = 156/260 (60.00%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSG-LPCFR---GQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ+++A Q++++FK I + E +D ++ PY++V  S   G+IE + ++ S  QI + ++  + +YF+  +G  +  S++ A++NFV S A+Y ++ YLLQ+KDRHNGNI+    GHIIHIDFGF+   SP  N+GFE    KLT E V VMGG   S  ++ F +L +   +  R + + I+  V +M  +  LPCF+     T++ LR+RF   ++++E      ++++          YD  QY+ N I
Sbjct: 1416 SAIVKCGDDLRQELMATQLLQMFKIIWQEEQVDLWVRPYKIVCLSNDSGLIEPILNTVSLHQIKKNSNKSLKEYFIDEYGSPSGESFRRAQKNFVQSCAAYCLISYLLQVKDRHNGNILFHSDGHIIHIDFGFILSISP-KNLGFEQSPFKLTPEFVEVMGG-TSSEHWREFNKLLLVGMMSARKHMDRIINFVEIMRSNAHLPCFKNGCSGTVQNLRKRFHMNLTEQEMERKVEQLVQDSLKSLSTKLYDGYQYYTNGI 1673          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Zebrafish
Match: pi4kaa (phosphatidylinositol 4-kinase, catalytic, alpha a [Source:ZFIN;Acc:ZDB-GENE-100204-2])

HSP 1 Score: 1274.61 bits (3297), Expect = 0.000e+0
Identity = 691/1511 (45.73%), Postives = 969/1511 (64.13%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNL-TTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLD------AYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX-----XXXXXXXXXAIGVRFRMLSMGLSILQH-MNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDS-VTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVE----NWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAAN+Q ++ + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ KRL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+SEL++NSAL ++T+   EL+D++  +I L+    E++ L+ K++     +L+SVYRLE + V  S +S+    +F+Y ED  I KDK GM  C+  +G K+F+ +++ M +  K    E  +++HAQFLLV FNH+ KR+R +AD +L+ +A+ FPH++WSG VL TMLDI Q LS  L  D ++  P YD+P T +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY++QS       T+L TTQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM+       + +D+N ++ R +N+                   D   P              +LF++ AL+ IS       LLH LCW+PL  FT   ME  +ACW WLLA ++   + F+ EM  AWQ T+D K+G+F+    E  PL   E+ +  P   +  PH IW +FL +R  +A+ SS  QVEI   L+ RSLS       S L++  +AIG RFR+L++GLS+L   +  N+  ++VLREK+Y++ F YFS   ++  Q     ++DI  +I+F++ + S+KKYL  S              V  +  DP+        LN++++M A        +    +     +   G+     ++S   +T         +N  + + + Y+K+R L+L LLA EI+RLS W N     E   P    VE    NW  K   + ++ W++   LAW ++P LA+ LP+RFK ++ +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN++ DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P PKG +R++ACL+AL +I++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D++++G +                            ++L+   +  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD KSRDQ+GR TD GMYDYF + +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLD  GH+IHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF P MS++EAA   ++V+  C    R+ TYD +QY+QNQIPY
Sbjct:  641 DHGYRHCSLAVINALANIAANLQTEQMVDELLVNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTKRLPAIKEAKPRLQKLFRDFWLYSVVMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSGEPLRSELQYNSALKNDTVTPAELNDLRGTIINLLDPPPEVAALINKLDFAMSTYLLSVYRLEYMRVLRSQESDRFQVMFRYFEDRAIQKDKSGMMQCVIAVGDKVFDVFLQMMADKAKTKAHEEELESHAQFLLVNFNHIHKRIRRVADKYLSGLAETFPHLLWSGRVLRTMLDILQTLSLSLSADIHKDQPYYDIPDTPYRITVPDTYEARESIVKDFAARCGEILKEAMKWAPSVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNRQS-------TSLGTTQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVAGMIHFSEATRSTSDLNKLMIRQMNEAL-----------------DGGQP---------EAFTEALFKMAALL-ISSREWDPLLLHHLCWSPLKMFTENGMETAIACWEWLLAGRTGVEVPFMREMAGAWQMTVDLKMGLFSDAQLEADPLAASEESQPIPCPPDVTPHYIWIEFLVQRFEIAKYSSADQVEIFGSLLQRSLSLNVGSPKSSLNRHVAAIGPRFRLLTLGLSLLHSDVVTNATIRNVLREKIYSTAFDYFSVASKFPTQGDKRLREDISIMIRFYASILSDKKYLGASLL------------VPPDNQDPS--------LNSLSVMNATDPRNNMDM----TVGSRQQSAQGWINTYPLSSGMSTTSKKSGMSKKSNRGTQLHKYYMKRRTLLLALLASEIERLSTWYNPLSTQELAIPTEQSVETSISNWRSKYINLTEKQWKDNVNLAWSIAPYLALQLPARFKNADAIVAEVTRLVRLDPGAVSDVPEAVKFLVTWHTIDADSPELSHILCWAPADPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAQKSQLLAHQFIWNMKTNIFLDEEGHQKDPDIGELLEQMVEEITHSLSGPAKDFYQREFDFFNKITNVSAIIKPVPKGDERKRACLKALSEIKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCPS----DSQDEGDE----------------------------SSLTAQRVCWQAAIFKVGDDCRQDMLALQIIGLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCKSRDQLGRQTDFGMYDYFRNQYGDESTLAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDSKGHLIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFNPNMSEKEAAAFMIKVIERCFLSSRSKTYDMLQYYQNQIPY 2059          

HSP 2 Score: 124.405 bits (311), Expect = 1.290e-27
Identity = 114/410 (27.80%), Postives = 199/410 (48.54%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQ-SVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 2306
            L+ ++ ++++ +S++F+   D+     L  N      YK++S PL + +  +LRD +   Y K        +Q S +KEV      + +   SEL +           L+    LHS    +   C +          +C+ ++V+    ++ E   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +A S   +L DFL+ P+ VL  L +       +G   IK+   N    ++ S     K      ++E++RD +I ++CR L    T D   ++ FLA LS R + + E+D+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK++    +  + ++  YR
Sbjct:  273 LRQLLQMVEQFVSESFMKTLDQAMTEVLEINPTAYLYYKTFSDPLYVAIFKMLRDSLY--YMK-------DLQVSFVKEVHDFVLEQFSSSQSELQRI----------LHDVEYLHSELNPLKLRCQANA--------ACVDLMVW----AVTEEQGAENLCTKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVVAHSVTMSLRDFLVVPSPVLVKLYKYH-SQYTTGAGEIKIHVTNEHSQSTFSSHSSKK--SQPSMYEQLRDISINNICRCLKAGLTMDSVIVEAFLASLSNRLYISQENDKDAHLIPDHTIRALGHIAVALRDTPRVMEPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKASSMVYSTKDYKDHGYR 645          

HSP 3 Score: 55.8398 bits (133), Expect = 7.684e-7
Identity = 44/157 (28.03%), Postives = 85/157 (54.14%), Query Frame = 3
Query:  132 CPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSP-AEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFP 599
            CP  +  G F L+ + + A++++GI+LVESEL+ K+ I+PYLL + K L + + + +  E    E  P AE  +FS   +   +     DE  ++   +++++M     L++       + +  +    + P LLG++R  GR + + + ++S+LFP
Sbjct:    2 CPV-DIRGVFQLDERRRDAVIALGIFLVESELQHKDAIVPYLLVLLKGLPRVQWIEESSERKGREALPIAE--NFSFCLVTVLSDVAQMDESMRI--QILEAVMNLIQVLQETCQNIEGQDKEYLCKYTV-PCLLGVVRAFGRYSNTEEPLLSKLFP 152          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Zebrafish
Match: pi4kab (phosphatidylinositol 4-kinase, catalytic, alpha b [Source:ZFIN;Acc:ZDB-GENE-080220-34])

HSP 1 Score: 395.971 bits (1016), Expect = 1.154e-143
Identity = 194/419 (46.30%), Postives = 274/419 (65.39%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNI-------KNSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQS 3570
            D   RH S +V++   NIAAN+QG+  + +LL  LLE +V L LE +R  +           +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+SEL++NSAL ++T+   EL D+++ +I L+    E + L+ K++     +L+SVYRLE + + HSND++    +F+Y ED  I KDK GM  C+  +G K+FE +++ M    K  E E  ++ HAQFLLV FNH  KR+R +AD +L+ +A+ FPH++WSG VL TMLDI Q LS  L  D ++  P YD+P T +++ + D+ + RE I+ DF   C  IL+  M+W   + +SHL +Y+ K +  +    QH GLA+AT+++L  AGY++QS
Sbjct:  642 DHGYRHCSLAVINALANIAANLQGEPLVDELLVNLLELFVQLGLEGKRACERASDKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVVMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSGEPLRSELQYNSALKNDTVTPAELSDLRSTIINLLDPSPEAAALINKLDFAMCTYLLSVYRLEYMRMLHSNDADRFQVMFRYFEDKAIQKDKSGMMQCVICVGDKVFEVFLQMMAEKPKTKEHEEELERHAQFLLVNFNHTHKRIRRVADKYLSGLAETFPHLLWSGRVLKTMLDILQTLSLSLSADIHKDQPYYDIPDTPYRITVPDTHEARESIVKDFAARCGEILKEAMKWAASVTKSHLQEYLNKHQNWLSGLSQHTGLAMATESILNFAGYNRQS 1060          

HSP 2 Score: 137.117 bits (344), Expect = 1.154e-143
Identity = 188/748 (25.13%), Postives = 323/748 (43.18%), Query Frame = 3
Query:  123 MCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCD-YKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMG---DAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNS----------LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQK-INENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTR-SYATQIESEESHYR 2306
            MC C   +  G F L+ + + A++++ ++LVES+L+ K+ ++ YLL++ K L + + V +      K  L  AE FSF L +LLS+ +  D +   +++  +MD + +     +   N D    ++ +    + P LLG               V+R F          R S+  E LL       +             TP R     +  R +      S L       CQ    R  S+   ++A    DR       G S            S   P G +Y  G   S   +  P  +   +S+S   +       LFS  S          L+ ++ ++K+ +S +F+   D +      +N  +   YK +S PL + +  +LRD +   Y K ++      +   + E F+   +EL +   E    G       S L  +L  H+ A                   +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +A S   +L DFL+ P+ VL  L +       SG   IK+   N    +S +     K      ++E++RD +I ++CR L    T DP  ++ FLA LS R + + E+D++  L+  +T+  LG + V ++D     E +LQ  QQ  +    PS L   II+QLG MII G   IYQ++  +F  I VK++   Y+   + ++  YR
Sbjct:    1 MCPC---DSRGVFVLDVRRRDAVIALAVFLVESDLQHKDTVVNYLLSLLKGLPRVQWVEENAGRKCKESLPMAENFSFCLVTLLSDVAQKDPESRTQILEAIMDVMQSLLEICQTPENHD----KVHLCRF-VVPCLLG---------------VARAF---------GRYSNADEPLLCQLFPRGA---------PPPATPVRGSVETEGIRRRSFNDFRSILPSSLLTVCQSDTLRRKSTATNLDAQASPDRG------GPSP----------CSPTAP-GPQYFEGSYLSEGSAVNPDYYFTTVSSSFSMSP------LFSGASGPEINVPLELLRRLLQMVKQFVSDSFLKSLDAVVTEVTEANAGVDLFYKGFSDPLYVSMFKMLRDTLY--YMKDVHAGFVKEVHDFVLEQFSSSQSELQRVLHEERLPG-----EASPL--KLRCHANA-------------------ACVDLMVW----AVKDEQGAENLCTKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVIAHSASLSLKDFLVVPSAVLIKLYKYH-SQCSSGAGGIKINVTNEHSQSSLNLLSSRK--DQPSMYEQLRDISIDNICRCLKAGLTMDPVIVEAFLASLSNRLYISQENDKEAHLIPDHTIRALGHIAVAMRDSPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCMIITGNQYIYQEVWNLFQQISVKASNVVYSATKDYKDHGYR 646          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Zebrafish
Match: pi4kab (phosphatidylinositol 4-kinase, catalytic, alpha b [Source:ZFIN;Acc:ZDB-GENE-080220-34])

HSP 1 Score: 223.787 bits (569), Expect = 1.369e-95
Identity = 114/231 (49.35%), Postives = 154/231 (66.67%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNI-------KNSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDK 3006
            D   RH S +V++   NIAAN+QG+  + +LL  LLE +V L LE +R  +           +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+SEL++NSAL ++T+   EL D+++ +I L+    E + L+ K++     +L+SVYRLE + + HSND++    +F+Y ED  I KDK
Sbjct:  676 DHGYRHCSLAVINALANIAANLQGEPLVDELLVNLLELFVQLGLEGKRACERASDKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVVMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSGEPLRSELQYNSALKNDTVTPAELSDLRSTIINLLDPSPEAAALINKLDFAMCTYLLSVYRLEYMRMLHSNDADRFQVMFRYFEDKAIQKDK 906          

HSP 2 Score: 149.443 bits (376), Expect = 1.369e-95
Identity = 198/781 (25.35%), Postives = 341/781 (43.66%), Query Frame = 3
Query:   30 MTTQNYILNSPYLKLARALIYSNEEDI--VKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCD-YKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMG---DAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNS----------LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQK-INENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTR-SYATQIESEESHYR 2306
            M T+++  N+  L LAR+L       +  V+K +C CP  +  G F L+ + + A++++ ++LVES+L+ K+ ++ YLL++ K L + + V +      K  L  AE FSF L +LLS+ +  D +   +++  +MD + +     +   N D    ++ +    + P LLG               V+R F          R S+  E LL       +             TP R     +  R +      S L       CQ    R  S+   ++A    DR       G S            S   P G +Y  G   S   +  P  +   +S+S   +       LFS  S          L+ ++ ++K+ +S +F+   D +      +N  +   YK +S PL + +  +LRD +   Y K ++      +   + E F+   +EL +   E    G       S L  +L  H+ A                   +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +A S   +L DFL+ P+ VL  L +       SG   IK+   N    +S +     K      ++E++RD +I ++CR L    T DP  ++ FLA LS R + + E+D++  L+  +T+  LG + V ++D     E +LQ  QQ  +    PS L   II+QLG MII G   IYQ++  +F  I VK++   Y+   + ++  YR
Sbjct:    1 MATRDFYFNT-VLSLARSLAAHRPAPVEKVQKLLCMCPC-DSRGVFVLDVRRRDAVIALAVFLVESDLQHKDTVVNYLLSLLKGLPRVQWVEENAGRKCKESLPMAENFSFCLVTLLSDVAQKDPESRTQILEAIMDVMQSLLEICQTPENHD----KVHLCRF-VVPCLLG---------------VARAF---------GRYSNADEPLLCQLFPRGA---------PPPATPVRGSVETEGIRRRSFNDFRSILPSSLLTVCQSDTLRRKSTATNLDAQASPDRG------GPSP----------CSPTAP-GPQYFEGSYLSEGSAVNPDYYFTTVSSSFSMSP------LFSGASGPEINVPLELLRRLLQMVKQFVSDSFLKSLDAVVTEVTEANAGVDLFYKGFSDPLYVSMFKMLRDTLY--YMKDVHAGFVKEVHDFVLEQFSSSQSELQRVLHEERLPG-----EASPL--KLRCHANA-------------------ACVDLMVW----AVKDEQGAENLCTKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVIAHSASLSLKDFLVVPSAVLIKLYKYH-SQCSSGAGGIKINVTNEHSQSSLNLLSSRK--DQPSMYEQLRDISIDNICRCLKAGLTMDPVIVEAFLASLSNRLYISQENDKEAHLIPDHTIRALGHIAVAMRDSPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCMIITGNQYIYQEVWNLFQQISVKASNVVYSATKDYKDHGYR 680          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Zebrafish
Match: pi4kb (phosphatidylinositol 4-kinase, catalytic, beta [Source:NCBI gene;Acc:563201])

HSP 1 Score: 186.422 bits (472), Expect = 1.562e-47
Identity = 102/258 (39.53%), Postives = 153/258 (59.30%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  + I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYF    G+  T  +  A+RNFV S A Y ++CYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG +D   F +++ L +Q  +  R + E ++ +V +M   S LPCF G  TI+ L++RF   +++ +      +++           YD  QY  N I
Sbjct:  579 SVIVKCGDDLRQELLAYQVLKQLQIIWEQERVPLWIKPYKILVISSDSGMIEPVVNAVSIHQVKKQSQLLLLDYFRQEHGNFNTEEFLTAQRNFVQSCAGYCLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSP-RNLGFETSAFKLTSEFVDVMGG-LDGDMFNYYKMLMLQGLIAARKHMEKVIQIVEIMQQGSQLPCFHGSSTIRNLKERFHMNLTEEQLQVLVEQMVDGSMRSITTKLYDGFQYLTNGI 834          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Zebrafish
Match: pi4kb (phosphatidylinositol 4-kinase, catalytic, beta [Source:NCBI gene;Acc:563201])

HSP 1 Score: 186.422 bits (472), Expect = 1.562e-47
Identity = 102/258 (39.53%), Postives = 153/258 (59.30%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  + I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYF    G+  T  +  A+RNFV S A Y ++CYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG +D   F +++ L +Q  +  R + E ++ +V +M   S LPCF G  TI+ L++RF   +++ +      +++           YD  QY  N I
Sbjct:  579 SVIVKCGDDLRQELLAYQVLKQLQIIWEQERVPLWIKPYKILVISSDSGMIEPVVNAVSIHQVKKQSQLLLLDYFRQEHGNFNTEEFLTAQRNFVQSCAGYCLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSP-RNLGFETSAFKLTSEFVDVMGG-LDGDMFNYYKMLMLQGLIAARKHMEKVIQIVEIMQQGSQLPCFHGSSTIRNLKERFHMNLTEEQLQVLVEQMVDGSMRSITTKLYDGFQYLTNGI 834          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Xenopus
Match: cobl (cordon-bleu WH2 repeat protein [Source:Xenbase;Acc:XB-GENE-490658])

HSP 1 Score: 1269.99 bits (3285), Expect = 0.000e+0
Identity = 692/1503 (46.04%), Postives = 961/1503 (63.94%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQ--SIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX-----XXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQG+  + DLL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL+++++ +I L+    E+S L+ K++     +L+SVYRLE + V H+ D +    +F Y ED  I KDK GM  C+  +  K+FE ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  +    QH GLA+AT+++L  AGY++Q  ++ S AS   +T QL++ +P+  +K D S+FMA+LNLR+RY GE+ GM++ ++D       L   + K    A D C     +  +                  +F++ AL+ IS      +LLH LCWAPL  FT   ME  +ACW WLLAAK+   + F+ EM  AWQ T++ KIG+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RSLS         L++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  +              V  +  DP+ N  S S ++ +N  ++N   T  S  R  ++      Y   SG ++I  +KKS L  K    T     + + Y+K+R L+L LLA EI+RL+ W N   + + E +  G + V NW  K   + ++ W++   LAW +SP LA+ LP+RFK +E +  E+ +LV+ +P  V   PEA+++L T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN++ DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+PFPKG +R++ACL +L ++++QPGCYLPSNP+AIVL+IDY SG PLQSAAKAPYLAKFKVKRCGV  LEKE +   S +  ++E +G   +                                 +  QA IFKVGDD RQD++ L       NI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+  ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF+P  ++REAAN  L+V++ C    R+ TYD IQY+QN IPY
Sbjct:  640 DHGYRHCSLAVINALANIAANIQGEHQIDDLLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELNELRSTIINLLDPAPEVSALINKLDFAMSTYLLSVYRLEHMRVLHATDKDRFQVMFFYFEDKAIQKDKSGMMQCVIAVADKVFEAFLNVMADKPKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPSVTKSHLQEYLNKHQNWMSGLSQHTGLAMATESILHFAGYNRQNTTLGSPASSAQVT-QLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVAGMIE-FSDATGRTSDLNRLMLKHLGDALD-CGQPESYTQV------------------MFKLTALL-ISSKECDAQLLHHLCWAPLRMFTDHGMETAIACWDWLLAAKNGIEVPFMREMAGAWQMTVEQKIGLFSAEKKEADPLAASEQSQPRPCAPQVNPHYIWIDFLMQRFEIAKYCSSDQVEIFSSLLQRSLSLNIGGCKGSLNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQTQKLLREDISIMIKFWTAMFSDKKYLTANQL------------VPPDNQDPSVN--SLSVMSDVN--RSNLDVTVGS--RQQTAQGWINTYPLSSGMSTI--SKKSGLAKK----TNRGTQLHKYYMKRRTLLLSLLATEIERLTTWYNPLSSPELELDQTGENSVANWRSKYISLSEKQWKDNVNLAWSISPHLALQLPTRFKNTEAIGGEVTRLVRLDPGAVSDTPEAIKYLVTWHTIDADAPELSHILCWTPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIFLDEEGHQKDPDIGELLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPFPKGEERKKACLNSLSEVKVQPGCYLPSNPEAIVLDIDYTSGTPLQSAAKAPYLAKFKVKRCGVSELEKEGLSCRSDSIDESEEEGGDGK---------------------------------VCWQAAIFKVGDDCRQDLVVLL------NIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESALAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFSPNSTEREAANFILKVIQNCFLSNRSRTYDMIQYYQNDIPY 2055          

HSP 2 Score: 158.303 bits (399), Expect = 9.238e-38
Identity = 188/737 (25.51%), Postives = 347/737 (47.08%), Query Frame = 3
Query:  132 CPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDY-KEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFP--SQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGS----EYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            CP  +  G F L+ + + A++++GI+LVES+L+ K  ++PYLL + + L K + + +      K  L  AE FSF L +LLS+ +  D     +++  ++D +     CL         + +  +    + P L+GI R  GR + + + ++S+LFP  S +++K       +  +   D+    S++   + +  +G++ KR   +  S             +P+         + S +P              YF             + S+L PDGS    +Y L  I S++ S +P      ++N   D            ++L+ +++++K++++  F++  D +      +N ++   YK++S PL + +  +LRD + N    + +     ++ +   V  Q N+       EL K  L+D      LN+ L+       +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +      Q+G N IK+   N +   ST      K  + +M +E++RD AI ++CR L    T DP  ++ FLA LS R + + E+++D  L+  +T+  LG + V L+D     + +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:    2 CPV-DYHGVFQLDERRRDALIALGIFLVESDLQHKETVVPYLLRLLRGLPKVQWIEESNSRKGKGTLPVAETFSFCLVTLLSDVAHRDLSFREQILEAVLDVM----QCLLGMCQSPQIQDKEYLCKYAV-PCLIGISRAFGRYSNTEESLLSKLFPKVSPQSLKAPEELEGIRRRSFNDFR---SILPSSLLTVCQGDSLKRKASSVSSGSQV---------SPDRIVPPPGSPAGSTIP--------------YF-------------EGSYL-PDGSAVDPDYYLTTISSSF-SVSP--LFTGVNNKEFD---------MPQDTLRQLLHMVKQIVADPFLSSLDMLISEVTEANPSVDLYYKTFSDPLYVAVFKMLRDTLYN----VKDPHTSFVKEIHDFVLEQFNSS----QGELQKI-LHDM---DRLNNELSP------LKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYH-SQYQTGANDIKISVTN-EHSESTMNIMSGKKSQASM-YEQLRDIAIDNICRCLKAGLTIDPVIVEAFLASLSNRLYISQENEKDAHLIPDHTIRALGHIAVALRDTPKVMQPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 644          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Xenopus
Match: cobl (cordon-bleu WH2 repeat protein [Source:Xenbase;Acc:XB-GENE-490658])

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 690/1501 (45.97%), Postives = 957/1501 (63.76%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX-----XXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQG+  + DLL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL+++++ +I L+    E+S L+ K++     +L+SVYRLE + V H+ D +    +F Y ED  I KDK GM  C+  +  K+FE ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  +    QH GLA+AT+++L  AGY++Q+       T   TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM++ ++D       L   + K    A D C     +  +                  +F++ AL+ IS      +LLH LCWAPL  FT   ME  +ACW WLLAAK+   + F+ EM  AWQ T++ KIG+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RSLS         L++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  +              V  +  DP+ N  S S ++ +N  ++N   T  S  R  ++      Y   SG ++I  +KKS L  K    T     + + Y+K+R L+L LLA EI+RL+ W N   + + E +  G + V NW  K   + ++ W++   LAW +SP LA+ LP+RFK +E +  E+ +LV+ +P  V   PEA+++L T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN++ DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+PFPKG +R++ACL +L ++++QPGCYLPSNP+AIVL+IDY SG PLQSAAKAPYLAKFKVKRCGV  LEKE +   S +  ++E +G   +                                 +  QA IFKVGDD RQD++ L       NI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+  ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF+P  ++REAAN  L+V++ C    R+ TYD IQY+QN IPY
Sbjct:  637 DHGYRHCSLAVINALANIAANIQGEHQIDDLLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELNELRSTIINLLDPAPEVSALINKLDFAMSTYLLSVYRLEHMRVLHATDKDRFQVMFFYFEDKAIQKDKSGMMQCVIAVADKVFEAFLNVMADKPKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPSVTKSHLQEYLNKHQNWMSGLSQHTGLAMATESILHFAGYNRQNT------TLGVTQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVAGMIE-FSDATGRTSDLNRLMLKHLGDALD-CGQPESYTQV------------------MFKLTALL-ISSKECDAQLLHHLCWAPLRMFTDHGMETAIACWDWLLAAKNGIEVPFMREMAGAWQMTVEQKIGLFSAEKKEADPLAASEQSQPRPCAPQVNPHYIWIDFLMQRFEIAKYCSSDQVEIFSSLLQRSLSLNIGGCKGSLNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQTQKLLREDISIMIKFWTAMFSDKKYLTANQL------------VPPDNQDPSVN--SLSVMSDVN--RSNLDVTVGS--RQQTAQGWINTYPLSSGMSTI--SKKSGLAKK----TNRGTQLHKYYMKRRTLLLSLLATEIERLTTWYNPLSSPELELDQTGENSVANWRSKYISLSEKQWKDNVNLAWSISPHLALQLPTRFKNTEAIGGEVTRLVRLDPGAVSDTPEAIKYLVTWHTIDADAPELSHILCWTPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIFLDEEGHQKDPDIGELLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPFPKGEERKKACLNSLSEVKVQPGCYLPSNPEAIVLDIDYTSGTPLQSAAKAPYLAKFKVKRCGVSELEKEGLSCRSDSIDESEEEGGDGK---------------------------------VCWQAAIFKVGDDCRQDLVVLL------NIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESALAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFSPNSTEREAANFILKVIQNCFLSNRSRTYDMIQYYQNDIPY 2045          

HSP 2 Score: 146.362 bits (368), Expect = 3.857e-34
Identity = 187/737 (25.37%), Postives = 342/737 (46.40%), Query Frame = 3
Query:  132 CPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDY-KEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFP--SQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGS----EYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            CP  +  G F L+ + + A++++GI+LVES+L+ K  ++PYLL + + L K + + +      K  L  AE FSF L +LLS+ +  D     +++  ++D +     CL         + +  +    + P L+GI R  GR + + + ++S+LFP  S +++K       +  +   D+    S++   + +  +G++ KR   +  S             +P+         + S +P              YF             + S+L PDGS    +Y L  I S++ S +P      ++N   D            ++L+ ++++++   S    +  D +      +N ++   YK++S PL + +  +LRD + N    + +     ++ +   V  Q N+       EL K  L+D      LN+ L+       +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +      Q+G N IK+   N +   ST      K  + +M +E++RD AI ++CR L    T DP  ++ FLA LS R + + E+++D  L+  +T+  LG + V L+D     + +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:    2 CPV-DYHGVFQLDERRRDALIALGIFLVESDLQHKETVVPYLLRLLRGLPKVQWIEESNSRKGKGTLPVAETFSFCLVTLLSDVAHRDLSFREQILEAVLDVM----QCLLGMCQSPQIQDKEYLCKYAV-PCLIGISRAFGRYSNTEESLLSKLFPKVSPQSLKAPEELEGIRRRSFNDFR---SILPSSLLTVCQGDSLKRKASSVSSGSQV---------SPDRIVPPPGSPAGSTIP--------------YF-------------EGSYL-PDGSAVDPDYYLTTISSSF-SVSP--LFTGVNNKEFD---------MPQDTLRQLLHMVQIFCS---FSSLDMLISEVTEANPSVDLYYKTFSDPLYVAVFKMLRDTLYN----VKDPHTSFVKEIHDFVLEQFNSS----QGELQKI-LHDM---DRLNNELSP------LKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYH-SQYQTGANDIKISVTN-EHSESTMNIMSGKKSQASM-YEQLRDIAIDNICRCLKAGLTIDPVIVEAFLASLSNRLYISQENEKDAHLIPDHTIRALGHIAVALRDTPKVMQPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 641          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Xenopus
Match: cobl (cordon-bleu WH2 repeat protein [Source:Xenbase;Acc:XB-GENE-490658])

HSP 1 Score: 1262.28 bits (3265), Expect = 0.000e+0
Identity = 684/1501 (45.57%), Postives = 947/1501 (63.09%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX-----XXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQG+  + DLL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL+++++ +I L+    E+S L+ K++     +L+SVYRLE + V H+ D +    +F Y ED  I KDK GM  C+  +  K+FE ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  +    QH GLA+AT+++L  AGY++Q+       T   TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM++ ++D       L   + K    A D C     +  +                  +F++ AL+ IS      +LLH LCWAPL  FT   ME  +ACW WLLAAK+   + F+ EM  AWQ T++ KIG+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RSLS         L++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  +                    DP+ N                    + SV+   ++      Y   SG ++I  +KKS L  K    T     + + Y+K+R L+L LLA EI+RL+ W N   + + E +  G + V NW  K   + ++ W++   LAW +SP LA+ LP+RFK +E +  E+ +LV+ +P  V   PEA+++L T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN++ DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+PFPKG +R++ACL +L ++++QPGCYLPSNP+AIVL+IDY SG PLQSAAKAPYLAKFKVKRCGV  LEKE +   S +  ++E +G   +                                 +  QA IFKVGDD RQD++ L       NI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+  ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF+P  ++REAAN  L+V++ C    R+ TYD IQY+QN IPY
Sbjct:  697 DHGYRHCSLAVINALANIAANIQGEHQIDDLLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELNELRSTIINLLDPAPEVSALINKLDFAMSTYLLSVYRLEHMRVLHATDKDRFQVMFFYFEDKAIQKDKSGMMQCVIAVADKVFEAFLNVMADKPKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPSVTKSHLQEYLNKHQNWMSGLSQHTGLAMATESILHFAGYNRQNT------TLGVTQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVAGMIE-FSDATGRTSDLNRLMLKHLGDALD-CGQPESYTQV------------------MFKLTALL-ISSKECDAQLLHHLCWAPLRMFTDHGMETAIACWDWLLAAKNGIEVPFMREMAGAWQMTVEQKIGLFSAEKKEADPLAASEQSQPRPCAPQVNPHYIWIDFLMQRFEIAKYCSSDQVEIFSSLLQRSLSLNIGGCKGSLNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQTQKLLREDISIMIKFWTAMFSDKKYLTANQLVPP---------------DPSVN--------------------SLSVMSDQTAQGWINTYPLSSGMSTI--SKKSGLAKK----TNRGTQLHKYYMKRRTLLLSLLATEIERLTTWYNPLSSPELELDQTGENSVANWRSKYISLSEKQWKDNVNLAWSISPHLALQLPTRFKNTEAIGGEVTRLVRLDPGAVSDTPEAIKYLVTWHTIDADAPELSHILCWTPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIFLDEEGHQKDPDIGELLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPFPKGEERKKACLNSLSEVKVQPGCYLPSNPEAIVLDIDYTSGTPLQSAAKAPYLAKFKVKRCGVSELEKEGLSCRSDSIDESEEEGGDGK---------------------------------VCWQAAIFKVGDDCRQDLVVLL------NIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESALAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFSPNSTEREAANFILKVIQNCFLSNRSRTYDMIQYYQNDIPY 2088          

HSP 2 Score: 168.318 bits (425), Expect = 8.849e-41
Identity = 196/761 (25.76%), Postives = 359/761 (47.17%), Query Frame = 3
Query:   66 LKLARALIYSNEE--DIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDY-KEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFP--SQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGS----EYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L LAR+L        + V+K +C CP  +  G F L+ + + A++++GI+LVES+L+ K  ++PYLL + + L K + + +      K  L  AE FSF L +LLS+ +  D     +++  ++D +     CL         + +  +    + P L+GI R  GR + + + ++S+LFP  S +++K       +  +   D+    S++   + +  +G++ KR   +  S             +P+         + S +P              YF             + S+L PDGS    +Y L  I S++ S +P      ++N   D            ++L+ +++++K++++  F++  D +      +N ++   YK++S PL + +  +LRD + N    + +     ++ +   V  Q N+       EL K  L+D      LN+ L+       +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +      Q+G N IK+   N +   ST      K  + +M +E++RD AI ++CR L    T DP  ++ FLA LS R + + E+++D  L+  +T+  LG + V L+D     + +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:   35 LSLARSLAVQRPAAFEKVQKLLCMCPV-DYHGVFQLDERRRDALIALGIFLVESDLQHKETVVPYLLRLLRGLPKVQWIEESNSRKGKGTLPVAETFSFCLVTLLSDVAHRDLSFREQILEAVLDVM----QCLLGMCQSPQIQDKEYLCKYAV-PCLIGISRAFGRYSNTEESLLSKLFPKVSPQSLKAPEELEGIRRRSFNDFR---SILPSSLLTVCQGDSLKRKASSVSSGSQV---------SPDRIVPPPGSPAGSTIP--------------YF-------------EGSYL-PDGSAVDPDYYLTTISSSF-SVSP--LFTGVNNKEFD---------MPQDTLRQLLHMVKQIVADPFLSSLDMLISEVTEANPSVDLYYKTFSDPLYVAVFKMLRDTLYN----VKDPHTSFVKEIHDFVLEQFNSS----QGELQKI-LHDM---DRLNNELSP------LKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYH-SQYQTGANDIKISVTN-EHSESTMNIMSGKKSQASM-YEQLRDIAIDNICRCLKAGLTIDPVIVEAFLASLSNRLYISQENEKDAHLIPDHTIRALGHIAVALRDTPKVMQPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 701          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Xenopus
Match: cobl (cordon-bleu WH2 repeat protein [Source:Xenbase;Acc:XB-GENE-490658])

HSP 1 Score: 1262.28 bits (3265), Expect = 0.000e+0
Identity = 684/1501 (45.57%), Postives = 947/1501 (63.09%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX-----XXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQG+  + DLL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL+++++ +I L+    E+S L+ K++     +L+SVYRLE + V H+ D +    +F Y ED  I KDK GM  C+  +  K+FE ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  +    QH GLA+AT+++L  AGY++Q+       T   TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM++ ++D       L   + K    A D C     +  +                  +F++ AL+ IS      +LLH LCWAPL  FT   ME  +ACW WLLAAK+   + F+ EM  AWQ T++ KIG+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RSLS         L++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  +                    DP+ N                    + SV+   ++      Y   SG ++I  +KKS L  K    T     + + Y+K+R L+L LLA EI+RL+ W N   + + E +  G + V NW  K   + ++ W++   LAW +SP LA+ LP+RFK +E +  E+ +LV+ +P  V   PEA+++L T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN++ DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+PFPKG +R++ACL +L ++++QPGCYLPSNP+AIVL+IDY SG PLQSAAKAPYLAKFKVKRCGV  LEKE +   S +  ++E +G   +                                 +  QA IFKVGDD RQD++ L       NI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+  ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF+P  ++REAAN  L+V++ C    R+ TYD IQY+QN IPY
Sbjct:  665 DHGYRHCSLAVINALANIAANIQGEHQIDDLLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELNELRSTIINLLDPAPEVSALINKLDFAMSTYLLSVYRLEHMRVLHATDKDRFQVMFFYFEDKAIQKDKSGMMQCVIAVADKVFEAFLNVMADKPKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPSVTKSHLQEYLNKHQNWMSGLSQHTGLAMATESILHFAGYNRQNT------TLGVTQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVAGMIE-FSDATGRTSDLNRLMLKHLGDALD-CGQPESYTQV------------------MFKLTALL-ISSKECDAQLLHHLCWAPLRMFTDHGMETAIACWDWLLAAKNGIEVPFMREMAGAWQMTVEQKIGLFSAEKKEADPLAASEQSQPRPCAPQVNPHYIWIDFLMQRFEIAKYCSSDQVEIFSSLLQRSLSLNIGGCKGSLNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQTQKLLREDISIMIKFWTAMFSDKKYLTANQLVPP---------------DPSVN--------------------SLSVMSDQTAQGWINTYPLSSGMSTI--SKKSGLAKK----TNRGTQLHKYYMKRRTLLLSLLATEIERLTTWYNPLSSPELELDQTGENSVANWRSKYISLSEKQWKDNVNLAWSISPHLALQLPTRFKNTEAIGGEVTRLVRLDPGAVSDTPEAIKYLVTWHTIDADAPELSHILCWTPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIFLDEEGHQKDPDIGELLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPFPKGEERKKACLNSLSEVKVQPGCYLPSNPEAIVLDIDYTSGTPLQSAAKAPYLAKFKVKRCGVSELEKEGLSCRSDSIDESEEEGGDGK---------------------------------VCWQAAIFKVGDDCRQDLVVLL------NIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESALAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFSPNSTEREAANFILKVIQNCFLSNRSRTYDMIQYYQNDIPY 2056          

HSP 2 Score: 137.502 bits (345), Expect = 2.250e-31
Identity = 185/757 (24.44%), Postives = 341/757 (45.05%), Query Frame = 3
Query:   66 LKLARALIYSNEE--DIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDY-KEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFP--SQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGS----EYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L LAR+L        + V+K +C CP  +  G F L+ + + A++++GI+LVES+L+ K  ++PYLL + + L K + + +      K  L  AE FSF L +LLS+ +  D     +++  ++D +     CL         + +  +    + P L+GI R  GR + + + ++S+LFP  S +++K       +  +   D+    S++   + +  +G++ KR   +  S             +P+         + S +P              YF             + S+L PDGS    +Y L  I S++ S +P      ++N   D            ++L+ +++++K++++  F++  D +      +N ++   YK++S PL + +  +LRD + N    + +     ++ +   V  Q N+       EL K  L+D      LN+ L+       +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +      Q+G N IK+   N +   ST      K  + +M +E++RD AI ++C                            RD  L+  +T+  LG + V L+D     + +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:   35 LSLARSLAVQRPAAFEKVQKLLCMCPV-DYHGVFQLDERRRDALIALGIFLVESDLQHKETVVPYLLRLLRGLPKVQWIEESNSRKGKGTLPVAETFSFCLVTLLSDVAHRDLSFREQILEAVLDVM----QCLLGMCQSPQIQDKEYLCKYAV-PCLIGISRAFGRYSNTEESLLSKLFPKVSPQSLKAPEELEGIRRRSFNDFR---SILPSSLLTVCQGDSLKRKASSVSSGSQV---------SPDRIVPPPGSPAGSTIP--------------YF-------------EGSYL-PDGSAVDPDYYLTTISSSF-SVSP--LFTGVNNKEFD---------MPQDTLRQLLHMVKQIVADPFLSSLDMLISEVTEANPSVDLYYKTFSDPLYVAVFKMLRDTLYN----VKDPHTSFVKEIHDFVLEQFNSS----QGELQKI-LHDM---DRLNNELS------PLKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYH-SQYQTGANDIKISVTN-EHSESTMNIMSGKKSQASM-YEQLRDIAIDNIC----------------------------RDAHLIPDHTIRALGHIAVALRDTPKVMQPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 669          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Xenopus
Match: cobl (cordon-bleu WH2 repeat protein [Source:Xenbase;Acc:XB-GENE-490658])

HSP 1 Score: 1261.13 bits (3262), Expect = 0.000e+0
Identity = 684/1501 (45.57%), Postives = 947/1501 (63.09%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX-----XXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQG+  + DLL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL+++++ +I L+    E+S L+ K++     +L+SVYRLE + V H+ D +    +F Y ED  I KDK GM  C+  +  K+FE ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  +    QH GLA+AT+++L  AGY++Q+       T   TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM++ ++D       L   + K    A D C     +  +                  +F++ AL+ IS      +LLH LCWAPL  FT   ME  +ACW WLLAAK+   + F+ EM  AWQ T++ KIG+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RSLS         L++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  +                    DP+ N                    + SV+   ++      Y   SG ++I  +KKS L  K    T     + + Y+K+R L+L LLA EI+RL+ W N   + + E +  G + V NW  K   + ++ W++   LAW +SP LA+ LP+RFK +E +  E+ +LV+ +P  V   PEA+++L T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN++ DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+PFPKG +R++ACL +L ++++QPGCYLPSNP+AIVL+IDY SG PLQSAAKAPYLAKFKVKRCGV  LEKE +   S +  ++E +G   +                                 +  QA IFKVGDD RQD++ L       NI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+  ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF+P  ++REAAN  L+V++ C    R+ TYD IQY+QN IPY
Sbjct:  640 DHGYRHCSLAVINALANIAANIQGEHQIDDLLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELNELRSTIINLLDPAPEVSALINKLDFAMSTYLLSVYRLEHMRVLHATDKDRFQVMFFYFEDKAIQKDKSGMMQCVIAVADKVFEAFLNVMADKPKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPSVTKSHLQEYLNKHQNWMSGLSQHTGLAMATESILHFAGYNRQNT------TLGVTQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVAGMIE-FSDATGRTSDLNRLMLKHLGDALD-CGQPESYTQV------------------MFKLTALL-ISSKECDAQLLHHLCWAPLRMFTDHGMETAIACWDWLLAAKNGIEVPFMREMAGAWQMTVEQKIGLFSAEKKEADPLAASEQSQPRPCAPQVNPHYIWIDFLMQRFEIAKYCSSDQVEIFSSLLQRSLSLNIGGCKGSLNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQTQKLLREDISIMIKFWTAMFSDKKYLTANQLVPP---------------DPSVN--------------------SLSVMSDQTAQGWINTYPLSSGMSTI--SKKSGLAKK----TNRGTQLHKYYMKRRTLLLSLLATEIERLTTWYNPLSSPELELDQTGENSVANWRSKYISLSEKQWKDNVNLAWSISPHLALQLPTRFKNTEAIGGEVTRLVRLDPGAVSDTPEAIKYLVTWHTIDADAPELSHILCWTPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIFLDEEGHQKDPDIGELLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPFPKGEERKKACLNSLSEVKVQPGCYLPSNPEAIVLDIDYTSGTPLQSAAKAPYLAKFKVKRCGVSELEKEGLSCRSDSIDESEEEGGDGK---------------------------------VCWQAAIFKVGDDCRQDLVVLL------NIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESALAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFSPNSTEREAANFILKVIQNCFLSNRSRTYDMIQYYQNDIPY 2031          

HSP 2 Score: 158.303 bits (399), Expect = 1.042e-37
Identity = 188/737 (25.51%), Postives = 347/737 (47.08%), Query Frame = 3
Query:  132 CPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDY-KEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFP--SQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGS----EYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            CP  +  G F L+ + + A++++GI+LVES+L+ K  ++PYLL + + L K + + +      K  L  AE FSF L +LLS+ +  D     +++  ++D +     CL         + +  +    + P L+GI R  GR + + + ++S+LFP  S +++K       +  +   D+    S++   + +  +G++ KR   +  S             +P+         + S +P              YF             + S+L PDGS    +Y L  I S++ S +P      ++N   D            ++L+ +++++K++++  F++  D +      +N ++   YK++S PL + +  +LRD + N    + +     ++ +   V  Q N+       EL K  L+D      LN+ L+       +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +      Q+G N IK+   N +   ST      K  + +M +E++RD AI ++CR L    T DP  ++ FLA LS R + + E+++D  L+  +T+  LG + V L+D     + +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:    2 CPV-DYHGVFQLDERRRDALIALGIFLVESDLQHKETVVPYLLRLLRGLPKVQWIEESNSRKGKGTLPVAETFSFCLVTLLSDVAHRDLSFREQILEAVLDVM----QCLLGMCQSPQIQDKEYLCKYAV-PCLIGISRAFGRYSNTEESLLSKLFPKVSPQSLKAPEELEGIRRRSFNDFR---SILPSSLLTVCQGDSLKRKASSVSSGSQV---------SPDRIVPPPGSPAGSTIP--------------YF-------------EGSYL-PDGSAVDPDYYLTTISSSF-SVSP--LFTGVNNKEFD---------MPQDTLRQLLHMVKQIVADPFLSSLDMLISEVTEANPSVDLYYKTFSDPLYVAVFKMLRDTLYN----VKDPHTSFVKEIHDFVLEQFNSS----QGELQKI-LHDM---DRLNNELSP------LKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYH-SQYQTGANDIKISVTN-EHSESTMNIMSGKKSQASM-YEQLRDIAIDNICRCLKAGLTIDPVIVEAFLASLSNRLYISQENEKDAHLIPDHTIRALGHIAVALRDTPKVMQPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 644          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Mouse
Match: Pi4ka (phosphatidylinositol 4-kinase alpha [Source:MGI Symbol;Acc:MGI:2448506])

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 689/1501 (45.90%), Postives = 947/1501 (63.09%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M    K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY+KQ+    A      TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM+        M D  +N +                 +DL   L   +         ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K+   + F+ EM  AW  T++ K G+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RS+S         +++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LP+RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE ++  S    D E++   Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V++ C    R+ TYD IQY+QN IPY
Sbjct:  641 DHGYRHCSLAVINALANIAANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMAEKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGA------TQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVHGMIRFSGATGQMSD--LNKM---------------MVQDLITALDHSHP---QHYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKNGVEVPFMREMAGAWHMTVEQKFGLFSVETKEADPLAASEASQPRPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGGARGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------TVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLQCRS----DAEDECFSQEA----------------------------DGKKICWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQNCFLSNRSRTYDMIQYYQNDIPY 2044          

HSP 2 Score: 125.176 bits (313), Expect = 8.810e-28
Identity = 112/414 (27.05%), Postives = 198/414 (47.83%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + +N +    Y ++S PL L +  +LRD +   Y K          S +KE+      +      EL K           L+    +HS    +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      + IK+   N    ++      ++ Q        ++E++RD AI ++CR L    T DP  ++ FLA LS R + + ESD+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  271 LRELLNLVKKIVEEPVLKSLDAIVAGVMEANPSADLYYTTFSDPLYLTMFKMLRDTLY--YMK------DLPTSFVKEIHDFVLEQFNMSQGELQKI----------LHDADRIHSEMSPLKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGSDIKISVTNEHSESTLNVLPGKKNQ------PSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 645          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Mouse
Match: Pi4ka (phosphatidylinositol 4-kinase alpha [Source:MGI Symbol;Acc:MGI:2448506])

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 689/1501 (45.90%), Postives = 947/1501 (63.09%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M    K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY+KQ+    A      TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM+        M D  +N +                 +DL   L   +         ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K+   + F+ EM  AW  T++ K G+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RS+S         +++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LP+RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE ++  S    D E++   Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V++ C    R+ TYD IQY+QN IPY
Sbjct:  641 DHGYRHCSLAVINALANIAANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMAEKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGA------TQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVHGMIRFSGATGQMSD--LNKM---------------MVQDLITALDHSHP---QHYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKNGVEVPFMREMAGAWHMTVEQKFGLFSVETKEADPLAASEASQPRPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGGARGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------TVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLQCRS----DAEDECFSQEA----------------------------DGKKICWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQNCFLSNRSRTYDMIQYYQNDIPY 2044          

HSP 2 Score: 125.176 bits (313), Expect = 8.810e-28
Identity = 112/414 (27.05%), Postives = 198/414 (47.83%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + +N +    Y ++S PL L +  +LRD +   Y K          S +KE+      +      EL K           L+    +HS    +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      + IK+   N    ++      ++ Q        ++E++RD AI ++CR L    T DP  ++ FLA LS R + + ESD+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  271 LRELLNLVKKIVEEPVLKSLDAIVAGVMEANPSADLYYTTFSDPLYLTMFKMLRDTLY--YMK------DLPTSFVKEIHDFVLEQFNMSQGELQKI----------LHDADRIHSEMSPLKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGSDIKISVTNEHSESTLNVLPGKKNQ------PSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 645          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Mouse
Match: Pi4ka (phosphatidylinositol 4-kinase alpha [Source:MGI Symbol;Acc:MGI:2448506])

HSP 1 Score: 279.256 bits (713), Expect = 1.140e-83
Identity = 149/350 (42.57%), Postives = 208/350 (59.43%), Query Frame = 1
Query: 2458 YVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILK 3477
            +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D                  D+F                   + K +E+ LER      HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K
Sbjct:    2 FVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDP-----------------DRFQA-----------------KTKENEEELER------HAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNK 311          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Mouse
Match: Pi4kb (phosphatidylinositol 4-kinase beta [Source:MGI Symbol;Acc:MGI:1334433])

HSP 1 Score: 193.356 bits (490), Expect = 5.032e-52
Identity = 105/258 (40.70%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G  TT ++  A+RNFV S A Y +VCYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG ++   F +++ L +Q  +  R + + +V +V +M   S LPCF G  TI+ L++RF   M++ +      +++           YD  QY  N I
Sbjct:  228 SVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSP-RNLGFETSAFKLTTEFVDVMGG-LNGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGI 483          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Mouse
Match: Pi4kb (phosphatidylinositol 4-kinase beta [Source:MGI Symbol;Acc:MGI:1334433])

HSP 1 Score: 194.126 bits (492), Expect = 4.902e-50
Identity = 105/258 (40.70%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G  TT ++  A+RNFV S A Y +VCYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG ++   F +++ L +Q  +  R + + +V +V +M   S LPCF G  TI+ L++RF   M++ +      +++           YD  QY  N I
Sbjct:  545 SVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSP-RNLGFETSAFKLTTEFVDVMGG-LNGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGI 800          
BLAST of Phosphatidylinositol 4-kinase alpha vs. UniProt/SwissProt
Match: sp|O02811|PI4KA_BOVIN (Phosphatidylinositol 4-kinase alpha OS=Bos taurus OX=9913 GN=PI4KA PE=2 SV=2)

HSP 1 Score: 1288.86 bits (3334), Expect = 0.000e+0
Identity = 697/1505 (46.31%), Postives = 951/1505 (63.19%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGML---DAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQHMN--ENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I E  PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ ++ L+    E+S L+ K++     +L+SVYRLE + V  S+D      +F Y ED  I KDK GM  C+  +  K+F+ ++  M    K  E E  ++ HAQFLLV FNHV KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT++VL  AGY+KQS    A      TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM+   DA    + +   +V ++K   L A D                +QY         ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K+   + F+ EM  AWQ T++ K G+F+ +++E  PL   E  + KP      PH IW  FL +R  +A+  S  QVEI   L+ RSLS      +  +++  +AIG RF++L++    L H +   N+  ++VLREK+Y++ F YFS  PR+  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G S V NW  K   + ++ W++   LAW +SP LAV LP+RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D E +G+ Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GH+IHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  L+V++ C    R+ TYD IQY+QN IPY
Sbjct:  699 DHGYRHCSLAVINALANIAANIQDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEPKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIVNLLDPAPEVSALIGKLDFAMSTYLLSVYRLEYMRVLRSSDPARFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMAEKAKTKENEEELERHAQFLLVSFNHVHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDVPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLSKHQNWVSGLSQHTGLAMATESVLHYAGYNKQSTSLGA------TQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVYGMIRFSDATGHTSDLNKMMVQELKA-ALGAGD---------------AQQYTQ-------AMFKLTA-MLISSRDCDPQLLHHLCWGPLQMFNEHGMETALACWEWLLAGKNGVEVPFMREMAGAWQMTVEQKFGLFSAEMKEADPLAASEASQPKPCAPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFCSLLQRSLSLSIGGTAGSMNRHVAAIGPRFKLLTL-GLSLLHADVLPNATIRNVLREKIYSTAFDYFSCPPRFPTQGEKRLREDISVMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------AVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGESSVANWRSKYISLSEKQWKDNVNLAWSISPHLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPADPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASQSQLLAHQFIWNMKTNIYVDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRS----DPEEEGSMQEA----------------------------DGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHLIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFILKVIQNCFLSNRSRTYDMIQYYQNDIPY 2102          

HSP 2 Score: 123.635 bits (309), Expect = 1.859e-26
Identity = 114/410 (27.80%), Postives = 200/410 (48.78%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + ++ +    Y ++S PL + +L +LRD +      + +     ++ V   V  Q N+       EL K           L+     HS    +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      N IK+   N +   ST      K  + +M +E++RD AI ++CR L    T DP  ++ FLA LS R + + ESD+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  329 LRELLNLVKKIVEEPVLKSLDAVVTGVIEASPSADLCYGAFSDPLYVAVLRMLRDTLYY----MRDLPTSFVKEVHDFVLEQFNSS----QGELQKI----------LHDADRAHSELSPLKLRCQASA--------ACVDLMVW----AVKDEQGAENLCVKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVVPSPVLVKLYKCHSQYHTVAGNDIKISVTN-EHAESTLNVASGKKSQPSM-YEQLRDIAIDNVCRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 703          
BLAST of Phosphatidylinositol 4-kinase alpha vs. UniProt/SwissProt
Match: sp|P42356|PI4KA_HUMAN (Phosphatidylinositol 4-kinase alpha OS=Homo sapiens OX=9606 GN=PI4KA PE=1 SV=4)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 691/1501 (46.04%), Postives = 952/1501 (63.42%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY+KQ+    A      TQLS+ +P+  +K D S+FMA+LNLR+RY GE+ GM+        M D  +N +                 +DL   L + +         ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K    + F+ EM  AW  T++ K G+F+ +++E  PL   E  + KP      PH IW  FL +R  +A+  S  QVEI S L+ RS+S         +++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LP+RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  L+ ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D+E++ + Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V+++C    R+ TYD IQY+QN IPY
Sbjct:  699 DHGYRHCSLAVINALANIAANIQDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGA------TQLSE-RPA-CVKKDYSNFMASLNLRNRYAGEVYGMIRFSGTTGQMSD--LNKM---------------MVQDLHSALDRSHP---QHYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKDGVEVPFMREMAGAWHMTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------TVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLDQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRS----DSEDECSTQEA----------------------------DGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDIPY 2102          

HSP 2 Score: 125.946 bits (315), Expect = 3.071e-27
Identity = 113/414 (27.29%), Postives = 199/414 (48.07%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + +N +    Y S+S PL L +  +LRD +   Y K          S +KE+      +      EL K           L+    +H+    +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      N IK+   N    ++    + ++ Q        ++E++RD AI ++CR L    T DP  ++ FLA LS R + + ESD+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  329 LRELLNLVKKIVEEAVLKSLDAIVASVMEANPSADLYYTSFSDPLYLTMFKMLRDTLY--YMK------DLPTSFVKEIHDFVLEQFNTSQGELQKI----------LHDADRIHNELSPLKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGNDIKISVTNEHSESTLNVMSGKKSQ------PSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 703          
BLAST of Phosphatidylinositol 4-kinase alpha vs. UniProt/SwissProt
Match: sp|O08662|PI4KA_RAT (Phosphatidylinositol 4-kinase alpha OS=Rattus norvegicus OX=10116 GN=Pi4ka PE=1 SV=2)

HSP 1 Score: 1280 bits (3311), Expect = 0.000e+0
Identity = 689/1501 (45.90%), Postives = 950/1501 (63.29%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL+++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M    K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY+KQ+       T   TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM+        M D  +N +                 +DL   L   +         ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K+   + F+ EM  AW  T++ K G+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RS+S         +++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LP+RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE ++  S    DTE++  +Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  +++++ C    R+ TYD IQY+QN IPY
Sbjct:  693 DHGYRHCSLAVINALANIAANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELNELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMAEKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNT------TLGVTQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVHGMIRFSGATGQMSD--LNKM---------------MVQDLITALDHSHP---QHYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKNGVEVPFMREMAGAWHMTVEQKFGLFSAETKEADPLAASEASQPRPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLHIGGARGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------TVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWTISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLQCRS----DTEDECRRQEA----------------------------DGKKICWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKIIQNCFLSNRSRTYDMIQYYQNDIPY 2096          

HSP 2 Score: 124.405 bits (311), Expect = 1.112e-26
Identity = 111/414 (26.81%), Postives = 197/414 (47.58%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D      + +N +    Y ++S P+ L +  +LRD +   Y K          S +KE+      +      EL K           L+    +HS    +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      + IK+   N    ++      ++ Q        ++E++RD AI ++CR L    T DP  ++ FLA LS R + + ESD+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  323 LRELLNLVKKIVEEPVLKSLDAAVARVMEANPSADLYYTTFSDPVYLTMFKMLRDTLY--YMK------DLPTSFVKEIHDFVLEQFNMSQGELQKI----------LHDADRIHSEMSPLKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGSDIKISVTNEHSESTLNVLPGKKNQ------PSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 697          

HSP 3 Score: 64.6994 bits (156), Expect = 1.416e-8
Identity = 52/198 (26.26%), Postives = 92/198 (46.46%), Query Frame = 3
Query:   66 LKLARALIYSNEEDI--VKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQI------------------YPSLLGIIRGIGRVAFSADGIVSRLFP 599
            L LAR+L       +  V+K +C CP  +  G F L+ + + A++++GI+L+ES+L+ K+ I+PYLL + + L K   V         E S A                  N    +  S  + +L++   C + +   ++ EA LQ++++ +                   P L+GI R  GR + S + ++S+LFP
Sbjct:   30 LSLARSLAVQRPASLEKVQKLLCMCPV-DFHGIFQLDERRRDAVIALGIFLIESDLQHKDCIVPYLLRLLRGLPKVYWV---------EESTAR-------------KGRGNLPVAESFSFCLVTLLSDVACRDPSLRDEILEALLQVLHVLLGMCQALEIQEKEYLCKYAIPCLIGISRSFGRYSNSEESLLSKLFP 204          
BLAST of Phosphatidylinositol 4-kinase alpha vs. UniProt/SwissProt
Match: sp|E9Q3L2|PI4KA_MOUSE (Phosphatidylinositol 4-kinase alpha OS=Mus musculus OX=10090 GN=Pi4ka PE=1 SV=2)

HSP 1 Score: 1276.92 bits (3303), Expect = 0.000e+0
Identity = 689/1501 (45.90%), Postives = 947/1501 (63.09%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M    K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY+KQ+    A      TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM+        M     +D+ K               +DL   L   +         ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K+   + F+ EM  AW  T++ K G+F+ + +E  PL   E  + +P      PH IW  FL +R  +A+  S  QVEI S L+ RS+S         +++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LP+RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE ++  S    D E++   Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V++ C    R+ TYD IQY+QN IPY
Sbjct:  702 DHGYRHCSLAVINALANIAANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMAEKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGA------TQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVHGMIRFSGATGQM-----SDLNK------------MMVQDLITALDHSHP---QHYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKNGVEVPFMREMAGAWHMTVEQKFGLFSVETKEADPLAASEASQPRPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGGARGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------TVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAAKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLQCRS----DAEDECFSQEA----------------------------DGKKICWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQNCFLSNRSRTYDMIQYYQNDIPY 2105          

HSP 2 Score: 124.79 bits (312), Expect = 7.188e-27
Identity = 112/414 (27.05%), Postives = 198/414 (47.83%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + +N +    Y ++S PL L +  +LRD +   Y K          S +KE+      +      EL K           L+    +HS    +   C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      + IK+   N    ++      ++ Q        ++E++RD AI ++CR L    T DP  ++ FLA LS R + + ESD+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  332 LRELLNLVKKIVEEPVLKSLDAIVAGVMEANPSADLYYTTFSDPLYLTMFKMLRDTLY--YMK------DLPTSFVKEIHDFVLEQFNMSQGELQKI----------LHDADRIHSEMSPLKLRCQANA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGSDIKISVTNEHSESTLNVLPGKKNQ------PSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 706          
BLAST of Phosphatidylinositol 4-kinase alpha vs. UniProt/SwissProt
Match: sp|A4QPH2|PI4P2_HUMAN (Putative phosphatidylinositol 4-kinase alpha-like protein P2 OS=Homo sapiens OX=9606 GN=PI4KAP2 PE=5 SV=3)

HSP 1 Score: 511.146 bits (1315), Expect = 4.129e-160
Identity = 255/470 (54.26%), Postives = 328/470 (69.79%), Query Frame = 1
Query: 5464 TNMYKDED----GQIKDP-DIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQ--------------------DILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVL---RPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            T M+ D+      Q+  P DIG  LE ++EE   S SGP+  F +R FDFF+KITNVS VI+P+PKG +R++ACL AL ++ +QPGC LPSNP+AIVL++DY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D+E++ + Q                                  I  QA IFK+GDD RQ                    D+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ VQA  +     PY + +V+LV++MLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V+++C    R+ TY+ IQY+QN IPY
Sbjct:  155 TAMFSDKKYLTASQLVPPADIGDLLEQLVEENTGSLSGPAKDFYQRGFDFFNKITNVSAVIKPYPKGDERKKACLSALSEVTVQPGCSLPSNPEAIVLDVDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRS----DSEDECSTQE----------------------------ADGQKISWQAAIFKLGDDCRQKSYWGARMPTDRILRLPASQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVQATWLCGEPGPYMDVVVSLVTIMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYNMIQYYQNDIPY 592          

HSP 2 Score: 98.5969 bits (244), Expect = 2.427e-19
Identity = 64/173 (36.99%), Postives = 101/173 (58.38%), Query Frame = 1
Query: 4081 TIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMD 4581
            T++ K G+F+ +++E  PL   E  + KP      PH IW  FL +R  +A+  S  QVEI S L+ RS+S         +++  +AIG RF++L++GLS+L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S      D
Sbjct:    2 TVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGRAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQLVPPAD 174          
BLAST of Phosphatidylinositol 4-kinase alpha vs. TrEMBL
Match: R7UPJ7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_184437 PE=3 SV=1)

HSP 1 Score: 1382.08 bits (3576), Expect = 0.000e+0
Identity = 717/1494 (47.99%), Postives = 1010/1494 (67.60%), Query Frame = 1
Query: 2350 NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTN---IKNS-IAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVP-RTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYND-MNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLV-----IRXXXXXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNY-NHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            + RH+S+SV++ F NIAANIQG+EAL +LL RLLE +V L LE +R  + N   +K S  AGNLG +IPVIA++++RL  I     RL KLFRDFWLY ++MGFA+ ++ LWP +W+ GVCEIATKSP L+  E L++EL++ S L  +++   E+ +++  +++L+    +I+PL+ K++  Q ++LMSVYRLE+L +++S   EA H +F Y+ED  IMKDK GMW CI  +  + F+ Y++   +  K    ER ++ HAQFLLVKF+HV KR+R +AD+ LT +   FPH++WSG +L TMLDI QLLS  LE+D N+ AP + VP  T   L  +D+  DRE  +NDF      IL+  M+W PH  RSHLI+Y+L+M+ + +   QH GLA+AT++VL  AGY       N S ++L     + +P+  +K +SSSFMANL+LRSRYLGEI+G   A+++    M++++ + +   C    D  P                    ++ + ++FR+  L +I+    +R+LLH +CWAP+ HFT   +E  VACW WLLAA+ D    F+ EM+ AWQ T+D K+G+F +D EE SPL+  E   + PN    + H IW+KFL ER+ VA+  S+ QVEI++ L+     IR  +++S +S+  +A+G RFR+LSMG+S+LQ  +  N++ KSVLREK+Y +   YFS  PR   Q++S+ ++DI+ +I+FW  M S++KYL  S  + D+             + P++  H++ S++ +         G+T S  +++         N  S  +++  +KKS++G +++    +     + Y+KKRNLIL L+A E +    W N    ++ + PG  ++  W + + I ++ W E  R AW ++P LAV LPSRF  SE L +E+ +LV+  P  V HIP+A+ +L T  +IE D PEL ++ TW PV+P+ AL +FSR YP HP++HQYA+K L  YPP+ ++FYVPQLVQ +RYD MGY+TEF+L     S +LAHQL+WNMKTN+++DE+    D  IG QLE++IE+I KS  GP+L F EREFDFF KIT++S +I+PFPKG +R++ACL+AL ++ELQ GCYLPSNP+A+VLEIDY SG P+QSAAKAP+LA+F+VK+CGV+ LE   ++   +T    E+          S+T  T    N + G +H  P    S   ++ QACIFKVGDDVRQD+LALQ+I LF+N++++ G+D YL PYRVVATSPGCGVIECVPDSKSRDQIGR TD  MY YFL+ +GDE+TP++Q ARRNF+ SMA YSV+ +LLQIKDRHNGNIMLD  GH+IHIDFGF+FESSPG N+G+EPDIKLT EMVM+MGG +D+P F+WFE+L VQ YL LR Y+EAI+ +VSLMLD+GLPCFRG TIK L+ RF P  ++REAAN+ L+V+R C   WR  TYD IQY+QN+IPY
Sbjct:  677 SFRHVSQSVINAFANIAANIQGEEALNELLIRLLELFVQLGLEGKRASEKNPGALKASNSAGNLGVLIPVIAVLIRRLPPITHPKARLAKLFRDFWLYCIVMGFAE-ESVLWPEDWFRGVCEIATKSPRLIPKEHLRAELQYTSVLKGDSVAPAEISELRNHILRLLEYAPDITPLVNKLDFGQCSYLMSVYRLETLRIQNSCSPEAFHGMFIYLEDTAIMKDKAGMWRCIAAVLKRAFKIYLEHKADMPKTEALERELENHAQFLLVKFSHVLKRIRHVADSCLTSLVDKFPHLLWSGKILCTMLDILQLLSSCLEMDPNERAPEFAVPGTTGCTLRAMDNMADRETTVNDFASRSVGILQEAMRWAPHTTRSHLIEYLLRMDNTSQGLNQHSGLALATESVLNYAGY-------NRSSSSLGASTLERRPN-CVKKNSSSFMANLSLRSRYLGEIEGWRVAFSEGQKSMVNKMCSLLDSSC---SDTDP--------------------DQFKQAIFRVTGL-IITTEAANRQLLHSICWAPVRHFTESSLEAAVACWEWLLAARPDLSSQFMQEMSAAWQTTVDLKLGMFAEDPEEQSPLVHVEGDTITPNPPFVMAHNIWTKFLAERVEVARYCSQDQVEIMASLLHKCLAIRVGARTSCISRHPAALGPRFRLLSMGMSLLQGDLLPNTLAKSVLREKIYATALDYFSIKPRPPSQRSSELREDILALIKFWHAMHSDRKYLRPSDVTSDLR------------ISPDHMGHSAASQIGS---------GSTRSAQQYW--------VNTMSNRSTV--SKKSSIGTRKT--GGSKREYVRDYMKKRNLILALVAHEHESFVTWYNPLSLSDMSIPGEENIVKW-RSQSITEKQWHEQTRTAWEIAPALAVFLPSRFMSSESLTKEVTRLVRLQPMAVSHIPDAVHYLVTAHSIEADAPELAHMLTWAPVSPIHALGYFSRQYPPHPISHQYAIKCLRSYPPEAILFYVPQLVQSVRYDTMGYVTEFILWAAKKSQLLAHQLVWNMKTNIFRDEESLEYDEQIGEQLENLIEQIRKSLDGPALKFYEREFDFFHKITDISRIIKPFPKGAERKKACLQALSEVELQAGCYLPSNPEAVVLEIDYKSGTPMQSAAKAPFLARFRVKKCGVRELENLGLKDVPTTLPSVES--------THSLTTLT----NGNDG-QHAAP----SASKVW-QACIFKVGDDVRQDMLALQIIALFRNVVQQIGMDIYLAPYRVVATSPGCGVIECVPDSKSRDQIGRQTDIDMYSYFLTKYGDESTPAFQAARRNFITSMAGYSVLSFLLQIKDRHNGNIMLDSSGHLIHIDFGFLFESSPGGNLGWEPDIKLTDEMVMIMGGSMDAPPFKWFEELCVQGYLALRQYREAILPMVSLMLDTGLPCFRGHTIKQLQARFAPQATEREAANYMLKVIRDCYLSWRGKTYDMIQYYQNKIPY 2085          

HSP 2 Score: 148.288 bits (373), Expect = 1.671e-31
Identity = 124/415 (29.88%), Postives = 210/415 (50.60%), Query Frame = 3
Query: 1077 FSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNK-NISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 2306
            FS++ L+ + NL KKM++K  ++  D M    + S+  +   PY SYS    + +L  L   V   Y  +N+     IQ      +T C   LT  +S    T +     +      LT++S                   + +C+ ++++    SI E  +A+ L  +L+E+I S +   +++I++  +LLA ++    L   FP LA +   TL DFL+NP+ +L+ L++    N  S      +    + E  +   +++    +   I E +R  AI ++CR L    T +   +Q FLA LS R + A  SD ++T +  NT+ T+G + V LKD   T ++VLQ FQQ  +  + PS +   II+QLG MIIAGCP I+Q++M +F  I V+S+ +Y ++  SE++ +R
Sbjct:  296 FSSSQLQGLFNLAKKMLAKEVLSNMDMMAEALVQSDVVDYRFPYSSYSE-TVVLVLVTLLRDVLQTYPDLNQQFIREIQDFAFAQYTACQTRLTDGDS---VTAIKGEKNSVVGPFSLTVYS-------------------VVTCIELMLW----SINEDIEADRLCLKLSEKI-SANYDHRVLIAHHPLLLASIQAFGDLACKFPKLASTINTTLLDFLINPSPILAKLHKYSSNNTSSKTKAGTLSITITAETNNGPSKKKGVRNKMRAIMESLRGAAIDNICRGLRAGLTVNQDCVQAFLASLSSRLYTAEISDMESTFISINTLLTMGHVAVALKDDPNTVKSVLQIFQQ--RFCSPPSQMDVLIIDQLGCMIIAGCPGIHQEVMNMFNKISVESSAAY-SKPGSEKNSFR 679          

HSP 3 Score: 77.0258 bits (188), Expect = 7.791e-10
Identity = 60/196 (30.61%), Postives = 107/196 (54.59%), Query Frame = 3
Query:   30 MTTQNYILNSPYLKLARALIY--SNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQET 611
            M T N   +   L LAR+L    S  +  V+  +  CPK + SG F L+ + Q A++++G+YL+ES+L+    I+PYL++V + L K++    +  I  ++L P E FSF L +LLS+    D     ++++  +D L    + L Q A+ ++   +  + + +I P  +G++R +GRV  +     S LFP  ++
Sbjct:    1 MATDNIRFSEVVLHLARSLAAQKSVPKKKVQTLLNLCPKESSSGIFRLDSRAQDAVIALGVYLLESDLQHSEEIVPYLISVLRGLPKAQWAYGHSAIYPNKLPPCERFSFCLNTLLSDVVYRDKSLQEQILTTQIDVLHV-LSLLTQGAH-EIPPGEHVLCHEKI-PIFIGMVRALGRVPGTNTPFFSLLFPEPQS 193          
BLAST of Phosphatidylinositol 4-kinase alpha vs. TrEMBL
Match: A0A1S3HRA2 (phosphatidylinositol 4-kinase alpha OS=Lingula unguis OX=7574 GN=LOC106157120 PE=3 SV=1)

HSP 1 Score: 1351.27 bits (3496), Expect = 0.000e+0
Identity = 718/1492 (48.12%), Postives = 973/1492 (65.21%), Query Frame = 1
Query: 2356 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK----NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAY-NDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLV-----IRXXXXXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLN-TINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSI-LTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            RH+S +V++ + NIAA++Q D  L DLL+ LLE +V L LE +R  +   +     + AGNLG +IPVIA+++KRL  I +   RL KLFRDFW Y V++GFA  D+  WP EW+EG+CEIA KSPLLL  E L+SEL +NSAL  +++   +L+++K ++   +    +  P++ K++ +Q+ +L+SVY+LE+L V +S+D  A   IF+Y+EDG I+KDK GMW CI  +  + F+ ++  M    K   RE+ ++ H QF LVKFNHV +++R +ADT+LT +   FP ++ SGT+L TMLDI QLLS  LEVD NQ AP   V  T   L I+D+  DRE  +NDF   C  IL+  M+W P+  RS LI+Y+L++E S      H GLA+AT++VL  AGY++Q+    A +  LT  LS+ +P+  + +DSS+FM+  +LRSRY GE+ GM  A+  D   +I  L   + + C+        + + ED                + SLFR+ AL+ IS     R+LLH +CWAP+  FT   M   VACW WLLAA+ D  L  + EM  AWQ T+D ++G+F+ D  E SPL   E+   KP   +  PH +W KF QER+ +A+  S  QV+I   L+     I     +  +S+  +++G R R+L++GLS++Q  +  +S  K VLRE++Y +T  YFS  PR+  Q+ SD +DDI+ ++++W+ M S++KYL  SS             V   G+  NY+ +  + L+ T   M++ S  +  S +         + +   S ++++++  K + GG++S   +       + YIKKRN IL LLA E +RL  W+N   + +   P    +  W +  Q+ ++ ++E A  AW +SP LAV LP RF+ SE L  E+ +LV+ NP+ V HIP A+Q+L T   +E D PEL ++  W P  P  ALS+FSR+YP HPLT QYAVKVL  YP D L+FY+PQLVQ +RYDKMGY+ EF++     S +LAHQL+WNMKTN++ DEDG +KDPDIG  LE +IE I KS SGP+L F EREF FFDKITNVS  IRP+PKGP+R+ ACL AL KI+LQPGCYLPSNP+A+VLEIDY SG P+QSAAKAPYLA+FKVKR GVQ LE   ++   S                               GV+  + NT    D++Y Q CIFKVGDDVRQD+LALQ+I L KNI +  G+D YL PYRVVAT+PGCGVIECVPDSKSRDQIGR TD GMY YF+  +GDE+TP +Q ARRNF++SMASYSV+CYLLQIKDRHNGN+ML+  GH+IHIDFGF+FESSPG N+GFEPD KLT EMVM+MG K+++  FQWF +L VQA+L +RPY+EAIVALVSLMLD+GLPCFRGQTIKLLRQRF P  +++EAA H   V++ C  +WRA TYD+IQY QN IPY
Sbjct:  682 RHVSGAVINAYANIAASLQEDSDLYDLLAGLLELFVQLGLEGKRASEKTSQVLKATASAGNLGVLIPVIAMVVKRLPPIKQPKNRLLKLFRDFWNYCVVLGFAVEDSGFWPKEWFEGLCEIACKSPLLLSREHLRSELLYNSALRDDSVAPAKLNELKGEICAQLEHPPDAVPVINKLSFSQLTYLLSVYKLETLRVAYSDDPLAFQLIFQYLEDGTILKDKAGMWYCIQAVADQSFKMFLNVMAEKPKTEAREKELEMHGQFFLVKFNHVHRKIRKLADTYLTGLFNRFPSLLLSGTILTTMLDILQLLSLSLEVDPNQEAPELKVQNTPHTLRIMDNLDDRESTVNDFAARCTDILKEVMKWAPNAARSFLIEYLLQLENSQFGLSLHSGLALATESVLKYAGYNRQA----APLGTLT--LSR-RPA-CVTNDSSTFMSYFSLRSRYTGEVHGMKAAFQGDDKALIKLLCRQLDQACM--------ENKIEDF---------------RQSLFRVTALL-ISNEGSDRQLLHHVCWAPVKVFTESAMSAAVACWDWLLAARPDLNLQVMQEMACAWQMTMDLRLGMFSVDKPETSPLAASENHIPKPQPPDVSPHLLWIKFFQERIEIAKYCSNDQVDIFVSLLNKSLSISVGKPNHVMSRHIASLGARLRLLNIGLSLVQGDIMPSSHSKGVLRERIYAATLDYFSVAPRWPTQQGSDLRDDILALVKYWTSMHSDRKYLQVSS-------------VFPTGVSENYDASGQNMLSLTPTDMRSGSEFSQRSHV-------PQQGWINMSLSSNMSTISKRSSGGRKSRGRSIGRSGYVKDYIKKRNYILSLLANEAERLITWHNPLQQQDLFVPDEDKIAAW-RNTQVTEKQYKEMANWAWEISPALAVMLPLRFQNSESLVREVTRLVRLNPDAVSHIPSAIQYLVTTETVERDSPELTHILNWAPAPPTTALSYFSRLYPAHPLTAQYAVKVLRSYPHDALLFYIPQLVQALRYDKMGYMQEFIMWASQKSQLLAHQLLWNMKTNIFMDEDGSVKDPDIGDLLEELIERICKSLSGPALKFYEREFAFFDKITNVSAEIRPYPKGPERKSACLNALSKIQLQPGCYLPSNPEAVVLEIDYNSGTPMQSAAKAPYLARFKVKRTGVQELENLGLQEQDS-------------------------------GVDSDR-NT---QDDLYWQGCIFKVGDDVRQDMLALQIIGLVKNIFQLIGMDLYLAPYRVVATAPGCGVIECVPDSKSRDQIGRQTDIGMYTYFIDKYGDESTPKFQAARRNFIISMASYSVICYLLQIKDRHNGNLMLNSKGHLIHIDFGFLFESSPGGNLGFEPDFKLTDEMVMIMGNKMEAAPFQWFMELCVQAFLAVRPYREAIVALVSLMLDTGLPCFRGQTIKLLRQRFCPEATEKEAAIHMSNVVKNCYSNWRAKTYDWIQYKQNLIPY 2085          

HSP 2 Score: 146.362 bits (368), Expect = 6.483e-31
Identity = 116/407 (28.50%), Postives = 206/407 (50.61%), Query Frame = 3
Query: 1077 FSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELT----QYNSELNKTG-LNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLL-NRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQ----RLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK 2255
            FS++ ++ ++   +K++SK  +   D         +++   PYKS+S  + L L+ +LRDI+ +  + +       +Q  +K V+     +L      +  +  K G +N F  T   NS                           +C+ ++ +    ++ +  +AE+LL +RLTER+ S     ++++++  +L+  L+    + + FP LA + + +L DF++NP+ +++ LNR+     +K +      +  E+   K     S+ R     +     E +RDTAI ++CR L    T DP  +Q FLA LS R + +  SDRD+ ++  NT+  LG + V LKD   T E+VLQ FQQ  +  N PS+  + I++QLG MIIAGCP+I QQ++ +F  I ++
Sbjct:  300 FSSSDVQLLLTWARKLLSKEKLQSIDVAASSLFAGSQHQRFPYKSFSETISLVLVAMLRDILKHN-KDLAATFTKEVQEFVKVVYKSGQKDLLSRQHDHGEKAEKRGEVNPFSLTVASNS---------------------------ACIELLFW----AVQDETEAETLLYSRLTERL-STPIEFKVLMAHYPLLVVCLQALGRMAEKFPTLANTTIISLRDFMVNPSPIIAKLNRRLTDDGVKKVGDLSITVTDESKPIKPQVGKSKSRN----KVAAAMENLRDTAIENVCRALKAGLTIDPDCVQAFLASLSNRLYISESSDRDSNVITHNTILLLGHVAVSLKDTPKTAESVLQVFQQ--RFCNPPSNFDKLIVDQLGCMIIAGCPSIQQQVLDMFKMISIE 667          
BLAST of Phosphatidylinositol 4-kinase alpha vs. TrEMBL
Match: A0A1S3HP62 (phosphatidylinositol 4-kinase alpha-like OS=Lingula unguis OX=7574 GN=LOC106156926 PE=3 SV=1)

HSP 1 Score: 1349.73 bits (3492), Expect = 0.000e+0
Identity = 715/1492 (47.92%), Postives = 971/1492 (65.08%), Query Frame = 1
Query: 2356 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK----NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAY-NDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLV-----IRXXXXXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLN-TINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSI-LTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            RH+S +V++ + NIAA++Q D  L DLL+ LLE +V L LE +R  +   +     + AGNLG +IPVIA+++KRL  I +   RL KLFRDFW Y V++GFA  D+  WP EW+EG+CEIA KSPLLL  E L+SEL +NSAL  +++   +L+++K ++   +    +  P++ K++ +Q+ +L+SVY+LE+L V +S+D  A   IF+Y+EDG I+KDK GMW CI  +  + F+ ++  M    K   RE+ ++ H QF LVKFNHV +++R +ADT+LT +   FP ++ SGT+L TMLDI QLLS  LEVD NQ AP   V  T   L I+D+  DRE  +NDF   C  IL+  M+W P+  RS LI+Y+L++E S      H GLA+AT++VL  AGY++Q+    A +  LT  LS+ +P+  + +DSS+FM+  +LRSRY GE+ GM  A+  D   ++  L   + + C+        + + ED                + SLFR+ AL+ IS     R+LLH +CWAP+  FT   M   VACW WLLAA+ D  L  + EM  AWQ T+D ++G+F+ D  E SPL   E+   KP   +  PH +W KF QER+ +A+  S  QV+I   L+     I     +  +S+  +++G R R+L++GLS++Q  +  +S  K VLRE++Y +T  YFS  PR+  Q+ SD +DDI+ ++++W+ M S++KYL  SS             V   G+  NY+    + L+ T   M++ S  +  S +         + +   S ++++++  K + GG++S   +       + YIKKRN IL LLA E +RL  W+N   + +   P    +  W +  Q+ ++ ++E A  AW +SP LAV LP RF+ SE L  E+ +LV+ NP+ V HIP A+Q+L T   +E D PEL ++  W P  P  ALS+FSR+YP HPLT QYAVKVL  YP D L+FY+PQLVQ +RYDKMGY+ EF++     S +LAHQL+WNMKTN++ DEDG +KDPDIG  LE +IE I KS SGP+L F EREF FFDKITNVS  IRP+PKGP+R+ ACL AL KI+LQPGCYLPSNP+A+VLEIDY SG P+QSAAKAPYLA+FKVKR GVQ LE   ++   +  VD+E                                    + D++Y Q CIFKVGDDVRQD+LALQ+I L KNI +  G+D YL PYRVVAT+PGCGVIECVPDSKSRDQIGR TD GMY YF+  +GDE+TP +Q ARRNF++SMASYSV+CYLLQIKDRHNGN+ML+  GH+IHIDFGF+FESSPG N+GFEPD KLT EMVM+MG K+++  FQWF +L VQA+L +RPY+EAIVALVSLMLD+GLPCFRGQTIKLLRQRF P  +++EAA H   V++ C  +WRA TYD+IQY QN IPY
Sbjct:  682 RHVSGAVINAYANIAASLQEDSDLYDLLAGLLELFVQLGLEGKRASEKTSQVLKATASAGNLGVLIPVIAMVVKRLPPIKQPKNRLLKLFRDFWNYCVVLGFAVEDSGFWPKEWFEGLCEIACKSPLLLSREHLRSELLYNSALRDDSVAPAKLNELKGEICAQLEHPPDAVPVINKLSFSQLTYLLSVYKLETLRVAYSDDPLAFQLIFQYLEDGTILKDKAGMWYCIQAVADQSFKMFLNVMAEKPKTEAREKELEMHGQFFLVKFNHVHRKIRKLADTYLTGLFNRFPSLLLSGTILTTMLDILQLLSLSLEVDPNQEAPELKVQNTPHTLRIMDNLDDRESTVNDFAARCTDILKEVMKWAPNAARSFLIEYLLQLENSQFGLSLHSGLALATESVLKYAGYNRQA----APLGTLT--LSR-RPA-CVTNDSSTFMSYFSLRSRYTGEVHGMKAAFQGDDKALVKLLCRQLDQACM--------ENKIEDF---------------RQSLFRVTALL-ISNEGSDRQLLHHVCWAPVKVFTESAMSAAVACWDWLLAARPDLNLQVMQEMACAWQMTMDLRLGMFSVDKPETSPLAASENHIPKPQPPDVSPHLLWIKFFQERIEIAKYCSNDQVDIFVSLLNKSLSISVGKPNHVMSRHIASLGARLRLLNIGLSLVQGDIMPSSHSKGVLRERIYAATLDYFSVAPRWPTQQGSDLRDDILALVKYWTSMHSDRKYLQVSS-------------VFPTGVSENYDAGGQNMLSLTPTDMRSGSEFSQRSHV-------PQQGWINMSLSSNMSTISKRSSGGRKSRGRSIGRSGYVKDYIKKRNYILSLLANEAERLITWHNPLQQQDLFVPDEDKIAAW-RNTQVTEKQYKEMANWAWEISPALAVMLPLRFQNSESLVREVTRLVRLNPDAVSHIPSAIQYLVTTETVERDSPELTHILNWAPAPPTTALSYFSRLYPAHPLTAQYAVKVLRSYPHDALLFYIPQLVQALRYDKMGYMQEFIMWASQKSQLLAHQLLWNMKTNIFMDEDGSVKDPDIGDLLEELIERICKSLSGPALKFYEREFAFFDKITNVSAEIRPYPKGPERKSACLNALSKIQLQPGCYLPSNPEAVVLEIDYNSGTPMQSAAKAPYLARFKVKRTGVQELENLGLQEQDNG-VDSERN----------------------------------TQDDLYWQGCIFKVGDDVRQDMLALQIIGLVKNIFQLIGMDLYLAPYRVVATAPGCGVIECVPDSKSRDQIGRQTDIGMYTYFIDKYGDESTPKFQAARRNFIISMASYSVICYLLQIKDRHNGNLMLNSKGHLIHIDFGFLFESSPGGNLGFEPDFKLTDEMVMIMGNKMEAAPFQWFMELCVQAFLAVRPYREAIVALVSLMLDTGLPCFRGQTIKLLRQRFCPEATEKEAAIHMSNVVKNCYSNWRAKTYDWIQYKQNLIPY 2085          

HSP 2 Score: 145.976 bits (367), Expect = 8.928e-31
Identity = 116/407 (28.50%), Postives = 206/407 (50.61%), Query Frame = 3
Query: 1077 FSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELT----QYNSELNKTG-LNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLL-NRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQ----RLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK 2255
            FS++ ++ ++   +K++SK  +   D         +++   PYKS+S  + L L+ +LRDI+ +  + +       +Q  +K V+     +L      +  +  K G +N F  T   NS                           +C+ ++ +    ++ +  +AE+LL +RLTER+ S     ++++++  +L+  L+    + + FP LA + + +L DF++NP+ +++ LNR+     +K +      +  E+   K     S+ R     +     E +RDTAI ++CR L    T DP  +Q FLA LS R + +  SDRD+ ++  NT+  LG + V LKD   T E+VLQ FQQ  +  N PS+  + I++QLG MIIAGCP+I QQ++ +F  I ++
Sbjct:  300 FSSSDVQLLLTWARKLLSKEKLQSIDVAASSLFAGSQHQRFPYKSFSETISLVLVAMLRDILKHN-KDLAAAFTKEVQEFVKVVYKSGQKDLLSRQHDHGEKAEKRGEVNPFSLTVASNS---------------------------ACIELLFW----AVQDETEAETLLYSRLTERL-STPIEFKVLMAHYPLLVVCLQALGRMAEKFPTLANTTIISLRDFMVNPSPIIAKLNRRLTDDGVKKVGDLSITVTDESKPIKPQVGKSKSRN----KVAAAMENLRDTAIENVCRALKAGLTIDPDCVQAFLASLSNRLYISESSDRDSNVITHNTILLLGHVAVSLKDTPKTAESVLQVFQQ--RFCNPPSNFDKLIVDQLGCMIIAGCPSIQQQVLDMFKMISIE 667          
BLAST of Phosphatidylinositol 4-kinase alpha vs. TrEMBL
Match: A0A480YY06 (Phosphatidylinositol 4-kinase alpha OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 698/1508 (46.29%), Postives = 957/1508 (63.46%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGML---DA---YNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQHMN--ENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C+ IL+  M+W P + +SHL +Y+ + +  V    QH GLA+AT++VL  AGY+KQ+    A      TQL++ +P+  +K D SSFMA LNLR+RY GE+ GM+   DA    +D+N M+ + +N                     LAL           R   ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K+   + F+ EM  AWQ T++ K G+F+ +++E  PL   E  + KP      PH IW  FL +R  +A+  S  QVEI S L+ RS+S      +  +++  +AIG RF++L++    L H +   N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LPSRFK +E +  E+ +LV+ +P  V  IPEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D+E++G+ Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V+++C    R+ TYD IQY+QN IPY
Sbjct:  697 DHGYRHCSLAVINALANIAANIQDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPAPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCEMILQEAMKWAPTVTKSHLQEYLNRHQNWVSGLSQHTGLAMATESVLHFAGYNKQNTTLGA------TQLTE-RPA-CVKKDYSSFMAALNLRNRYAGEVYGMIRFSDATGQTSDLNKMMVQELN---------------------LALDTGDP-----QRYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMEAALACWEWLLAGKNGVEVPFMREMAGAWQMTVEQKFGLFSAEIKEADPLAASEASQPKPCASEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLSIGGATGSMNRHVAAIGPRFKLLTL-GLALLHADVLPNATVRNVLREKVYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------AVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPHLAVQLPSRFKNTEAIGNEVTRLVRLDPGAVSDIPEAIKFLVTWHTIDADAPELSHVLCWAPADPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRS----DSEDEGSTQEA----------------------------DGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDIPY 2100          

HSP 2 Score: 121.324 bits (303), Expect = 2.940e-23
Identity = 117/417 (28.06%), Postives = 205/417 (49.16%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNS---ELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + +N +    Y + S PL + +  +LRD ++  Y K          S +KEV    +  L Q+NS   EL K  L+D   + +  S L L          C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL  L +   +      N IK+   N    ++    + ++ Q        ++E++RD AI ++CR L    T D   ++ FLA LS R + + E+D+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  327 LRELLNLVKKIVEEPVLKSLDAVVASVMEANPSADLYYSTCSDPLYVAMFKMLRDTLH--YMK------DLPPSFVKEVH---DFVLEQFNSSQGELQKI-LHDADRSHSELSPLKLR---------CQASA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVVPSPVLVKLYKCHSQYHTVAGNDIKISVTNEHSESTLNVLSGKKGQ------PSMYEQLRDIAIDNICRCLKAGLTVDAVIVEAFLASLSNRLYISQENDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 701          
BLAST of Phosphatidylinositol 4-kinase alpha vs. TrEMBL
Match: A0A480XIH0 (Phosphatidylinositol 4-kinase alpha OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 699/1507 (46.38%), Postives = 960/1507 (63.70%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLF--TEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGML---DA---YNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXX-----XXXXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNN--HNDKAEYNCPGLSDVENWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAANIQ +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+S L++NSA+ ++T+   EL ++++ +I L+    E+S L+ K++     +L+SVYRLE + V  S D +    +F Y ED  I KDK GM  C+  +  K+F+ ++  M +  K  E E  ++ HAQFLLV FNH+ KR+R +AD +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P YD+P   +++ + D+ + RE I+ DF   C+ IL+  M+W P + +SHL +Y+ + +  V    QH GLA+AT++VL  AGY+KQ+    A      TQL++ +P+  +K D SSFMA LNLR+RY GE+ GM+   DA    +D+N M+ + +N                     LAL           R   ++F++ A M+IS      +LLH LCW PL  F    ME  +ACW WLLA K+   + F+ EM  AWQ T++ K G+F+ +++E  PL   E  + KP      PH IW  FL +R  +A+  S  QVEI S L+ RS+S      +  +++  +AIG RF++L++GL++L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+FW+ M S+KKYL  S                   L P  N ++ S L+        ++G+     + +        Y   SG ++I  +KKS +  K    T     + + Y+K+R L+L LLA EI+RL  W N     + E +  G + V NW  K   + ++ W++   LAW +SP LAV LPSRFK +E +  E+ +LV+ +P  V  IPEA++FL T   I+ D PEL +V  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P+PKG +R++ACL AL ++++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S    D+E++G+ Q                                  I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD  SRDQ+GR TD GMYDYF   +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLDK GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF+P M++REAAN  ++V+++C    R+ TYD IQY+QN IPY
Sbjct:  692 DHGYRHCSLAVINALANIAANIQDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPAPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCEMILQEAMKWAPTVTKSHLQEYLNRHQNWVSGLSQHTGLAMATESVLHFAGYNKQNTTLGA------TQLTE-RPA-CVKKDYSSFMAALNLRNRYAGEVYGMIRFSDATGQTSDLNKMMVQELN---------------------LALDTGDP-----QRYTQAMFKLTA-MLISSKDCDPQLLHHLCWGPLRMFNEHGMEAALACWEWLLAGKNGVEVPFMREMAGAWQMTVEQKFGLFSAEIKEADPLAASEASQPKPCASEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSLSIGGATGSMNRHVAAIGPRFKLLTLGLALLHADVLPNATVRNVLREKVYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQ------------------LVPPDNQDTRSNLDI-------AVGSRQQATQGW-----INTYPLSSGMSTI--SKKSGMSKK----TNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPHLAVQLPSRFKNTEAIGNEVTRLVRLDPGAVSDIPEAIKFLVTWHTIDADAPELSHVLCWAPADPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRS----DSEDEGSTQEA----------------------------DGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDIPY 2095          

HSP 2 Score: 120.168 bits (300), Expect = 5.759e-23
Identity = 117/417 (28.06%), Postives = 204/417 (48.92%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNS---ELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L++++NL+KK++ +  +   D +    + +N +    Y + S PL + +  +LRD ++  Y K          S +KEV    +  L Q+NS   EL K  L+D   + +  S L L          C +          +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +  S   +L DFL+ P+ VL      +L       N IK+   N    ++    + ++ Q        ++E++RD AI ++CR L    T D   ++ FLA LS R + + E+D+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG ++I G   IYQ++  +F  I VK S+  Y+   + ++  YR
Sbjct:  327 LRELLNLVKKIVEEPVLKSLDAVVASVMEANPSADLYYSTCSDPLYVAMFKMLRDTLH--YMK------DLPPSFVKEVH---DFVLEQFNSSQGELQKI-LHDADRSHSELSPLKLR---------CQASA--------ACVDLMVW----AVKDEQGAENLCIKLSEKLQSKTSSK-VIIAHLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVVPSPVLV-----KLYKCHIAGNDIKISVTNEHSESTLNVLSGKKGQ------PSMYEQLRDIAIDNICRCLKAGLTVDAVIVEAFLASLSNRLYISQENDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQ--KFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYR 696          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Cavefish
Match: pi4kab (phosphatidylinositol 4-kinase, catalytic, alpha b [Source:ZFIN;Acc:ZDB-GENE-080220-34])

HSP 1 Score: 1277.69 bits (3305), Expect = 0.000e+0
Identity = 696/1505 (46.25%), Postives = 956/1505 (63.52%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNI-------KNSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLD--AYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXXXXXXXX-----XXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVE----NWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAAN+QG+    +LL  LLE +V L LE +R  +           +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+SEL++NSAL ++T+ Q EL+D+++ +I L+    E + L+ K++     +L+SVYRLE + + HSND++    +F+Y ED  I KDK GM  C+  +G K+FE +++ M    K  E E  ++ HAQFLLV FNH  KR+R +AD +L+ +A+ FPH++WSG VL TMLDI Q LS  L  D ++  P YD+P T  ++ + D+ + RE I+ DF   C  IL+  M+W   + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY++Q      SMT   TQL+  +P+  +K D S+FM++LNLR+RY GE+ GM+   A       + RL+     E L+A+D   SD                       S+F++ AL+ IS      +LLH LCW+PL  FT   ME  +ACW W LAA +   + F+ EM  AW  T++ K+G+F++   E  PL   E+ +  P   +  PH +W +FL +R  +A+  S  QVEI +GL+ R+LS S G +KS      SAIG RFR+L++GL++L   +  N+  ++VLREK+Y++ F YFS  PR+  Q     ++DI  II+F++ + S+KKYL                  + N L P     S S L+        ++G+    ++ +        Y   SG ++++     +    R         + + Y+K+R L+L LLA E++RL+ W N     E        VE    NW  K   + ++ W++   LAW +SP LA+ LP RFK SE +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QYAV+VL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P PKG +R++ACL AL +I++QPGCYLPSNP+AIV++IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +   S +  +  ++   QR                                 I  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD KSRDQ+GR TD GMYDYF + +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLD  GHIIHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF P MS++EAA   ++V++ C    R+ TYD IQY+QNQIPY
Sbjct:  328 DHGYRHCSLAVINALANIAANLQGEPLEDELLINLLELFVQLGLEGKRASERASDKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVVMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSGEPLRSELQYNSALKNDTVTQAELNDLRSTIINLLDPAPEAAALINKLDFAMCTYLLSVYRLEYMRMLHSNDADRFQVMFRYFEDKAIQKDKSGMMQCVICVGDKVFEVFLQMMAEKPKTKEHEEELERHAQFLLVNFNHTHKRIRRVADKYLSGLAETFPHLLWSGRVLKTMLDILQTLSLSLSADIHKDQPYYDIPDTPHRITVPDTHEARESIVKDFAARCGEILKEAMKWASSVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILNFAGYNRQ------SMTLGATQLTD-RPT-CVKKDYSNFMSSLNLRNRYTGEVAGMVQFAAATHSESDLSRLMVGQMSEALEAKD---SD-------------------SFTQSMFKMTALL-ISVKDYDPQLLHHLCWSPLKMFTEHGMETAIACWEWFLAACNGVEVPFMREMAGAWHMTVELKMGLFSETELEADPLAASEESQPLPRPPDVTPHALWIEFLVQRFEIAKYCSADQVEIFTGLLQRALSLSVGGAKSCLNRHVSAIGPRFRLLTLGLTLLHADVVTNATIRNVLREKIYSTAFDYFSVAPRFPTQTEKRLREDISVIIKFYACLLSDKKYL------------------TANQLVPPGTQYSRSSLDA-------AVGSRQPAMQGW-----INTYPLSSGMSTLSKKSGLSKKSNRG------SQLHKYYMKRRTLLLALLASEVERLTTWYNPLGTQELQISSEQSVETSIVNWRSKYISLTEKQWKDNVNLAWSISPYLALQLPGRFKNSEAIVSEVTRLVRMDPGAVSDVPEAVKFLVTWHTIDADSPELSHILCWAPADPPTGLSYFSSMYPPHPLTAQYAVRVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAQKSQLLAHQFIWNMKTNIYTDEEGHQKDPDIGELLEQLVEEITGSCSGPAKDFYQREFDFFNKITNVSAIIKPIPKGDERKRACLRALSEIKVQPGCYLPSNPEAIVIDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLLCRSDSLEEGRSEEEAQR---------------------------------ICWQAAIFKVGDDCRQDMLALQIIGLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCKSRDQLGRQTDFGMYDYFRNQYGDESTLAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDSQGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFNPSMSEKEAAAFMIKVIQNCFLSSRSKTYDMIQYYQNQIPY 1732          

HSP 2 Score: 118.627 bits (296), Expect = 5.334e-26
Identity = 91/306 (29.74%), Postives = 162/306 (52.94%), Query Frame = 3
Query: 1368 ELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKST 2261
            E++   L  F ++ +   R+ LH A  L  Q   S    + +   +C+ ++V+    ++ +   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +A S   +L DFL+ P+ VL  L +   ++  SG   IK+   N    ++    ++R+ Q        ++E++RD +I ++CR L    + DP  ++ FLA LS R + + E+D++  L+  +T+  LG + V ++D     E +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK++
Sbjct:   28 EVHDFVLEQFSSSQSELQRV-LHEAERLPGQP--SPLKLRCHANAACVDLMVW----AVKDEQGAENLCTKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVIAHSATMSLKDFLVVPSPVLIKLYKYHSQS-SSGGGEIKISVTNEHSQSTFNILSNRKDQ------PSMYEQLRDISIDNICRCLKAGLSMDPVIVEAFLASLSNRLYISQENDKEAHLIPDHTIRALGHIAVAMRDSPKVMEPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKAS 316          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Cavefish
Match: pi4kaa (phosphatidylinositol 4-kinase, catalytic, alpha a [Source:ZFIN;Acc:ZDB-GENE-100204-2])

HSP 1 Score: 1200.65 bits (3105), Expect = 0.000e+0
Identity = 672/1512 (44.44%), Postives = 936/1512 (61.90%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLD------AYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXX-----XXXXXXXXXAIGVRFRMLSMGLSILQH-MNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVS-GNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDS-VTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVE----NWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAAS-STEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAAN+Q +  + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+SEL++NSAL ++T+   EL+D+++ +I L+    E++ L+ K++     +L+SVYRLE + +  S DS+    +F+Y ED  I KDK GM  C+  +G K+F+ +++ M +  K    E  ++ HAQFLLV FNH+ KR+R +AD +L+ +A+ FPH++WSG VL TMLDI Q LS  L  D ++  P YD+P T + + + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +  V    QH GLA+AT+++L  AGY++QS       T  +TQL++ +P+  +K D S+FMA+LNLR+RY GE+ GM+       + +D+N ++ R +N+                   D   P              ++F++ AL+ IS      +LLH LCW+PL  FT   ME  +ACW WLLAA++   + F+ EM  AWQ T++ K+G+F+    E  PL   E+ +  P   +  PH IW +FL +R  +A+  S  QVEI   L+ RSLS       S L++  +AIG RFR+L++GLS+L   +  N+  ++VLREK+Y++ F YFS   ++  Q     ++DI  +I+F++ + S+KKYLA          +   G++S  N  DP          NT+++    ++GT              +   G+     ++S   +T         +N  + + + Y+K+R L+L LLA EI+RL+ W N     E        VE    NW  K   + ++ W++   LAW +SP LA+ L +RFK +E +  E+ +LV+ +P  V  +PEA++FL T   I+ D PEL ++                 MYP HPLT QY VKVL  +PP                  MGY+ E++L     S +LAHQ IWNMKTN+Y DE+G  KDPDIG  LE ++EEI  S SGP+  F +REFDFF+KITNVS +I+P PKG +R++ACL+AL  I++QPGCYLPSNP+AIVL+IDY SG P+QSAAKAPYLAKFKVKRCGV  LEKE +R  S S E   EN    Q+                                 +  QA IFKVGDD RQD+LALQ+I LFKNI +  GLD +++PYRVVAT+PGCGVIEC+PD KSRDQ+GR TD GMYDYF + +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLD  GH+IHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+QRF P MS++EAA   ++V+  C    R+ TYD +QY+QNQIPY
Sbjct:  639 DHGYRHCSLAVINALANIAANLQAEHMVDELLVNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVVMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSGEPLRSELQYNSALKNDTVTPAELNDLRSTIINLLDPPPEVAALINKLDFAMSTYLLSVYRLEYMRMLRSLDSDRFQVMFRYFEDRAIQKDKSGMLQCVIAVGDKVFDVFLQMMADKPKTKAHEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLAETFPHLLWSGRVLKTMLDILQTLSVSLSADIHKDQPYYDIPDTPYHITVPDTYEARESIVKDFAARCGEILKEAMKWAPSVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNRQST------TLGSTQLTE-RPA-CVKKDYSNFMASLNLRNRYAGEVAGMIHFSEATRSTSDLNKLMIRQMNEAL-----------------DGGQP---------EAFTEAMFKLAALL-ISSKDCDPQLLHHLCWSPLKMFTENGMETAIACWEWLLAARTGMEVPFMREMAGAWQMTVELKMGLFSDAQVEADPLAASEESQPVPCPPDITPHYIWIEFLVQRFEIAKYCSADQVEIFGSLLQRSLSLNVGGLKSSLNRHVAAIGPRFRLLTLGLSLLHSDVVTNATIRNVLREKIYSTAFDYFSVASKFPTQGDKHLREDICVMIKFYASILSDKKYLAACQ-------LVPPGDLSVMNAADPR---------NTMDM----AVGTRQ------------QSAQGWINTYPLSSGMSTTSKKSGMSKKSNRGTQLHKYYMKRRTLLLALLASEIERLTTWYNPLSAQELAIFTEQSVETSIANWRSKYISLSEKQWKDHVNLAWSISPYLAMQLSTRFKNTEAIVAEVTRLVRLDPGAVSDVPEAVKFLVTWHTIDADSPELSHI----------------LMYPPHPLTAQYGVKVLRSFPP------------------MGYVREYILWAAQKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGELLEQMMEEIISSLSGPAKDFYQREFDFFNKITNVSAIIKPVPKGDERKRACLKALSDIKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCPSDSVEDGEENSEAAQK---------------------------------VCWQAAIFKVGDDCRQDMLALQIIGLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCKSRDQLGRQTDFGMYDYFRNQYGDESTLAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDSKGHLIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKQRFNPNMSEKEAAAFMIKVIERCFLSSRSKTYDMLQYYQNQIPY 2016          

HSP 2 Score: 126.716 bits (317), Expect = 2.284e-28
Identity = 114/413 (27.60%), Postives = 200/413 (48.43%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTS----TSRRRQFKYFRYTMIFEKIRDTAITSLCRI----LTTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 2306
            L+ ++ L++  + +TF+   D+M      +N  +   YK++S PL + +  +LRD +   Y K  +       + +KEV      + +   SEL +           L+    LHS    +   C +          +C+ ++V+    ++ E   AE+L  +L+E++QS  S K +II++  +L+  L+    L + FP +A S   +L DFL+ P+ VL  L +    + Q     IK+   N    ++    T +R Q        ++E++RD +I ++CR     LT D   ++ FLA LS R + + E+D+D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS L   II+QLG M+I G   IYQ++  +F  I VK++    +  + ++  YR
Sbjct:  273 LRQLLQLVEHFVEETFLKPLDQMLAEVQENNPVLYLYYKTFSDPLYVAVFKMLRDTLY--YMKDLQT------AFVKEVHDFVLEQFSSSQSELQR----------ILHDVEYLHSELSPLKLRCQANA--------ACVDLMVW----AVTEEQGAENLCTKLSEKLQSKTSSK-VIIAHMPLLICCLQGLGRLCERFPVVAHSVTMSLRDFLVVPSPVLVKLYKY---HNQYRTGEIKIHVTNEHSQSTFSGHTIKRSQ------PSMYEQLRDISIDNICRCLKAGLTMDAVIVEAFLASLSNRLYISQENDKDAHLIPDHTIRALGHIAVALRDTPRVMEPILQILQQ--KFCQPPSQLDVLIIDQLGCMVITGNQYIYQEVWNLFQQISVKASSMVYSTKDYKDHGYR 643          

HSP 3 Score: 61.2326 bits (147), Expect = 1.677e-8
Identity = 56/219 (25.57%), Postives = 103/219 (47.03%), Query Frame = 3
Query:  153 GSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSP-AEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPS--QETIKNMSRKSSLGEKLLMDY--------------------SKNTSLISEQVNSEKKGNTPKRMGD 740
            G F L+ + + A++++GI+LVES+L+ K+ I+PYLL + K L + + + +  E    E+ P AE F F L ++LS+ +  D     +++  +MD +    +      + D   A    V     P LLG++R  GR + + + ++S+LFP    + + N     +   +   D+                    + + S IS+Q + E+ G  P    D
Sbjct:    8 GVFQLDERRRDAVIALGIFLVESDLQHKDAIVPYLLGLLKGLPRVQWIEESSERKVREILPVAENFCFCLVTMLSDVAQRDETLRIQILEAVMDLMQVLLHACRNPEDQDKEYACRYTV-----PCLLGVVRASGRYSNTEEPLLSKLFPRAIAQPVPNTDETEAARRRSFNDFRSILPSSLLTVCQSDTLRRKTSSVSSISQQASPERAGLPPSSPAD 221          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Cavefish
Match: pi4kb (phosphatidylinositol 4-kinase beta [Source:NCBI gene;Acc:103035584])

HSP 1 Score: 195.667 bits (496), Expect = 1.540e-50
Identity = 104/258 (40.31%), Postives = 157/258 (60.85%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G+ TT ++  A+RNFV S A Y ++CYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG+ D   F +++ L +Q  +  R + E ++ +V +M   S LPCF G  TI+ L++RF   +++ +      +++           YD  QY  N I
Sbjct:  576 SVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISSDSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGNYTTEAFLTAQRNFVQSCAGYCLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSP-RNLGFETSAFKLTNEFVDVMGGQ-DGDMFNYYKMLMLQGLIAARKHMEKVIQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSLTEEQLQVLVEQMVDGSMRSITTKLYDGFQYLTNGI 831          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Cavefish
Match: pi4kb (phosphatidylinositol 4-kinase beta [Source:NCBI gene;Acc:103035584])

HSP 1 Score: 195.667 bits (496), Expect = 1.776e-50
Identity = 104/258 (40.31%), Postives = 157/258 (60.85%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I E+E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G+ TT ++  A+RNFV S A Y ++CYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG+ D   F +++ L +Q  +  R + E ++ +V +M   S LPCF G  TI+ L++RF   +++ +      +++           YD  QY  N I
Sbjct:  589 SVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISSDSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGNYTTEAFLTAQRNFVQSCAGYCLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSP-RNLGFETSAFKLTNEFVDVMGGQ-DGDMFNYYKMLMLQGLIAARKHMEKVIQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSLTEEQLQVLVEQMVDGSMRSITTKLYDGFQYLTNGI 844          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Cavefish
Match: pik3cg (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [Source:NCBI gene;Acc:103041836])

HSP 1 Score: 146.747 bits (369), Expect = 1.145e-34
Identity = 102/276 (36.96%), Postives = 154/276 (55.80%), Query Frame = 1
Query: 5941 KKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTT--DSGMY-DYFLSLFGDETTPS---YQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFM---FESSPGNNMGFEPDIKLTKEMVMVMG--GKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCD 6732
            KK  + L  +   P TTLS+D I     IFK GDD+RQD+L LQ++ + ++I E E LD  L PY  ++T    G+IE V D+ +   I ++T  ++G + D  L+ +  +   S   YQ+A   FV S   Y V  Y+L I DRHN NIM+ + G++ HIDFG +   ++S  G +    P + LT + + VMG  GK  SP F  F+ + V+AYL LR +   ++ L S+ML +G+P     + I+ +R+  T   S+ EA  H+L  +  C D
Sbjct:  809 KKKPLWLQFKRADP-TTLSSDTI---GIIFKDGDDLRQDMLILQILLIMESIWETESLDLSLLPYGCISTGNKIGMIEIVKDATTIANIQQSTVGNTGAFKDEILNQWLRDKCVSEEKYQQAVDRFVFSCGGYCVATYVLGIGDRHNDNIMITESGNLFHIDFGHILGNYKSFLGISKERVPFV-LTPDFLYVMGTTGKKSSPNFLKFQDVCVRAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIREALTVGCSEDEAQKHFLDQIEICRD 1079          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008978.1 (pep scaffold:Pmarinus_7.0:GL477391:15964:91650:-1 gene:ENSPMAG00000008040.1 transcript:ENSPMAT00000008978.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1265.37 bits (3273), Expect = 0.000e+0
Identity = 682/1505 (45.32%), Postives = 958/1505 (63.65%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIK-------NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXX-----XXXXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEY--NCPGLSDVENW-YKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHI--DFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVL--RPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            D   RH S +V++   NIAAN+QG++ + +LL  LLE +V L LE +R  +   +       +S AGNLG +IPVIA++ +RL  I EA PRL+KLFRDFW Y V+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+SEL++NSAL ++T++  EL +++     L+  I E+  L+ K++     +L+SVYRLE++ V HS D +    +F Y+ED  I KDK GM  C+  +  ++F  ++  M    K  E E+ ++ HAQFLLV FNH+ KR+R ++D +L+ +   FPH++WSGTVL TMLDI Q LS  L  D ++  P Y +P T + + + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +       QH GLA+A +++L  AG+++Q    NAS   L + L   +P   +K D SSFMA+LNLR+RY GE+ GM++ Y  M         D+ +  +K  +   S R  E                    +F++ AL+ I+      +LLH L WAP   FT   ME  +ACW WLLAAK      FL E+  AWQ T++ ++G+F+ D +E  PL   E+ +  P   +  PH++W +FL +R  +A+  S  QVEI S ++ RSLS +     SG+++  +AIG RF++LS+GLS+L   +  ++  ++VLREK+Y++ F YFS  P++  Q     ++DI  +++FW  M S+KKYL  +     +  +   G+ S N LD        +    IN +  +S  +T S                 SGA     +KK+  G +          + + Y+K+R L+L LLA EI+RL  W +     +   +  G  +V  W  K   + ++ WR+   LAW +SP LA+ LP+RF+ SE + +E+ +LV+ +P  V +IPEA++FL T   +E D PEL ++  W P  P  ALS+FSR+YP HPLT QYAV+VL  +PPD ++FY+PQ+VQ +RYD MGY+ E++L     S +LAHQ IWNMKTN++ DE+G  KD +IG  LES+++EI  + SGP+  F +REFDFF+KITNVS  I+P+PKG +R+ ACL+AL +I L+PGCYLPSNP+AIVL+IDY SG+P+QSAAKAPYLAKFKVKRCGV  LEKE            E  G   R    S T +  +K N                ++IY QA IFKVGDD RQD+LALQ+I LFKNI +  G+D +++PYRVVATSPGCGVIEC+PD KSRDQ+GR TD GMY+YF + +GDE+T ++Q+AR NF+ SMA+YS++ +LLQIKDRHNGNIMLD  GH+IHI  DFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +  RPY +A+++LV+LMLD+GLPCFRGQTIKLL+QRF P  S+R+AAN+ +++++ C    R+ TYD IQY+QNQIPY
Sbjct:  697 DHGYRHCSVAVINALANIAANLQGEQLVDELLVNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLHKLFRDFWFYCVVMGFAVQGSGLWPEEWYEGVCEIATKSPLLTFPSGEPLRSELQYNSALKNDTVSAAELTELRMSNANLLDPIQEVIALINKLDFAMSTYLLSVYRLENMRVSHSVDQDRFQVMFLYLEDRAIQKDKAGMMQCVAAVADRVFYVFLHVMAEKPKTKENEQELERHAQFLLVNFNHIHKRIRRVSDKYLSGLVDKFPHMLWSGTVLKTMLDILQTLSLSLSADLHKDKPNYSIPDTPYIITVPDTFEARESIVRDFAARCAGILQEAMKWAPSVTKSHLQEYLNKHQNWAAGLTQHTGLAMAIESILQFAGFNRQ----NAS---LGSNLLHDRPG-CVKKDYSSFMASLNLRNRYAGEVSGMMEMYTIMGSQ-----GDLNRLLVKQLNDALSSRNPEAYTQ---------------GMFKLAALL-INSKECDLQLLHHLSWAPQEMFTDAGMEAAIACWEWLLAAKPCQETRFLREVVGAWQMTVEKRMGLFSPDQKEADPLAASEESQPCPCPPSITPHQLWIEFLVQRFEIAKYCSADQVEIFSSVLQRSLSLTVGGPDSGINRHVAAIGPRFKLLSLGLSMLHADVLTSTTGRNVLREKVYSTAFDYFSVAPKFPTQTTKALREDISVMVKFWMAMYSDKKYLNANQL---VPPVMNVGD-SRNNLDVAMGSRQPANQGWINTVPLSSGMSTLS---------------KKSGA-----SKKTNRGTQ----------LHKYYMKRRTLLLSLLASEIERLMTWYDSLSSPDMAIDTAGEENVAAWRTKYTNLTEKQWRDNVNLAWTISPYLAIQLPTRFRNSEAISKEVTRLVRLDPGAVSNIPEAIKFLVTEHTVEADAPELSHILCWAPTDPPTALSYFSRLYPPHPLTAQYAVRVLRSFPPDAILFYIPQIVQAVRYDTMGYVREYILWAAKKSQLLAHQFIWNMKTNIFSDEEGHTKDVEIGETLESLVDEITNALSGPAKEFYQREFDFFNKITNVSATIKPYPKGAERKAACLKALSEINLEPGCYLPSNPEAIVLDIDYQSGLPMQSAAKAPYLAKFKVKRCGVSELEKE------------EMPGLMCRRESISGTGDDKRKVN----------------EDIYWQAAIFKVGDDCRQDMLALQIIGLFKNIFQLVGMDLFVFPYRVVATSPGCGVIECIPDCKSRDQLGRQTDIGMYEYFRNQYGDESTEAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDSQGHLIHIVLDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVSNRPYMDAVISLVALMLDTGLPCFRGQTIKLLKQRFAPNQSERDAANYMIKIIQNCFLSNRSKTYDMIQYYQNQIPY 2110          

HSP 2 Score: 120.168 bits (300), Expect = 4.473e-27
Identity = 104/410 (25.37%), Postives = 200/410 (48.78%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESH-YR 2306
            LK +++++K++++   +   D++    ++ N +    Y+++S+ L +    +LRD + N  + +       +   + E F    AEL +   + ++                  H  +  +   C +          +C+ ++V+ +         AE+L  +L+E++Q+  S K +I+++  +L+  L+    L + FP ++ S    L DFL+ P+ VL  L +   +    G N IK+   N +   ST      K  + +M +E++RD AI ++CR L      +P  ++ FLA LS R + + ++++D  L++ +T+  LG + V L+D   T E++LQ  QQ  +    PS L   II+QLG M+I G   IYQ+++ +F  I VK++    +Q +    H YR
Sbjct:  326 LKRLLDMVKRLVNDNMLRTLDKILLETIDCNPSTYLYYRNFSNILYVAAFKMLRDTLLNCLKDLPSVFVKEVHDFVLEQFNSSQAELQRMLHDADRP-----------------HGESSSLKLRCQANA--------ACVDLMVWAAKDE----QGAETLCVKLSEKLQTKTSSK-VIVAHMPLLICCLQGLGRLCERFPSVSNSVTVCLRDFLVVPSPVLLKLYKLHCQFQSVGGNDIKISVTN-EFAESTVNVVASKKIQPSM-YEQLRDMAIDNICRALKGGLIEEPVIVEAFLATLSNRLYTSQDNEKDGQLIHEHTIRALGHIAVSLRDTPRTMESILQILQQ--KFCQPPSPLDVLIIDQLGCMVITGPQHIYQEVLNLFQQISVKASSVVYSQAKDMRDHGYR 701          

HSP 3 Score: 63.929 bits (154), Expect = 4.872e-10
Identity = 60/182 (32.97%), Postives = 95/182 (52.20%), Query Frame = 3
Query:   66 LKLARALIYSNEE--DIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSP-AEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANG-DVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFP 599
            L LAR+L   N    D V+K +  CP  ++ G   L+ + + A++++GI+L+ES L+ K  ++PYLL + K L   + + DY      E  P AE FSF L +LLS+ +  D     +++  L+D+L       E   N  DV +  +        P L+G+ R  GR +   D ++SRLFP
Sbjct:   33 LSLARSLAAQNPAPLDKVQKVLGMCPL-DQQGVCQLDHRRRDAVIALGIFLLESGLQHKEHLVPYLLQLLKMLPNVQWIEDYVGKRDRERLPVAESFSFCLVTLLSDVAQRDPLIREQILEALLDTLQELLQICEDPHNDRDVCQYSV--------PCLIGMSRAFGRYSNEDDSLLSRLFP 205          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Sea Lamprey
Match: pi4kb (phosphatidylinositol 4-kinase, catalytic, beta [Source:NCBI gene;Acc:563201])

HSP 1 Score: 191.045 bits (484), Expect = 6.280e-50
Identity = 101/258 (39.15%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA Q +R  +++ E+E +  +L PY+++ TS   G+IE + ++ S  Q+ + +   + +YFL   G   T  +  A+R+FV S A+Y ++CY+LQ+KDRHNGNI+LD  GHIIHIDFGF+  +SP  N+GFE    KLT E V VMGG  DS  F +++ L +Q  +  R + E +V +V +M   S LPCF G  TI+ L++RF   +++ +  +   +++           YD  QY  N I
Sbjct:  526 SVIVKCGDDLRQELLAYQFLRQLQSVWEQERVPLWLKPYKILVTSADSGMIEPILNAVSIHQVKKQSQLSLLEYFLQEHGSPNTEGFLTAQRHFVESCAAYCLICYILQVKDRHNGNILLDSEGHIIHIDFGFILSNSP-RNLGFETSAFKLTAEFVEVMGGP-DSDMFNYYKLLMLQGLIAARKHMERVVQIVEIMQQGSQLPCFHGASTIRQLKERFHVSLTEEQLQSTIEQMVEGSMRSLTTRLYDGFQYITNGI 781          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Sea Lamprey
Match: pi4kb (phosphatidylinositol 4-kinase, catalytic, beta [Source:NCBI gene;Acc:563201])

HSP 1 Score: 187.578 bits (475), Expect = 4.195e-49
Identity = 109/273 (39.93%), Postives = 159/273 (58.24%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGR---------------TTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFE-PDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  + I E+E +  +L PY+++ TS   G+IE + ++ S  Q+ R                +   + +YFL   G  TT  +  A+RNFV S A+Y +VCYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  +SP  N+GFE    KLT+E V VMGG+ DS  F +F+ L +Q  +  R + E +V +V +M   S LPCF G  TI+ L++RF   +++ +      +++           YD  QYF N I
Sbjct:  468 SVIVKCGDDLRQELLAYQVLKQLQMIWEQERVPLWLKPYKILVTSADSGMIEPIVNAVSIHQVPRPELTKHPNARYSVKKQSQLSLLEYFLQEHGSRTTEGFLTAQRNFVQSCAAYCLVCYLLQVKDRHNGNILLDLEGHIIHIDFGFILSNSP-RNLGFEVSAFKLTQEFVDVMGGQ-DSDMFIYFKLLMLQGLIGARKHMERVVQIVEIMQQGSQLPCFHGASTIRQLKERFHMSLTEEQLQATIDQMVEGSMRSLTTRLYDGFQYFTNGI 738          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Sea Lamprey
Match: pi4kb (phosphatidylinositol 4-kinase, catalytic, beta [Source:NCBI gene;Acc:563201])

HSP 1 Score: 168.318 bits (425), Expect = 1.096e-43
Identity = 86/184 (46.74%), Postives = 123/184 (66.85%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFE-PDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLR 6567
            + I K GDD+RQ++LA QV++  + I E+E +  +L PY+++ TS   G+IE + ++ S  Q+ + +   + +YFL   G  TT  +  A+RNFV S A+Y +VCYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  +SP  N+GFE    KLT+E V VMGG+ DS  F +F+ L +Q  +  R
Sbjct:  397 SVIVKCGDDLRQELLAYQVLKQLQMIWEQERVPLWLKPYKILVTSADSGMIEPIVNAVSIHQVKKQSQLSLLEYFLQEHGSRTTEGFLTAQRNFVQSCAAYCLVCYLLQVKDRHNGNILLDLEGHIIHIDFGFILSNSP-RNLGFEVSAFKLTQEFVDVMGGQ-DSDMFIYFKLLMLQGLIGAR 578          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010071.1 (pep scaffold:Pmarinus_7.0:GL484237:218:13057:-1 gene:ENSPMAG00000009114.1 transcript:ENSPMAT00000010071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 7.514e-29
Identity = 81/231 (35.06%), Postives = 125/231 (54.11%), Query Frame = 1
Query: 6031 KVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQI-GRTTDSGMY-DYFLSLFGDETTPS---YQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSP--GNNMGFEPDIKLTKEMVMVM-GGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLP-CFRGQTIKLLRQRFTPLMSDREAA 6696
            + GDD+RQD+L LQV+R+ +++  +EGLD  +  +R ++T    G++E VP +++  +I G    +G + D  L+L+  +  PS   YQ+A  NF+ S A   V  Y+L I DRHN NIML   GH+ H+DFG     +   GN         LT +M  VM GG   + +FQ F +L  QAY  +R +   +  L+ L+ D G P     + +  +R    P  ++ EAA
Sbjct:    4 QTGDDLRQDMLTLQVMRVMESVWLQEGLDMRMVRFRCLSTGKQRGMVELVPGAETLRRIQGEHGVTGSFKDTPLALWLRKHNPSEQQYQQAVENFIYSCAGCCVATYVLGICDRHNDNIMLRTTGHMFHVDFGKFLGHAQMFGNIKRDRTPFVLTADMAYVMNGGDRPTSSFQQFVELCCQAYNAIRKHAGLLFNLLGLVSDGGEPGAVHMEGLVYVRDALRPQATEAEAA 234          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Yeast
Match: STT4 (Phosphatidylinositol-4-kinase; functions in the Pkc1p protein kinase pathway; required for normal vacuole morphology, cell wall integrity, and actin cytoskeleton organization [Source:SGD;Acc:S000004296])

HSP 1 Score: 393.275 bits (1009), Expect = 4.640e-111
Identity = 228/554 (41.16%), Postives = 317/554 (57.22%), Query Frame = 1
Query: 5146 PEALQFLATPSNI--ENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACL--EALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEP-DIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            P AL      S++  + D+    Y   W PV+P+ +++ F   +  +    Q+++  L     +   FYVPQ+VQ +RYDK GY+   +L+   +S + +HQ+IWNM  N YKD++G I++ +I   L+ I E +  SFS     F EREF+FFD++T +SG ++P+ K  + ++     E + KIE++P  YLPSNPD +V++ID  SG PL                   Q   K    A    + D ++  T +   V                                 QA IFKVGDD RQD+LALQ+I LF+ I    GLD Y++PYRV AT+PGCGVI+ +P+S SRD +GR   +G+Y+YF S FG+E+T  +Q AR NFV S+A YSV+ YLLQ KDRHNGNIM D  GH +HIDFGF+F+  PG  + FE    KLTKEMV VMGG   +PA+  FE+L ++AYL  RP+ EAI+  V+ ML SGLPCF+G +TI+ LR RF P  +D EAA +   ++R   +      YD  Q   N IPY
Sbjct: 1401 PSALDLFIKGSHLSSKKDLHATLY---WAPVSPLKSINLFLPEWQGNSFILQFSIYSLESQDVNLAFFYVPQIVQCLRYDKTGYVERLILDTAKISVLFSHQIIWNMLANCYKDDEG-IQEDEIKPTLDRIRERMVSSFSQSHRDFYEREFEFFDEVTGISGKLKPYIKKSKAEKKHKIDEEMSKIEVKPDVYLPSNPDGVVIDIDRKSGKPL-------------------QSHAKAPFMATFKIKKDVKDPLTGKNKEVEKW------------------------------QAAIFKVGDDCRQDVLALQLISLFRTIWSSIGLDVYVFPYRVTATAPGCGVIDVLPNSVSRDMLGREAVNGLYEYFTSKFGNESTIEFQNARNNFVKSLAGYSVISYLLQFKDRHNGNIMYDDQGHCLHIDFGFIFDIVPG-GIKFEAVPFKLTKEMVKVMGGSPQTPAYLDFEELCIKAYLAARPHVEAIIECVNPMLGSGLPCFKGHKTIRNLRARFQPQKTDHEAALYMKALIRKSYESIFTKGYDEFQRLTNGIPY 1900          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Yeast
Match: PIK1 (Phosphatidylinositol 4-kinase; catalyzes first step in the biosynthesis of phosphatidylinositol-4,5-biphosphate; may control cytokinesis through the actin cytoskeleton; may control nonselective autophagy and mitophagy through trafficking of Atg9p [Source:SGD;Acc:S000005211])

HSP 1 Score: 172.94 bits (437), Expect = 1.194e-43
Identity = 95/243 (39.09%), Postives = 145/243 (59.67%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRT-----------TDSG----MYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLML-DSGLPCFRG--QTIKLLRQRFTPLMSDRE 6690
            + I K GDD+RQ+  A Q+I+   NI  +E +D ++   +++ TS   G++E + ++ S   I +             D G    + D+FL  FG+     Y+ A+ NF  S+A+YSV+CYLLQ+KDRHNGNIM+D  GH+ HIDFGFM  +SPG ++GFE    KLT E + ++GG ++  AF+ F +L+  ++  LR Y + IV++  +M  D+  PCF    QT   LRQRF   +S++E
Sbjct:  792 SVIAKTGDDLRQEAFAYQMIQAMANIWVKEKVDVWVKRMKILITSANTGLVETITNAMSVHSIKKALTKKMIEDAELDDKGGIASLNDHFLRAFGNPNGFKYRRAQDNFASSLAAYSVICYLLQVKDRHNGNIMIDNEGHVSHIDFGFMLSNSPG-SVGFEAAPFKLTYEYIELLGG-VEGEAFKKFVELTKSSFKALRKYADQIVSMCEIMQKDNMQPCFDAGEQTSVQLRQRFQLDLSEKE 1032          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Yeast
Match: VPS34 (Phosphatidylinositol (PI) 3-kinase that synthesizes PI-3-phosphate; forms membrane-associated signal transduction complex with Vps15p to regulate protein sorting; activated by the GTP-bound form of Gpa1p; a fraction is localized, with Vps15p, to nuclear pores at nucleus-vacuole junctions and may facilitate transcription elongation for genes positioned at the nuclear periphery [Source:SGD;Acc:S000004230])

HSP 1 Score: 121.709 bits (304), Expect = 4.749e-28
Identity = 78/232 (33.62%), Postives = 116/232 (50.00%), Query Frame = 1
Query: 6025 IFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDE--TTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFR---GQTIKLLRQRFTPLMSDREAANHY 6705
            +FKVGDD+RQD L +Q+I L   +L+ E +D  L PY+++AT P  G IE +P+      + +    G+  Y    + DE  T         NFV S A Y V+ Y+L + DRH  N+++   GH  H DFG++    P     F P +KL  +++   GG  +S  +  F      AY +LR     I+ L  LM  S +P  R      I  +R+RF   MS+ +A  H+
Sbjct:  622 MFKVGDDLRQDQLVVQIISLMNELLKNENVDLKLTPYKILATGPQEGAIEFIPNDTLASILSKY--HGILGYLKLHYPDENATLGVQGWVLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPK---PFPPLMKLPPQIIEAFGGA-ESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAILRVRERFNLNMSEEDATVHF 847          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Yeast
Match: TOR2 (PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that regulates growth in response to nutrients and TORC2, a complex that regulates cell-cycle dependent polarization of the actin cytoskeleton; involved in meiosis; TOR2 has a paralog, TOR1, that arose from the whole genome duplication [Source:SGD;Acc:S000001686])

HSP 1 Score: 57.3806 bits (137), Expect = 3.061e-8
Identity = 46/183 (25.14%), Postives = 76/183 (41.53%), Query Frame = 1
Query: 6025 IFKVGDDVRQDILALQVIRLFKNILE------REGLDHYLYPYRVVATSPGCGVIECVPDSKS-----------------------------RDQIGRTTDSGMYDYFLS-----------LFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDK-HGHIIHIDFGFMFESS 6432
            + K  +D+RQD L +Q+  L   +L+      R  LD   YP   +  SP  G++  VP+S +                              D +       ++ Y L+                ++ ++ E R  +  S+A  S+  Y+L + DRH  N+MLD+  G +IHIDFG  FE++
Sbjct: 2126 VLKGHEDIRQDSLVMQLFGLVNTLLQNDAECFRRHLDIQQYP--AIPLSPKSGLLGWVPNSDTFHVLIREHREAKKIPLNIEHWVMLQMAPDYDNLTLLQKVEVFTYALNNTEGQDLYKVLWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAA 2306          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Yeast
Match: TOR1 (PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that controls growth in response to nutrients by regulating translation, transcription, ribosome biogenesis, nutrient transport and autophagy; involved in meiosis; TOR1 has a paralog, TOR2, that arose from the whole genome duplication [Source:SGD;Acc:S000003827])

HSP 1 Score: 56.225 bits (134), Expect = 6.797e-8
Identity = 45/183 (24.59%), Postives = 74/183 (40.44%), Query Frame = 1
Query: 6025 IFKVGDDVRQDILALQVIRLFKNILEREG------LDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRT----------------------------------------TDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDK-HGHIIHIDFGFMFESS 6432
            + K  +D+RQD L +Q+  L   +L+ +       LD   YP   +  SP  G++  VP+S +   + R                                            G   Y +      ++ ++ E R  +  S+A  S+  Y+L + DRH  N+MLD+  G +IHIDFG  FE++
Sbjct: 2122 VLKGHEDIRQDSLVMQLFGLVNTLLKNDSECFKRHLDIQQYP--AIPLSPKSGLLGWVPNSDTFHVLIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQKIEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAA 2302          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Nematostella
Match: EDO42545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S165])

HSP 1 Score: 1187.17 bits (3070), Expect = 0.000e+0
Identity = 640/1494 (42.84%), Postives = 913/1494 (61.11%), Query Frame = 1
Query: 2356 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARR---NVKTNIK-NSIAGNLGEMIPVIAIILKRLNKIE-ASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSI-YSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXXXX----XXXXXXAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQ------SSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIP 6786
            RH + +V++ + N+AAN++G+  L D L RLLE +V L LE++R        IK +S AGNLG +IPVIA  + +L  +E   PRL+KLF DFWLY V+MGF    + LWP EWY GVC IA KSPLLL  E L+S L +NSAL ++++   EL++++  L+  +G   EI  L+ K+N  Q  +L+SVY+LE+L V   + S        Y+ED  + KDK GMW CI+ IG K+F+ ++  M N  +   RE  ++ HAQ+LL+KFNH+ KR+R +AD +L+++   FPH++W+G VLH +LD+ Q LS  LE        +  VP T++ L + +    RE  + DF   C  IL+  ++W P    S L  Y+LK E        H GLA+A + ++  AG + +S+  SNA++          +PS  +K       + L +RSRY GEI GM+        M++    DV+    K   LC        L   LQ    V       ++F+  A +V + + V ++L+H++CW P   FT   M   VACW W+L A+ D  L  + E++ AWQ T+  ++G+F++D +  SPL   +D    P   +  PH IW +FL +R  + +  S  QV+I+  LV RSL  S      +S+  +A+  RFR+LS+G+++LQ     NS+ K+VLRE++Y +   YFS  P + +  +++ + D+  +++FW  + ++KKY+         S+           + S   L P    N W  +NTI L                         N  S  ++ AS ++ + G + ++         + Y+K+RNLIL L+  E++RLS W+N   + E +  G + + NW  +    +R WR+  RLAW +SP +AV+LP+R+K    ++ E+ +LV+ NP  V HIP+AL ++ T S ++ DIPEL +   W  V PV A++FFS+ YP HPLT QYA++VL  +PPD+++ Y+PQLVQ  RYD +G++TE+++     S +LAHQLIWNMKTNM+ DE+G  KD  IG  L+ +I  I  + SGP   F  REF+FFDK+TN+S VI+PFPKGP+R++ACL AL  I  + G YLPSNP+A+VLEID  SG P+QSAAKAP+LAKFKVKR G+  LE   ++     + D  N+                                     N+Y QA IFKVGDDVRQD+LALQVI LFKNI E+ GLD YL PYRVVATSPGCGVIECVPDSKSRDQ+GR T+  +Y+Y+L  +GDE+TP++Q+AR NF+ SMA+YS+V +LLQIKDRHNGN+MLD+ GHIIHIDFGFMFESSPG N+GFEPD+K++ EMVM+MGG ++SP F+WF  L V++YL +RPYQEA+V+LV+LMLD+GLPCFRG+T+K LR RF+P  S++EAA +  +V+R    ++R   YD IQ  QNQIP
Sbjct:  288 RHCALAVLNAYSNVAANLKGETKLQDFLVRLLELFVQLGLESKRASEKASFAIKASSSAGNLGVLIPVIATAISQLPPLEDPKPRLHKLFWDFWLYCVVMGFGVEGSTLWPQEWYLGVCAIAVKSPLLLGAEHLRSRLMYNSALKNDSVAPAELNEVRLALLDNLGNPPEIVTLVNKLNFGQCTYLLSVYKLETLRVSSESSSIHSIF--SYLEDRAVQKDKAGMWQCISAIGDKVFKAFLNTMANKSRTPSRELELEGHAQYLLIKFNHLHKRIRRVADKYLSELVDKFPHLLWNGKVLHFILDLLQTLSESLEQPVRTVQML--VPGTSYTLAVHEEMDGREGTVRDFSARCSGILKEAIKWAPEATLSLLQDYLLKFEHVSVGMTHHTGLALAMENIVQFAGLNPRSMCLSNAALDK--------RPS-CVKKGLDQVPSGLTIRSRYQGEIVGMM-------AMVEAQSKDVRDVSTK---LC------RVLNKQLQDSVTVAGEAYVSAMFKASAFLVTTKD-VDKQLMHDVCWCPAQIFTKESMATAVACWEWILGARKDVELQMMREISCAWQWTVCRRVGLFSRDTDPESPLASFDD-NSPPKAPDVAPHDIWIRFLAQRFEMVKYYSTDQVQIIMTLVQRSLPLSVSRDNFMSRHVAAVRPRFRLLSLGMAVLQGDFLGNSVAKNVLRERVYCNALDYFSIKPMWPVTDSTELRVDVTVLVKFWQAILADKKYMKHFMMSPVDSYPLGAQSSGSNYSSSHTDLGPYLQGNRW--MNTIPL-----------------------SSNVSSRRSTSASNERDSPGNQHTV---------RDYLKRRNLILALVRREVERLSTWHNSLAQPEMSFEGETSMTNWANQTLFTERNWRDLVRLAWLISPGIAVHLPTRYKDVPIVQREVSRLVRNNPIAVAHIPDALHYIVTESTVKMDIPELTHALCWSAVPPVQAIAFFSQQYPPHPLTAQYAIRVLQSFPPDSILIYIPQLVQATRYDALGFVTEYIIWAAQHSQLLAHQLIWNMKTNMFVDEEGLHKDSQIGDHLDQLIGRITSTVSGPERDFYTREFEFFDKVTNISAVIKPFPKGPERKEACLRALGDIRAEKGVYLPSNPEAMVLEIDQTSGTPMQSAAKAPFLAKFKVKRMGIAELESINVKKDFPCDSDEANQ----------------------------------ENPNVYWQAAIFKVGDDVRQDMLALQVISLFKNIFEQVGLDVYLKPYRVVATSPGCGVIECVPDSKSRDQLGRQTEVDLYEYYLKTYGDESTPAFQQARSNFIKSMAAYSIVSFLLQIKDRHNGNLMLDREGHIIHIDFGFMFESSPGGNLGFEPDMKISHEMVMIMGGTMESPPFRWFMDLCVKSYLAVRPYQEALVSLVALMLDTGLPCFRGETLKRLRARFSPAQSEKEAATYMSKVIRDSYLNYRTRVYDLIQLAQNQIP 1682          

HSP 2 Score: 90.5077 bits (223), Expect = 8.416e-18
Identity = 75/268 (27.99%), Postives = 131/268 (48.88%), Query Frame = 3
Query: 1482 FKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSR----RRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDT-TLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKS 2258
            +K   +++ + ++V+ +        DAE+L   ++E + S      L+ ++  +    LE    L + FP +A   L +   FLLNP  V+S   +  +   + G  II    ++S E  ST +        K      + +++R  A+ ++CR L    T D + +Q FL+ +S + +     D +T +LM  N + TLG +  ++ ++  T E+VL   Q   +  + PSSL   I+EQLG +I+ G   IYQQIM +F  I V +
Sbjct:   14 WKLQTVSASIDLMVWTAQDE----QDAETLCQNISEFLCS-SMATSLVQTDISIFTCCLEGLGTLCEKFPSMASLVLSSFRVFLLNPAPVVS---KCCVSEKKPGSGIIM--TVSSAESNSTPQVTVGHAPAKPNLTNTLCQELRKEALENICRSLKAGLTNDENCVQAFLSSVSNKLYTIDTKDEETASLMSTNAILTLGHVAFMMHEVPDTVESVLTIMQH--RFCHPPSSLDPLIVEQLGYLILVGSDQIYQQIMGMFMKITVDA 269          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Nematostella
Match: EDO27201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9X1])

HSP 1 Score: 185.652 bits (470), Expect = 1.192e-50
Identity = 96/227 (42.29%), Postives = 148/227 (65.20%), Query Frame = 1
Query: 4765 ASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQ 5445
            +S  S+++ST          N  +V + Y+K+RNLIL L+  E++RLS W+N   + E +  G + + NW  +    +R WR+  RLAW +SP +AV+LP+R+K    ++ E+ +LV+ NP  V HIP+AL ++ T S ++ DIPEL +   W  V PV A++FFS+ YP HPLT QYA++VL  +PPD+++ Y+PQLVQ  RYD +G++TE+++     S +LAHQ
Sbjct:  192 SSNVSSRRSTSASNERDSPGNQHTV-RDYLKRRNLILALVRREVERLSTWHNSLAQPEMSFEGETSMTNWANQTLFTERNWRDLVRLAWLISPGIAVHLPTRYKDVPIVQREVSRLVRNNPIAVAHIPDALHYIVTESTVKMDIPELTHALCWSAVPPVQAIAFFSQQYPPHPLTAQYAIRVLQSFPPDSILIYIPQLVQATRYDALGFVTEYIIWAAQHSQLLAHQ 417          

HSP 2 Score: 127.487 bits (319), Expect = 6.075e-31
Identity = 64/175 (36.57%), Postives = 100/175 (57.14%), Query Frame = 1
Query: 3070 MKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSI-YSNASM 3591
            M N  +   RE  ++ HAQ+LL+KFNH+ KR+R +AD +L+++   FPH++W+G VLH +LD+ Q LS  LE   +       VP T++ L + +    RE  + DF   C  IL+  ++W P    S L  Y+LK E        H GLA+A + ++  AG + +S+  SNA++
Sbjct:    1 MANKSRTPSRELELEGHAQYLLIKFNHLHKRIRRVADKYLSELVDKFPHLLWNGKVLHFILDLLQTLSESLEQPESHQTVQMLVPGTSYTLAVHEEMDGREGTVRDFSARCSGILKEAIKWAPEATLSLLQDYLLKFEHVSVGMTHHTGLALAMENIVQFAGLNPRSMCLSNAAL 175          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Nematostella
Match: EDO45547 (Phosphatidylinositol 3-kinase [Source:UniProtKB/TrEMBL;Acc:A7RSD9])

HSP 1 Score: 125.561 bits (314), Expect = 9.591e-29
Identity = 88/243 (36.21%), Postives = 133/243 (54.73%), Query Frame = 1
Query: 6004 NIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPS--YQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFR---GQTIKLLRQRFTPLMSDREAANHYLRVL 6717
            N  E   IFK GDD+RQD L LQ+IRL   +L +E LD  L PY+V+ATS   G+++ +  +   + + +  D  + +YF      ET P+    E    +V S A Y V+ YLL + DRH  N++L K G++ HIDFG++      +     P +KL+KEMV  MGG  +   +Q F +    A+L LR +   I+ L  LM+D+ +P       +T+K ++ +F   +SD EA   YL+ L
Sbjct:  618 NEQEYVVIFKNGDDLRQDQLILQMIRLMDKLLMKENLDLKLTPYKVLATSASHGLVQFIESNAVAEVLDK--DGSIQNYFRKHAPCETGPNGISPEVMDTYVKSCAGYCVITYLLGVGDRHLDNLLLTKSGNLFHIDFGYILGR---DPKPLPPPMKLSKEMVEGMGG-ANGECYQAFRKQCYTAFLHLRRHANLILNLFGLMVDASVPDIALEPDKTVKKVQDKFRLDLSDEEAV-QYLQSL 853          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Nematostella
Match: EDO45977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA6])

HSP 1 Score: 124.79 bits (312), Expect = 2.589e-28
Identity = 89/258 (34.50%), Postives = 132/258 (51.16%), Query Frame = 1
Query: 6025 IFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQI-------GRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSP--GNNMGFEPDIKLTKEMVMVM-GGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQT-IKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQ 6765
            IFK+GDD+RQD L +Q++ +   I  +EGLD  +  Y+ +AT PG G+IE V DS++  +I       G   D  +  + L    DE    Y+ A  NF  S A Y V  Y+L I DRHN NIM+ + GH+ HIDF  +   +   GN         LT +M  V+ GG   SP FQ F  L  +A+ ++R +    + L+SLML+SG+      + ++ +R    P  S+ EA   + R++ +    W      FI 
Sbjct:  754 IFKMGDDMRQDTLTMQLVGIMNKIWLQEGLDLKIITYQCMATGPGMGMIEIVSDSQTLREIHTEFGLTGSFKDESINRWLLKFNPDE--KEYRRAVENFTASCAGYCVATYVLGICDRHNDNIMIHRSGHLFHIDFSKILGHAQMFGNFKRDRAPFVLTPDMAYVINGGYRPSPRFQHFIDLCSRAFNLIRRHSNLFLNLLSLMLNSGIGSLGNVSDLRYIRDSLLPQESEAEATAAFTRLIESSLSSWFTQVNFFIH 1009          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Nematostella
Match: EDO42011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J3])

HSP 1 Score: 124.405 bits (311), Expect = 2.676e-28
Identity = 82/254 (32.28%), Postives = 132/254 (51.97%), Query Frame = 1
Query: 6025 IFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKS-----RDQIGRTTDSGMYDYFLSLFGDE--TTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD---IKLTKEMVMVMG-GKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDH-WRAN 6747
            IFK GDD+RQD+L LQ+IR+   + +++GLD  + PY  ++T    G+IE V +S++       Q+G  T +      L    D   +  +  EA   F++S A Y V  Y+L + DRH+ NIM+ ++G + HIDFG  F  +  N  G   +     LT   V V+  G  ++  FQ F ++  QA+LVLR     ++ L  +ML +G+P  R    I  LR+     +S+ +A  ++ R      D+ W+ +
Sbjct:  776 IFKSGDDLRQDMLTLQLIRIMDRLWKKDGLDLEMIPYGCLSTGDHVGMIEVVTNSETIAKIQMKQMGAITGAFNKTCILDWLADRNGSKEALVEATHRFMLSCAGYCVATYVLGVGDRHSDNIMVHENGQLFHIDFGH-FLGNFKNKFGIRRERVPFVLTDHFVHVITRGNDNTEGFQEFRRICEQAFLVLRRRGSLLINLFVMMLSAGIPELRSLDDIGYLRKTLNLNVSEEKALEYFNRKFNEAVDNSWKTS 1028          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Medaka
Match: PI4KA (phosphatidylinositol 4-kinase alpha [Source:NCBI gene;Acc:101154784])

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 485/1170 (41.45%), Postives = 700/1170 (59.83%), Query Frame = 1
Query: 2344 D*NLRHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARR------NVKTNIK-NSIAGNLGEMIPVIAIILKRLNKI-EASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFT--EPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNR-----IQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXXXXXXXXX-----XAIGVRFRMLSMGLSILQ-HMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVE----NWY-KEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQ 5775
            D   RH S +V++   NIAAN+QG++ + +LL  LLE +V L LE +R      +  T +K +S AGNLG +IPVIA++ +RL  I EA PRL KLFRDFWLYSV+MGFA   + LWP EWYEGVCEIATKSPLL F   EPL+SEL++NSAL ++T+   EL +++  +  LI    E S L+ K++     +L+SVYRLE + +  SND +    +F+Y ED  I KDK GM  CI  +G ++F+ +++ M +  K ++R                                 +  FPH++WSG VL TMLDI Q LS  L  D ++  P YD+P T  ++ + D+ + RE I+ DF   C  IL+  M+W P + +SHL +Y+ K +M V    QH GLA+AT+++L  AGY++QS       T L T L   +P+  +K D S+FMA+LNLR+RY GE+ GM+                         +   + +   DL   +  Q    L++        ++F++ AL++ + N   ++LLH+LCW+PL  FT   ME  +ACW WLLAA +   + F+ EM  AWQ T++ K+G+F++   E  PL V E+ +  P   + IPH +W +FL +R  +A+ SSE QVEI + ++ RSLS S G SKSS     +AIG RFR+L++GL++L   +  N+  ++VLREK+Y++ F YFS  P++  Q     ++DI  +I+F++ ++S+KKYLA                   N L P    +S   L+        ++G    VL+ +        Y   SG +++  +KKS L  K +        + + Y+K+R L+L LLA EI+RL+ W N     E        VE    NW  K   + ++ W++   LAW +SP LA+ LP+RFK +E +  E+ +LV+ +P  VC++PEA++FL T   I+ D PEL ++  W P  P   LS+FS MYP HPLT QY VKVL  +PPD ++FY+PQ+VQ +RYDKMGY+ E++L     S +LAHQ IWNMKTN+Y+DE+G +KDPDIG  LE ++EEI  S SGP+ +F + EFDFF+KITNVS +I+PFPKG +R++ACLEAL +I++QPGCYLPSNP+AIVL+IDY SG P+Q
Sbjct:  623 DHGYRHCSLAVINALANIAANLQGEQLVDELLVNLLELFVQLGLEGKRASERASDKGTALKASSSAGNLGVLIPVIAVLTRRLQPIKEAKPRLQKLFRDFWLYSVVMGFAAEGSGLWPEEWYEGVCEIATKSPLLTFPSGEPLRSELQYNSALKNDTVTPAELSELRATISNLIDPTPEGSALINKLDFAMSTYLLSVYRLEYMRMLRSNDPDRFQVMFRYFEDKAIQKDKSGMLQCIICVGDRVFDVFLQMMAD--KRMKR-------------------------------SWSDIFPHLLWSGRVLKTMLDILQTLSLSLSADIHKDQPYYDIPDTPHRITVPDTYEARESIVKDFAARCGEILKEAMKWAPSVTKSHLQEYLNKHQMWVSGLSQHTGLAMATESILHFAGYNRQS-------TTLGTTLLTERPA-CVKKDYSNFMASLNLRNRYTGEVIGMI-------------------------EFSEATQSKSDLKKLMILQMTSALDKKDPEGFTQTMFKMAALLITTKN-CDQQLLHQLCWSPLKMFTEHGMETAIACWEWLLAAHNGVEVPFMREMAGAWQMTVELKMGLFSETKVEAGPLAVSEESQPTPCAPDVIPHFLWIEFLVQRFEIAKYSSEDQVEIFTSILQRSLSLSVGGSKSSLNRHVAAIGPRFRLLTLGLNLLHADIVTNTTIRNVLREKIYSTAFDYFSGAPKFPTQTDKRLREDISIMIKFYTCLQSDKKYLA------------------ANQLVP---QDSRGSLDV-------AVGQRQQVLQGW-----INTYPLSSGMSTL--SKKSGLSKKNN----RGSQLHKYYMKRRTLLLALLASEIERLTTWYNPLSSPELAIATEQSVETSIANWRSKYISLTEKQWKDTVNLAWSISPYLALQLPTRFKNTESIASEVTRLVRMDPAAVCNVPEAIKFLVTWHTIDADSPELSHILCWAPADPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAQKSQLLAHQFIWNMKTNIYQDEEGNLKDPDIGQLLEEMVEEITGSLSGPAKAFYQGEFDFFNKITNVSAIIKPFPKGEERKKACLEALSQIKVQPGCYLPSNPEAIVLDIDYKSGTPMQ 1686          

HSP 2 Score: 93.9745 bits (232), Expect = 2.098e-18
Identity = 106/414 (25.60%), Postives = 188/414 (45.41%), Query Frame = 3
Query: 1092 LKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTT-STLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLT-ERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAIN--SKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRIL----TTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVK-STRSYATQIESEESHYR 2306
            L+ +I+++KK +S + +   D +    L  N  I   YK++S  L +C+  +LRD + N    + + +   ++ V   V  Q ++  T+    L  TG    P+  S L  R   ++A                     C+ ++V+        + D +   + LT   ++   S      S+AG+          L + FP +A S   +L DFL+ P+  L+ L +       +G   I++   N  S+ M +    ++ +      ++E++RD +I ++CR L    T D   ++ FLA LS R + + E+++D  L+  +T+  LG + V L+D     E +LQ  QQ  +    PS +   II+QLG M+I G   IYQ +  +F  I VK S+  Y+   +  +  YR
Sbjct:  263 LQHLIDMVKKFVSDSSLKTLDAVLTEVLEQNPGIGLCYKTFSDTLYVCVFKMLRDTLYN----LKDLQPAFVREVHDFVLEQFSSSQTELQRVLYDTG--GLPSEQSPLKLRCQANAA---------------------CVDLMVW-------AVKDEQGNPSLLTLPELKIFSSLPTCPCSSAGL--------GRLCERFPVIAHSASTSLRDFLVVPSPALTKLYKYH-SQYSTGAGEIRINVTNEHSQSMINVLPNKKDQ----PSMYEQLRDISIDNICRCLKAGLTMDNVIVEAFLASLSNRLYISQENEKDAHLIPDHTIRALGHIAVALRDTPNVMEHILQILQQ--KFCQPPSQMDVLIIDQLGCMVITGNQYIYQDVWNLFQQISVKASSVVYSATKDYRDHGYR 627          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Medaka
Match: ENSORLT00000027434.1 (pep primary_assembly:ASM223467v1:12:1567090:1568477:1 gene:ENSORLG00000023950.1 transcript:ENSORLT00000027434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 2.147e-60
Identity = 88/139 (63.31%), Postives = 116/139 (83.45%), Query Frame = 1
Query: 6373 MLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            MLD  GH+IHIDFGFMFESSPG N+G+EPDIKLT EMVM+MGGK+++  F+WF ++ V+ YL +RPY +A+V+LV+LMLD+GLPCFRGQTIKLL+ RF P MS++EAA   ++V+++C    R+ TYD +QY+QNQIPY
Sbjct:    1 MLDSKGHLIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKGRFNPQMSEKEAAAFMIKVIQSCFLSSRSKTYDMLQYYQNQIPY 139          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Medaka
Match: ENSORLT00000001557.2 (phosphatidylinositol 4-kinase beta-like [Source:NCBI gene;Acc:101161567])

HSP 1 Score: 191.43 bits (485), Expect = 2.540e-49
Identity = 104/258 (40.31%), Postives = 157/258 (60.85%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I ++E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G  TT ++  A+RNFV S A YS++CYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG +D   F +++ L +Q  +  R + E ++ +V +M   S LPCF G  TI+ L++RF   +++ +      +++           YD  QY  N I
Sbjct:  549 SVIVKCGDDLRQELLAYQVLKQLQSIWQQERVPLWIKPYKILVMSSDSGMIEPVLNAVSLHQVKKQSQLSLLDYFLQEHGSFTTEAFLTAQRNFVQSCAGYSLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSP-KNLGFETSAFKLTSEFVDVMGG-LDGDMFIYYKMLMLQGLIAARKHMEKVLQIVEIMQQGSHLPCFHGSSTIRGLKERFHMSLTEEQLQVLVEQLVDGSMRSITTKLYDSFQYVTNGI 804          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Medaka
Match: ENSORLT00000041935.1 (phosphatidylinositol 4-kinase beta-like [Source:NCBI gene;Acc:101161567])

HSP 1 Score: 191.43 bits (485), Expect = 9.650e-49
Identity = 104/258 (40.31%), Postives = 157/258 (60.85%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I ++E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DYFL   G  TT ++  A+RNFV S A YS++CYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG +D   F +++ L +Q  +  R + E ++ +V +M   S LPCF G  TI+ L++RF   +++ +      +++           YD  QY  N I
Sbjct:  711 SVIVKCGDDLRQELLAYQVLKQLQSIWQQERVPLWIKPYKILVMSSDSGMIEPVLNAVSLHQVKKQSQLSLLDYFLQEHGSFTTEAFLTAQRNFVQSCAGYSLICYLLQVKDRHNGNILLDSEGHIIHIDFGFILSSSP-KNLGFETSAFKLTSEFVDVMGG-LDGDMFIYYKMLMLQGLIAARKHMEKVLQIVEIMQQGSHLPCFHGSSTIRGLKERFHMSLTEEQLQVLVEQLVDGSMRSITTKLYDSFQYVTNGI 966          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Medaka
Match: pi4kb (phosphatidylinositol 4-kinase beta [Source:NCBI gene;Acc:101165462])

HSP 1 Score: 186.808 bits (473), Expect = 8.119e-48
Identity = 102/258 (39.53%), Postives = 155/258 (60.08%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPD-IKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLD-SGLPCFRG-QTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ++LA QV++  ++I ++E +  ++ PY+++  S   G+IE V ++ S  Q+ + +   + DY L   G  TT ++  A+RNFV S A YS++CYLLQ+KDRHNGNI+LD  GHIIHIDFGF+  SSP  N+GFE    KLT E V VMGG  D   F +F+ L +Q  +  R + + ++ +V +M   S LPCF G  T++ L++RF   +++ +      +++           YD  QY  N I
Sbjct:  555 SVIVKCGDDLRQELLAYQVLQQLQSIWQQERVPLWIKPYKILVLSADSGMIEPVMNAVSLHQVKKQSQLSLLDYLLQEHGAPTTEAFLTAQRNFVQSCAGYSLICYLLQVKDRHNGNILLDADGHIIHIDFGFILSSSP-RNLGFETSAFKLTSEFVDVMGGP-DGDMFIYFKMLMLQGLIAARKHMDRVLQVVEIMQQGSHLPCFHGSSTMRALKERFHMSLTEEQLQLLIDQLVDGSMRSLTTKLYDGFQYLTNGI 810          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Planmine SMEST
Match: SMESG000041715.1 (SMESG000041715.1)

HSP 1 Score: 3011.48 bits (7806), Expect = 0.000e+0
Identity = 1476/1478 (99.86%), Postives = 1477/1478 (99.93%), Query Frame = 1
Query: 2356 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXXXXXXXXXXAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLS +NIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY
Sbjct:  773 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSKENIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 2250          

HSP 2 Score: 1472.99 bits (3812), Expect = 0.000e+0
Identity = 754/773 (97.54%), Postives = 756/773 (97.80%), Query Frame = 3
Query:   30 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQ--------------KINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 2306
            MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSE KGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTK DEMC HYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQ              +INENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSY+QNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR
Sbjct:    1 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEIKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKLDEMCGHYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQNLNDVKRKRRFSLKEINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYVQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 773          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Planmine SMEST
Match: SMESG000041715.1 (SMESG000041715.1)

HSP 1 Score: 3011.09 bits (7805), Expect = 0.000e+0
Identity = 1476/1478 (99.86%), Postives = 1477/1478 (99.93%), Query Frame = 1
Query: 2356 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXXXXXXXXXXAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLS +NIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY
Sbjct:  769 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSKENIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 2246          

HSP 2 Score: 1476.84 bits (3822), Expect = 0.000e+0
Identity = 755/769 (98.18%), Postives = 756/769 (98.31%), Query Frame = 3
Query:   30 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGC----------PTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 2306
            MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSE KGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTK DEMC HYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSY+QNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGC          PTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR
Sbjct:    1 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEIKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKLDEMCGHYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYVQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCKIKNTNVSVIPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 769          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Planmine SMEST
Match: SMESG000041715.1 (SMESG000041715.1)

HSP 1 Score: 3011.09 bits (7805), Expect = 0.000e+0
Identity = 1476/1478 (99.86%), Postives = 1477/1478 (99.93%), Query Frame = 1
Query: 2356 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXXXXXXXXXXAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLS +NIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY
Sbjct:  759 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSKENIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 2236          

HSP 2 Score: 1484.16 bits (3841), Expect = 0.000e+0
Identity = 755/759 (99.47%), Postives = 756/759 (99.60%), Query Frame = 3
Query:   30 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 2306
            MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSE KGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTK DEMC HYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSY+QNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR
Sbjct:    1 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEIKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKLDEMCGHYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYVQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 759          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Planmine SMEST
Match: SMESG000041715.1 (SMESG000041715.1)

HSP 1 Score: 3009.94 bits (7802), Expect = 0.000e+0
Identity = 1476/1478 (99.86%), Postives = 1477/1478 (99.93%), Query Frame = 1
Query: 2356 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRXXXXXXXXXXXXXAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFXXXXXXXXXXXXXXXXNPEDVCHIPEALQFLATPSNIENDIPELCYVPTWXXXXXXXXLSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 6789
            RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLS +NIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY
Sbjct:  775 RHLSKSVVDTFGNIAANIQGDEALTDLLSRLLEHYVHLDLEARRNVKTNIKNSIAGNLGEMIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWYEGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLIGKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIEDGIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLLVKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLEVDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWVPHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNASMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMNVMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLFRICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSDAILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSIPHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGVRFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASDFKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYNHNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTKKSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKAEYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSEKLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVAPVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKMGYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESIIEEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALRKIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQRLEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPNTTLSKENIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQIPY 2252          

HSP 2 Score: 1472.6 bits (3811), Expect = 0.000e+0
Identity = 754/775 (97.29%), Postives = 756/775 (97.55%), Query Frame = 3
Query:   30 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIXXXXXXXXXXXXXXXDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSPYKSYSHPXXXXXXXXXXDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYIQNFLADLSRRFFNAVESD----------------RDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 2306
            MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSE KGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTK DEMC HYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSY+QNFLADLSRRFFNAVESD                +DTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR
Sbjct:    1 MTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNESGSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCDYKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFNCLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPSQETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEIKGNTPKRMGDAQRSKRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGASEDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDTVDCVGVLLFSNNSLKDIINLIKKMISKTFVTKLDEMCGHYLNSNKNISSPYKSYSHPLRLCLLTLLRDIVNNKYQKINENKNGTIQSVMKEVFTQCNAELTQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLINSCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLAVLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVNIIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPSYVQNFLADLSRRFFNAVESDSHINHQDVYGDTDYWAKDTTLMYFNTVFTLGSMGVLLKDIGGTQEAVLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRVKSTRSYATQIESEESHYR 775          
BLAST of Phosphatidylinositol 4-kinase alpha vs. Planmine SMEST
Match: SMESG000061430.1 (SMESG000061430.1)

HSP 1 Score: 164.466 bits (415), Expect = 1.022e-40
Identity = 99/263 (37.64%), Postives = 150/263 (57.03%), Query Frame = 1
Query: 6019 ACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPYRVVATSPGCGVIECVPDSKSRDQIGRT-TDSGMYDYFLSLFGDETTPSYQEARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSPGNNMGFE-PDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAIVALVSLMLDS---GLPCFRG--QTI-KLLRQRFTPLMSDREAANHYLRVLRTCCDHWRANTYDFIQYFQNQI 6783
            + I K GDD+RQ+ LA Q++++ + +   E    ++ P  +V  S   G+IE V ++ S  QI R  +   + +YF + FG   + S+  A++ FV S A+YS+VCYLLQ+KDRHNGNI+LD  GH+IHID+GF+  +SPG N+GFE    KLT E V +MGG + S  F++F+ L +Q  L  R + + I+A + + LDS    LPCF    +T+    R RF    ++ +       ++           YD  QY+ N I
Sbjct:  558 SVIVKHGDDLRQEQLAYQILKMLQKVWLSERTPLWVRPLNIVVISSDSGMIEPVLNAVSIHQIKRLYSGKSLIEYFKNQFGPTNSESFLNAQKCFVESCAAYSLVCYLLQVKDRHNGNILLDNEGHMIHIDYGFILSASPGRNLGFEFSPFKLTYEEVDIMGG-VKSDMFEYFKILILQGLLAARKHMDKILATIEI-LDSISFKLPCFSKGFETVYNNFRDRFHLCKTEAQLQILVDSMVENSLHSLTTRLYDSFQYYTNGI 818          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI4KA6.394e-2846.04phosphatidylinositol 4-kinase alpha [Source:HGNC S... [more]
PI4KA0.000e+059.49phosphatidylinositol 4-kinase alpha [Source:HGNC S... [more]
PI4KB1.847e-5241.09phosphatidylinositol 4-kinase beta [Source:HGNC Sy... [more]
PI4KB2.468e-5041.09phosphatidylinositol 4-kinase beta [Source:HGNC Sy... [more]
PI4KB2.468e-5041.09phosphatidylinositol 4-kinase beta [Source:HGNC Sy... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y75B8A.245.729e-1237.50pep chromosome:WBcel235:III:12251494:12273692:-1 g... [more]
Y75B8A.245.729e-1237.50pep chromosome:WBcel235:III:12251492:12273692:-1 g... [more]
pifk-15.011e-4637.92PhosphoInositide Four Kinase (PI-4 Kinase) [Sourc... [more]
vps-347.689e-2932.85Phosphatidylinositol 3-kinase catalytic subunit ty... [more]
vps-343.772e-2832.85Phosphatidylinositol 3-kinase catalytic subunit ty... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI4KIIIalpha7.330e-1743.18gene:FBgn0267350 transcript:FBtr0331587[more]
PI4KIIIalpha1.103e-1743.24gene:FBgn0267350 transcript:FBtr0307158[more]
fwd1.704e-4436.54gene:FBgn0004373 transcript:FBtr0072517[more]
fwd2.363e-4436.54gene:FBgn0004373 transcript:FBtr0072516[more]
fwd2.363e-4436.54gene:FBgn0004373 transcript:FBtr0072515[more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pi4kaa1.290e-2745.73phosphatidylinositol 4-kinase, catalytic, alpha a ... [more]
pi4kab1.154e-14346.30phosphatidylinositol 4-kinase, catalytic, alpha b ... [more]
pi4kab1.369e-9549.35phosphatidylinositol 4-kinase, catalytic, alpha b ... [more]
pi4kb1.562e-4739.53phosphatidylinositol 4-kinase, catalytic, beta [So... [more]
pi4kb1.562e-4739.53phosphatidylinositol 4-kinase, catalytic, beta [So... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cobl9.238e-3846.04cordon-bleu WH2 repeat protein [Source:Xenbase;Acc... [more]
cobl3.857e-3445.97cordon-bleu WH2 repeat protein [Source:Xenbase;Acc... [more]
cobl8.849e-4145.57cordon-bleu WH2 repeat protein [Source:Xenbase;Acc... [more]
cobl2.250e-3145.57cordon-bleu WH2 repeat protein [Source:Xenbase;Acc... [more]
cobl1.042e-3745.57cordon-bleu WH2 repeat protein [Source:Xenbase;Acc... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi4ka8.810e-2845.90phosphatidylinositol 4-kinase alpha [Source:MGI Sy... [more]
Pi4ka8.810e-2845.90phosphatidylinositol 4-kinase alpha [Source:MGI Sy... [more]
Pi4ka1.140e-8342.57phosphatidylinositol 4-kinase alpha [Source:MGI Sy... [more]
Pi4kb5.032e-5240.70phosphatidylinositol 4-kinase beta [Source:MGI Sym... [more]
Pi4kb4.902e-5040.70phosphatidylinositol 4-kinase beta [Source:MGI Sym... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O02811|PI4KA_BOVIN1.859e-2646.31Phosphatidylinositol 4-kinase alpha OS=Bos taurus ... [more]
sp|P42356|PI4KA_HUMAN3.071e-2746.04Phosphatidylinositol 4-kinase alpha OS=Homo sapien... [more]
sp|O08662|PI4KA_RAT1.112e-2645.90Phosphatidylinositol 4-kinase alpha OS=Rattus norv... [more]
sp|E9Q3L2|PI4KA_MOUSE7.188e-2745.90Phosphatidylinositol 4-kinase alpha OS=Mus musculu... [more]
sp|A4QPH2|PI4P2_HUMAN4.129e-16054.26Putative phosphatidylinositol 4-kinase alpha-like ... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UPJ71.671e-3147.99Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3HRA26.483e-3148.12phosphatidylinositol 4-kinase alpha OS=Lingula ung... [more]
A0A1S3HP628.928e-3147.92phosphatidylinositol 4-kinase alpha-like OS=Lingul... [more]
A0A480YY062.940e-2346.29Phosphatidylinositol 4-kinase alpha OS=Sus scrofa ... [more]
A0A480XIH05.759e-2346.38Phosphatidylinositol 4-kinase alpha OS=Sus scrofa ... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pi4kab5.334e-2646.25phosphatidylinositol 4-kinase, catalytic, alpha b ... [more]
pi4kaa2.284e-2844.44phosphatidylinositol 4-kinase, catalytic, alpha a ... [more]
pi4kb1.540e-5040.31phosphatidylinositol 4-kinase beta [Source:NCBI ge... [more]
pi4kb1.776e-5040.31phosphatidylinositol 4-kinase beta [Source:NCBI ge... [more]
pik3cg1.145e-3436.96phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008978.14.473e-2745.32pep scaffold:Pmarinus_7.0:GL477391:15964:91650:-1 ... [more]
pi4kb6.280e-5039.15phosphatidylinositol 4-kinase, catalytic, beta [So... [more]
pi4kb4.195e-4939.93phosphatidylinositol 4-kinase, catalytic, beta [So... [more]
pi4kb1.096e-4346.74phosphatidylinositol 4-kinase, catalytic, beta [So... [more]
ENSPMAT00000010071.17.514e-2935.06pep scaffold:Pmarinus_7.0:GL484237:218:13057:-1 ge... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STT44.640e-11141.16Phosphatidylinositol-4-kinase; functions in the Pk... [more]
PIK11.194e-4339.09Phosphatidylinositol 4-kinase; catalyzes first ste... [more]
VPS344.749e-2833.62Phosphatidylinositol (PI) 3-kinase that synthesize... [more]
TOR23.061e-825.14PIK-related protein kinase and rapamycin target; s... [more]
TOR16.797e-824.59PIK-related protein kinase and rapamycin target; s... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO425458.416e-1842.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272011.192e-5042.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455479.591e-2936.21Phosphatidylinositol 3-kinase [Source:UniProtKB/T... [more]
EDO459772.589e-2834.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420112.676e-2832.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI4KA2.098e-1841.45phosphatidylinositol 4-kinase alpha [Source:NCBI g... [more]
ENSORLT00000027434.12.147e-6063.31pep primary_assembly:ASM223467v1:12:1567090:156847... [more]
ENSORLT00000001557.22.540e-4940.31phosphatidylinositol 4-kinase beta-like [Source:NC... [more]
ENSORLT00000041935.19.650e-4940.31phosphatidylinositol 4-kinase beta-like [Source:NC... [more]
pi4kb8.119e-4839.53phosphatidylinositol 4-kinase beta [Source:NCBI ge... [more]
back to top
BLAST of Phosphatidylinositol 4-kinase alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041715.10.000e+099.86SMESG000041715.1[more]
SMESG000041715.10.000e+099.86SMESG000041715.1[more]
SMESG000041715.10.000e+099.86SMESG000041715.1[more]
SMESG000041715.10.000e+099.86SMESG000041715.1[more]
SMESG000061430.11.022e-4037.64SMESG000061430.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009508 ID=SMED30009508|Name=Phosphatidylinositol 4-kinase alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=6928bp
CGAAATTTAATTTTCATGCAAATATTCAAATGACGACTCAAAATTATATT
TTAAACTCTCCTTATTTAAAGTTAGCACGAGCATTAATTTACTCAAATGA
GGAAGACATAGTTAAAAAGTTTATGTGTTACTGTCCGAAACCGAATGAAT
CAGGGTCATTTTTTCTAAATGGAAAGCATCAAGCTGCTATTTTAAGCATT
GGAATTTATCTTGTTGAATCAGAATTAAAATTCAAAAATATTATATTACC
ATATTTGTTAAATGTTCAGAAAAATCTAATTAAAAGTAAAATAGTCTGCG
ATTACAAAGAAATTATTAAATCAGAATTGAGCCCAGCAGAAATTTTTTCA
TTTTCATTAACTAGTCTTTTGAGTGAAGCATCAGCTTTAGACAATGACGA
AGGACATAAAGTGATTTCTGTGTTAATGGATTCATTGATGGCTCATTTCA
ATTGTCTTGAACAAGCTGCAAACGGTGATGTCACAGAGGCTCAATTACAA
ATTGTAAATATACAAATCTATCCATCATTACTTGGAATTATTAGAGGTAT
TGGGCGTGTGGCATTTTCAGCCGATGGTATTGTGTCGCGATTGTTTCCCA
GTCAGGAGACCATCAAAAATATGTCGAGAAAATCCAGTCTCGGTGAAAAA
TTGTTGATGGATTATTCTAAAAATACAAGTCTGATTAGTGAACAAGTGAA
TTCAGAAAAAAAGGGAAATACCCCTAAAAGAATGGGTGATGCTCAAAGAA
GTAAGAGATTGCAAAAATTAGCCTCCAGTTTGTCGTGTGGAACTCCGGAA
TCATGTCAGAAATGCTTATCTCGTGATTCATCAAGTTTTGTTCCAATTAA
CGCAACAAATCAAATTGACAGATCGCAGCTGCAATTTTATTTTGGTGCCA
GCGAAGATATACGATTATTAATGTCTAACAAACAGAACTCTTGGCTTCAT
CCGGACGGTTCTGAGTATTTACTCGGCCGGATTTGTTCAGCATACGGTTC
CAAAGCTCCACATCGCTTTATTATCGATTTGTCAAATAGTGCAAAAGACA
CTGTCGATTGTGTCGGAGTGCTTCTGTTCTCTAACAACAGTTTGAAAGAT
ATAATCAACTTGATCAAAAAAATGATTTCGAAAACTTTCGTGACAAAATC
AGATGAAATGTGTTGTCATTATTTGAATTCCAATAAAAATATCAGTTCTC
CATATAAGAGTTATTCTCATCCTTTAAGGCTGTGTCTTTTGACATTGTTA
CGCGACATTGTTAACAATAAATATCAAAAAATTAATGAAAACAAAAATGG
AACAATCCAATCTGTGATGAAAGAAGTATTTACTCAATGTAATGCGGAAC
TGACGCAATACAATAGTGAGTTGAATAAAACTGGATTGAACGATTTCCCA
ACTACGTCTACGTTAAATAGCAGATTGACTTTACATTCTGCCGCTTATTT
GATCGACCAGAGTTGCGATTCAGAAACTCTATTCAAGTACAATTTGATAA
ACAGCTGTTTGGGAGTCGTAGTCTACATTTCCACTAAATCAATCATTGAA
ATTAATGATGCCGAAAGCCTACTAAATCGACTTACTGAAAGAATACAATC
GGTAGATAGCCGGAAACAATTGATCATATCTAATGCTGGAGTTTTGTTAG
CAGTTTTAGAATGCTGTGCTTATTTGACTCAAGCATTTCCGCACTTGGCC
AAATCTAATTTGGATACGTTGAGTGATTTTCTACTTAATCCTAATCAAGT
TCTTAGCTTTCTAAATCGTCAAAGACTGAAAAATATTCAATCTGGTGTTA
ATATTATCAAAATGGAAGCGATCAATTCAAAAGAGATGACTTCTACAAGT
CGAAGACGGCAATTTAAATATTTCCGTTACACTATGATTTTTGAAAAAAT
TCGTGACACTGCAATAACAAGTCTTTGCAGAATTCTTACCACAGATCCCA
GTTACATTCAGAATTTCTTGGCCGATCTTTCGAGAAGATTTTTCAACGCC
GTTGAAAGTGATAGGGATACTACTTTGATGTATTTCAATACCGTATTTAC
ACTGGGAAGCATGGGTGTCCTGCTGAAAGATATTGGAGGAACCCAAGAAG
CAGTTTTACAATTTTTCCAGCAGAGTTTACAGTTAACTAACTTACCATCT
TCTCTCGGTGAGAAAATAATTGAACAGTTAGGAAATATGATAATAGCAGG
CTGTCCGACTATTTATCAGCAAATTATGACAATATTTACTGATATTCGAG
TTAAATCAACTCGCTCATACGCAACGCAAATTGAATCTGAAGAATCACAT
TACAGGTGGAATAATGCTTTCATAATGATAATTTTTCACAGCCGATTGAA
ATTTAAGACATTTATCCAAGTCGGTAGTTGATACATTTGGTAACATTGCT
GCTAATATTCAAGGCGATGAAGCTTTAACGGATTTATTGAGTAGATTACT
CGAGCATTATGTTCATTTGGATCTCGAAGCTAGAAGGAATGTAAAAACCA
ACATTAAAAATTCTATAGCTGGGAATCTTGGAGAAATGATCCCAGTTATA
GCAATAATATTAAAGAGGTTGAATAAAATTGAAGCGTCTCCGAGGTTAAA
TAAATTATTTCGTGATTTTTGGTTGTATTCAGTCATAATGGGGTTTGCCG
ATCCTGATAATAAACTTTGGCCGGTTGAGTGGTATGAAGGAGTTTGTGAA
ATAGCCACAAAATCACCACTTCTCTTATTTACGGAACCCCTTAAATCAGA
ACTAGAGCACAATTCAGCTCTTGTTTCTAATACTCTCAATCAAACAGAAT
TACATGATATGAAGACAAAACTAATTCAATTAATCGGGAAAATAGATGAA
ATATCACCTCTTCTCACTAAAATGAATGTGACGCAAATTGCATTCTTGAT
GTCCGTATACAGACTTGAGTCGTTATGCGTGGAGCACTCGAATGATTCTG
AGGCATTGCATAGGATATTTAAATATATTGAAGATGGCATTATTATGAAG
GATAAATTCGGCATGTGGACTTGTATTACACAAATTGGATATAAAATTTT
TGAAAACTACATCAAAAGAATGAAAAATCATGAGAAAAACCTCGAAAGAG
AAAGAATTATCGATACTCATGCTCAATTTCTTTTAGTAAAATTTAATCAT
GTTCAAAAACGAGTGAGAATTATCGCCGATACATTTCTCACAGATATGGC
AAAAGCATTTCCTCATGTCATTTGGAGTGGCACAGTACTTCACACCATGC
TCGACATAAATCAGTTGCTATCCAGGGGTTTAGAAGTTGACTCAAACCAA
TCGGCTCCCATTTACGATGTGCCCAGGACAAATTTTAAATTAGTTATAGT
TGATAGTCAGCAAGACCGGGAGGAAATCCTAAATGATTTTGTTAAAAATT
GCAAATCGATTCTCGAAGTTGGAATGCAATGGGTTCCACATTTAGTCAGA
TCACATCTAATTCAATACATCCTGAAAATGGAAATGTCTGTGGAGAACTT
TGGTCAGCATATTGGATTAGCAATAGCTACGCAAGCTGTCCTCACGTCTG
CCGGTTATTCGAAACAAAGTATTTATTCCAACGCCAGCATGACAAATTTA
ACAACGCAACTAAGTCAAATAAAACCTTCTGAAACAATGAAATCAGACTC
ATCCAGCTTCATGGCTAATTTGAATTTGAGGAGTCGTTATCTTGGCGAAA
TTCAAGGTATGCTTGATGCATATAACGACATGAATGTCATGATTGATAGA
CTTGTAAATGATGTCAAGAAGGAATGCCTTAAAGCTGAAGACTTATGTCC
CAGTGATAGACAATTCGAAGATCTTGCGTTGCCTTTGCAAAAACAGTATA
AGGTAGTTCTCAACCGCATTCAGTTGAGTCTATTTCGAATTTGTGCACTG
ATGGTAATCTCTCCAAACCCAGTTAGTCGAAAACTACTCCATGAGTTATG
TTGGGCTCCGTTAATGCATTTTACACCCTTTGTCATGGAAAATGTTGTTG
CCTGCTGGACTTGGCTTTTAGCTGCTAAATCAGATGCTATTCTCATTTTT
CTTTGTGAAATGAATACCGCTTGGCAGCGAACGATCGACTCGAAGATTGG
AGTATTTACGCAAGATGTTGAAGAATGTAGTCCGTTGATAGTTGGTGAAG
ATTTTAAAATGAAACCAAATTTTTGTAATTCAATCCCCCATAAAATCTGG
TCAAAATTTCTACAAGAGAGATTGTACGTTGCTCAAGAAAGTAGTGAGCA
ACAAGTTGAAATTTTATCTGGCTTAGTAATCCGTTCATTAAGTAAGTCGT
CGGGATTATCTAAATCCTCGAGTGCAATTGGTGTAAGATTCAGAATGTTG
AGCATGGGATTATCAATTCTACAGCACATGAATGAGAATTCCATATGTAA
AAGTGTATTACGGGAAAAGCTTTACACTTCAACGTTTGCTTATTTTAGTA
ACTGTCCTCGTTATGCCATTCAAAAAGCATCCGATTTTAAAGATGATATT
ATGACAATAATTCAGTTTTGGTCTGTCATGAGATCAGAAAAAAAATATTT
GGCTCAGTCATCATTTTCCGAGGACATGGATTATATTTACCAGAAAGGAA
ATGTCTCTGGTAACGGTCTAGATCCGAACTATAATCATAACTCTTGGTCG
AAATTAAACACCATAAATTTAATGAAAGCAAACTCGCTAGGTACAACTCA
CAGTGTTTTGCGATTCTATTCCTCACCAGATTCGACTAAGGATTATAATG
GATATTCTGGTGCGGCATCTATAGCCTCGACAAAGAAATCGACTTTAGGG
GGCAAGAGATCGATATTAACGACAAATGATGATTCAGTTACCCAACAATA
CATAAAAAAACGAAATCTAATTCTAATTCTCTTAGCTGTTGAGATTGATC
GACTAAGTGTATGGAATAACCACAATGATAAAGCTGAGTACAATTGCCCT
GGTTTGTCTGATGTAGAAAATTGGTATAAAGAAAAACAGATTCGCGATAG
ATATTGGCGTGAATTTGCTCGTTTGGCATGGGGTGTGAGTCCAGAGTTGG
CTGTAAATTTACCTTCCAGATTTAAAGGATCAGAAAAATTGAAAGAAGAA
ATTGAGAAACTAGTAAAGGAAAATCCTGAAGATGTTTGTCATATTCCTGA
AGCCTTACAATTTTTAGCTACACCATCTAATATAGAAAATGATATACCAG
AATTGTGTTACGTTCCGACCTGGGTTCCGGTAGCCCCAGTCGTTGCACTG
TCATTCTTTTCTCGCATGTATCCTCAACATCCTCTTACTCATCAATATGC
TGTTAAAGTATTGTCACTATATCCTCCAGATACTCTAATATTTTATGTCC
CACAATTAGTCCAAGGAATTCGTTATGACAAGATGGGCTACCTTACTGAA
TTTGTTTTGGAAATAGTTCACCTGTCACCAATTTTAGCCCATCAACTCAT
TTGGAATATGAAAACCAATATGTATAAAGATGAAGATGGCCAAATTAAAG
ACCCGGATATTGGATTACAATTAGAAAGTATAATTGAGGAAATAAACAAA
TCGTTTAGTGGGCCTTCACTTAGCTTTTCTGAAAGAGAATTCGATTTTTT
CGATAAAATAACCAATGTATCAGGAGTTATTAGGCCGTTTCCTAAAGGAC
CACAGCGACAACAAGCTTGCTTAGAGGCGTTAAGAAAAATTGAATTGCAA
CCTGGTTGTTACTTACCGAGTAATCCCGATGCTATTGTTCTTGAAATCGA
TTATATGTCTGGAATACCGTTACAATCAGCTGCTAAAGCTCCTTATTTAG
CCAAATTTAAAGTTAAACGCTGTGGAGTGCAAAGATTAGAAAAGGAAGCA
ATCAGGGCTGCTAGTTCTACTGAGGTAGACACAGAAAACAAAGGAACAAA
ACAGAGACCCAGAGTTGGTTCAATAACGGCCAATACGTTTAAAAAACCGA
ATATATCACTGGGTGTTGAACATCACAAACCCAATACAACTCTAAGTACA
GATAATATTTATGAACAAGCTTGCATTTTCAAAGTTGGTGATGATGTTCG
GCAGGATATTCTAGCTTTGCAGGTTATTAGGCTGTTTAAAAATATTTTGG
AACGAGAAGGTCTTGATCATTATTTATATCCCTATCGAGTTGTCGCCACA
AGTCCTGGGTGTGGAGTGATAGAATGTGTTCCTGATAGCAAATCGCGTGA
CCAAATTGGCCGCACGACGGACAGCGGGATGTATGATTACTTTCTCAGTT
TATTCGGCGATGAAACTACTCCTTCGTATCAAGAAGCTCGCAGAAATTTT
GTGATGAGTATGGCATCATATAGTGTGGTTTGTTATCTCTTGCAAATCAA
AGATAGGCACAATGGAAACATAATGCTGGATAAACATGGCCATATAATTC
ATATCGATTTCGGCTTCATGTTTGAAAGCAGTCCTGGAAACAATATGGGA
TTTGAGCCTGATATCAAGCTAACTAAGGAAATGGTGATGGTGATGGGTGG
AAAGATCGATAGCCCAGCATTTCAGTGGTTCGAACAGTTGTCAGTTCAGG
CGTATTTGGTGCTTCGACCCTATCAGGAGGCCATTGTAGCATTGGTGAGT
CTGATGTTGGACAGCGGGTTGCCATGCTTTCGCGGACAAACTATCAAATT
GCTCCGGCAACGATTCACTCCATTAATGAGTGATCGGGAGGCAGCCAATC
ATTATTTGCGGGTGCTGCGAACATGCTGTGATCATTGGCGTGCTAATACA
TATGATTTCATCCAATATTTCCAGAATCAAATTCCATATTGATAGTGCTG
GTAAAGAGATTATTGTATTTTATTGTATTGATTGATTTGTGTTATTTTCC
CAATCAATTGTGATGTGAATGATTCATTAGATTATATTATATTTGTATTT
GAGTGCTCACATATTATATTTACCGAAG
back to top

protein sequence of SMED30009508-orf-1

>SMED30009508-orf-1 ID=SMED30009508-orf-1|Name=SMED30009508-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1419bp
MIPVIAIILKRLNKIEASPRLNKLFRDFWLYSVIMGFADPDNKLWPVEWY
EGVCEIATKSPLLLFTEPLKSELEHNSALVSNTLNQTELHDMKTKLIQLI
GKIDEISPLLTKMNVTQIAFLMSVYRLESLCVEHSNDSEALHRIFKYIED
GIIMKDKFGMWTCITQIGYKIFENYIKRMKNHEKNLERERIIDTHAQFLL
VKFNHVQKRVRIIADTFLTDMAKAFPHVIWSGTVLHTMLDINQLLSRGLE
VDSNQSAPIYDVPRTNFKLVIVDSQQDREEILNDFVKNCKSILEVGMQWV
PHLVRSHLIQYILKMEMSVENFGQHIGLAIATQAVLTSAGYSKQSIYSNA
SMTNLTTQLSQIKPSETMKSDSSSFMANLNLRSRYLGEIQGMLDAYNDMN
VMIDRLVNDVKKECLKAEDLCPSDRQFEDLALPLQKQYKVVLNRIQLSLF
RICALMVISPNPVSRKLLHELCWAPLMHFTPFVMENVVACWTWLLAAKSD
AILIFLCEMNTAWQRTIDSKIGVFTQDVEECSPLIVGEDFKMKPNFCNSI
PHKIWSKFLQERLYVAQESSEQQVEILSGLVIRSLSKSSGLSKSSSAIGV
RFRMLSMGLSILQHMNENSICKSVLREKLYTSTFAYFSNCPRYAIQKASD
FKDDIMTIIQFWSVMRSEKKYLAQSSFSEDMDYIYQKGNVSGNGLDPNYN
HNSWSKLNTINLMKANSLGTTHSVLRFYSSPDSTKDYNGYSGAASIASTK
KSTLGGKRSILTTNDDSVTQQYIKKRNLILILLAVEIDRLSVWNNHNDKA
EYNCPGLSDVENWYKEKQIRDRYWREFARLAWGVSPELAVNLPSRFKGSE
KLKEEIEKLVKENPEDVCHIPEALQFLATPSNIENDIPELCYVPTWVPVA
PVVALSFFSRMYPQHPLTHQYAVKVLSLYPPDTLIFYVPQLVQGIRYDKM
GYLTEFVLEIVHLSPILAHQLIWNMKTNMYKDEDGQIKDPDIGLQLESII
EEINKSFSGPSLSFSEREFDFFDKITNVSGVIRPFPKGPQRQQACLEALR
KIELQPGCYLPSNPDAIVLEIDYMSGIPLQSAAKAPYLAKFKVKRCGVQR
LEKEAIRAASSTEVDTENKGTKQRPRVGSITANTFKKPNISLGVEHHKPN
TTLSTDNIYEQACIFKVGDDVRQDILALQVIRLFKNILEREGLDHYLYPY
RVVATSPGCGVIECVPDSKSRDQIGRTTDSGMYDYFLSLFGDETTPSYQE
ARRNFVMSMASYSVVCYLLQIKDRHNGNIMLDKHGHIIHIDFGFMFESSP
GNNMGFEPDIKLTKEMVMVMGGKIDSPAFQWFEQLSVQAYLVLRPYQEAI
VALVSLMLDSGLPCFRGQTIKLLRQRFTPLMSDREAANHYLRVLRTCCDH
WRANTYDFIQYFQNQIPY*
back to top

protein sequence of SMED30009508-orf-2

>SMED30009508-orf-2 ID=SMED30009508-orf-2|Name=SMED30009508-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=793bp
KFNFHANIQMTTQNYILNSPYLKLARALIYSNEEDIVKKFMCYCPKPNES
GSFFLNGKHQAAILSIGIYLVESELKFKNIILPYLLNVQKNLIKSKIVCD
YKEIIKSELSPAEIFSFSLTSLLSEASALDNDEGHKVISVLMDSLMAHFN
CLEQAANGDVTEAQLQIVNIQIYPSLLGIIRGIGRVAFSADGIVSRLFPS
QETIKNMSRKSSLGEKLLMDYSKNTSLISEQVNSEKKGNTPKRMGDAQRS
KRLQKLASSLSCGTPESCQKCLSRDSSSFVPINATNQIDRSQLQFYFGAS
EDIRLLMSNKQNSWLHPDGSEYLLGRICSAYGSKAPHRFIIDLSNSAKDT
VDCVGVLLFSNNSLKDIINLIKKMISKTFVTKSDEMCCHYLNSNKNISSP
YKSYSHPLRLCLLTLLRDIVNNKYQKINENKNGTIQSVMKEVFTQCNAEL
TQYNSELNKTGLNDFPTTSTLNSRLTLHSAAYLIDQSCDSETLFKYNLIN
SCLGVVVYISTKSIIEINDAESLLNRLTERIQSVDSRKQLIISNAGVLLA
VLECCAYLTQAFPHLAKSNLDTLSDFLLNPNQVLSFLNRQRLKNIQSGVN
IIKMEAINSKEMTSTSRRRQFKYFRYTMIFEKIRDTAITSLCRILTTDPS
YIQNFLADLSRRFFNAVESDRDTTLMYFNTVFTLGSMGVLLKDIGGTQEA
VLQFFQQSLQLTNLPSSLGEKIIEQLGNMIIAGCPTIYQQIMTIFTDIRV
KSTRSYATQIESEESHYRWNNAFIMIIFHSRLKFKTFIQVGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042236PI3K_accessory_sf
IPR036940PI3/4_kinase_cat_sf
IPR015433PI_Kinase
IPR000403PI3/4_kinase_cat_dom
IPR001263PI3K_accessory_dom
IPR018936PI3/4_kinase_CS
IPR011009Kinase-like_dom_sf
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0005488binding
GO:0000166nucleotide binding
GO:00044301-phosphatidylinositol 4-kinase activity
GO:0005524ATP binding
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
GO:0030660Golgi-associated vesicle membrane
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0046854phosphatidylinositol phosphorylation
GO:0048015phosphatidylinositol-mediated signaling
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 169..192
NoneNo IPR availablePANTHERPTHR10048:SF15PHOSPHATIDYLINOSITOL 4-KINASE ALPHA-RELATEDcoord: 2..1418
NoneNo IPR availableCDDcd05167PI4Kc_III_alphacoord: 1067..1417
e-value: 4.01042E-180
score: 534.481
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainSMARTSM00146pi3k_hr1_6coord: 1162..1415
e-value: 4.4E-103
score: 358.4
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainPFAMPF00454PI3_PI4_kinasecoord: 1162..1365
e-value: 8.6E-42
score: 143.7
IPR000403Phosphatidylinositol 3-/4-kinase, catalytic domainPROSITEPS50290PI3_4_KINASE_3coord: 1161..1418
score: 62.681
IPR001263Phosphoinositide 3-kinase, accessory (PIK) domainSMARTSM00145pi3k_hr2_4coord: 825..1013
e-value: 4.8E-20
score: 82.6
IPR001263Phosphoinositide 3-kinase, accessory (PIK) domainPFAMPF00613PI3Kacoord: 869..1007
e-value: 1.8E-24
score: 86.2
IPR001263Phosphoinositide 3-kinase, accessory (PIK) domainPROSITEPS51545PIK_HELICALcoord: 824..1002
score: 16.431
IPR042236Phosphoinositide 3-kinase, accessory (PIK) domain superfamilyGENE3DG3DSA:1.25.40.70coord: 837..1000
e-value: 3.6E-15
score: 57.9
IPR036940Phosphatidylinositol 3-/4-kinase, catalytic domain superfamilyGENE3DG3DSA:1.10.1070.11coord: 1218..1416
e-value: 1.8E-61
score: 209.6
IPR015433Phosphatidylinositol kinasePANTHERPTHR10048PHOSPHATIDYLINOSITOL KINASEcoord: 2..1418
IPR018936Phosphatidylinositol 3/4-kinase, conserved sitePROSITEPS00915PI3_4_KINASE_1coord: 1165..1179
IPR018936Phosphatidylinositol 3/4-kinase, conserved sitePROSITEPS00916PI3_4_KINASE_2coord: 1258..1278
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 1012..1413
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 812..992