Baculoviral IAP repeat-containing protein 5

Overview
NameBaculoviral IAP repeat-containing protein 5
Smed IDSMED30009506
Length (bp)624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Baculoviral IAP repeat-containing protein 5 (SMED30009506) t-SNE clustered cells

Violin plots show distribution of expression levels for Baculoviral IAP repeat-containing protein 5 (SMED30009506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Baculoviral IAP repeat-containing protein 5 (SMED30009506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Baculoviral IAP repeat-containing protein 5 (SMED30009506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009506SMESG000033647.1 SmedASXL_000184SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30009506SMESG000033647.1 dd_Smed_v4_14261_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009506SMESG000033647.1 SMED_32482_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009506SMESG000033647.1 SMED_32482_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Human
Match: BIRC5 (baculoviral IAP repeat containing 5 [Source:HGNC Symbol;Acc:HGNC:593])

HSP 1 Score: 69.3218 bits (168), Expect = 7.821e-15
Identity = 36/73 (49.32%), Postives = 47/73 (64.38%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            RI TFKNW F +   +C    +A+AGF +C T  + D  +CF C KEL+GWE DD P+EEH KH+  C FL +
Sbjct:   18 RISTFKNWPFLE-GCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSV 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Human
Match: BIRC5 (baculoviral IAP repeat containing 5 [Source:HGNC Symbol;Acc:HGNC:593])

HSP 1 Score: 69.707 bits (169), Expect = 9.879e-15
Identity = 39/78 (50.00%), Postives = 50/78 (64.10%), Query Frame = 1
Query:   70 FLK-WRIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            FLK  RI TFKNW F +   +C    +A+AGF +C T  + D  +CF C KEL+GWE DD P+EEH KH+  C FL +
Sbjct:   13 FLKDHRISTFKNWPFLE-GCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSV 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Human
Match: BIRC5 (baculoviral IAP repeat containing 5 [Source:HGNC Symbol;Acc:HGNC:593])

HSP 1 Score: 55.8398 bits (133), Expect = 3.654e-10
Identity = 30/60 (50.00%), Postives = 38/60 (63.33%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEE 255
            RI TFKNW F +   +C    +A+AGF +C T  + D  +CF C KEL+GWE DD PM E
Sbjct:   18 RISTFKNWPFLE-GCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPMRE 76          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Human
Match: BIRC5 (baculoviral IAP repeat containing 5 [Source:HGNC Symbol;Acc:HGNC:593])

HSP 1 Score: 57.3806 bits (137), Expect = 5.192e-10
Identity = 39/101 (38.61%), Postives = 50/101 (49.50%), Query Frame = 1
Query:   70 FLK-WRIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPM-----------------------EEHAKHAPYCPFLKI 294
            FLK  RI TFKNW F +   +C    +A+AGF +C T  + D  +CF C KEL+GWE DD P+                       EEH KH+  C FL +
Sbjct:   13 FLKDHRISTFKNWPFLE-GCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIGPGTVAYACNTSTLGGRGGRITREEHKKHSSGCAFLSV 112          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Human
Match: BIRC3 (baculoviral IAP repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:591])

HSP 1 Score: 58.9214 bits (141), Expect = 9.586e-10
Identity = 28/70 (40.00%), Postives = 38/70 (54.29%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            R+ TF+ W    ++ +     LAKAGFY   P  D + CF C  +L  WE  D  M EH +H P CPF++
Sbjct:  172 RLLTFQTWPLTFLSPT----DLAKAGFYYIGP-GDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIE 236          

HSP 2 Score: 50.0618 bits (118), Expect = 1.040e-6
Identity = 24/50 (48.00%), Postives = 32/50 (64.00%), Query Frame = 1
Query:  142 SLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            SLA+AGFY T   +D +KCF C   LD W++ D P E+H K  P C F++
Sbjct:   49 SLARAGFYYTG-VNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQ 97          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Celegans
Match: bir-1 (Chromosomal passenger complex protein bir-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFA2])

HSP 1 Score: 65.855 bits (159), Expect = 1.247e-13
Identity = 35/77 (45.45%), Postives = 51/77 (66.23%), Query Frame = 1
Query:   70 FLKWRIQTFKNWQFDK-MNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIG 297
            F K R+ TFKN+++D+  ++ C S ++A+AGFYCT P+S   KC  C KELD ++ +D P  EH K    C F++IG
Sbjct:   16 FYKDRLMTFKNFEYDRDPDAKCTSQAVAQAGFYCTGPQSG--KCAFCNKELD-FDPEDDPWYEHTKRDEPCEFVRIG 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Celegans
Match: bir-2 (Baculoviral IAP repeat-containing protein bir-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ5])

HSP 1 Score: 58.9214 bits (141), Expect = 2.341e-10
Identity = 37/75 (49.33%), Postives = 45/75 (60.00%), Query Frame = 1
Query:   82 RIQTFKNWQFDK-MNSSCDSVSLAKAGFYCTNPKSD--SLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIG 297
            R+ TF+N+ FDK  N  C S  LAKAG++    K D  S KC  CL ELD  E DD P EEH K +  C F+K+G
Sbjct:  170 RLATFQNFIFDKKRNVKCTSKKLAKAGWFSIANKKDKTSAKCPFCLVELDFDESDD-PWEEHQKFSASCDFIKLG 243          

HSP 2 Score: 55.0694 bits (131), Expect = 4.786e-9
Identity = 38/100 (38.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:   82 RIQTFKNWQFDK-MNSSCDSVSLAKAGFYCT-NPK-SDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYE--NLSGNILSKAELLRITCQNY 366
            R  +FK + +DK +N +C S  LA+AGFY T +P+   S KC  C+ E++ +E+ D P E+H   +P+C F+ IG  E   LS  I+S   +   T + Y
Sbjct:   27 RFASFKGFVYDKRINIACTSEKLARAGFYSTASPEFPASAKCPFCMLEIN-FEQCDDPWEKHKSGSPHCEFVMIGEIEESELSFRIISNLAIRHATVRLY 125          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Fly
Match: Det (gene:FBgn0264291 transcript:FBtr0083408)

HSP 1 Score: 74.3294 bits (181), Expect = 1.073e-16
Identity = 34/73 (46.58%), Postives = 49/73 (67.12%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPK--SDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            R++++K+W F +  +SC    +A+AGFY T  K  +D+  CF+C K LDGWE +D P +EH KHAP C F K+
Sbjct:   31 RVESYKSWPFPE-TASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEFAKL 102          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Fly
Match: Diap1 (gene:FBgn0260635 transcript:FBtr0075500)

HSP 1 Score: 59.6918 bits (143), Expect = 2.668e-10
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELL 345
            R++TF +W  D +    D   LA+ G Y T+   D +KCF C  E+  WE++D P+ EH + +P CP L+       + N+   AE L
Sbjct:   47 RLKTFTDWPLDWL----DKRQLAQTGMYFTH-AGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLR----RRTTNNVPINAEAL 125          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Fly
Match: Diap1 (gene:FBgn0260635 transcript:FBtr0333618)

HSP 1 Score: 59.6918 bits (143), Expect = 2.668e-10
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELL 345
            R++TF +W  D +    D   LA+ G Y T+   D +KCF C  E+  WE++D P+ EH + +P CP L+       + N+   AE L
Sbjct:   47 RLKTFTDWPLDWL----DKRQLAQTGMYFTH-AGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLR----RRTTNNVPINAEAL 125          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Fly
Match: Diap1 (gene:FBgn0260635 transcript:FBtr0075501)

HSP 1 Score: 59.6918 bits (143), Expect = 2.668e-10
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELL 345
            R++TF +W  D +    D   LA+ G Y T+   D +KCF C  E+  WE++D P+ EH + +P CP L+       + N+   AE L
Sbjct:   47 RLKTFTDWPLDWL----DKRQLAQTGMYFTH-AGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLR----RRTTNNVPINAEAL 125          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Fly
Match: Diap1 (gene:FBgn0260635 transcript:FBtr0333619)

HSP 1 Score: 59.6918 bits (143), Expect = 2.668e-10
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELL 345
            R++TF +W  D +    D   LA+ G Y T+   D +KCF C  E+  WE++D P+ EH + +P CP L+       + N+   AE L
Sbjct:   47 RLKTFTDWPLDWL----DKRQLAQTGMYFTH-AGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLR----RRTTNNVPINAEAL 125          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Zebrafish
Match: birc5b (baculoviral IAP repeat containing 5b [Source:ZFIN;Acc:ZDB-GENE-030826-2])

HSP 1 Score: 65.0846 bits (157), Expect = 2.661e-13
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YCTNP-KSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIG 297
            R+QTF  W F + +  C    +AKAGF +C +  + D   CF CL+EL+GWE DD P  EHAK +P C FL + 
Sbjct:    7 RLQTFSEWPF-REDCQCTPELMAKAGFVHCPSENEPDVACCFYCLRELEGWEPDDNPWSEHAKRSPNCAFLHMS 79          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Zebrafish
Match: birc5b (baculoviral IAP repeat containing 5b [Source:ZFIN;Acc:ZDB-GENE-030826-2])

HSP 1 Score: 65.4698 bits (158), Expect = 2.833e-13
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YCTNP-KSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIG 297
            R+QTF  W F + +  C    +AKAGF +C +  + D   CF CL+EL+GWE DD P  EHAK +P C FL + 
Sbjct:   23 RLQTFSEWPF-REDCQCTPELMAKAGFVHCPSENEPDVACCFYCLRELEGWEPDDNPWSEHAKRSPNCAFLHMS 95          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Zebrafish
Match: birc5a (baculoviral IAP repeat containing 5a [Source:ZFIN;Acc:ZDB-GENE-030826-1])

HSP 1 Score: 66.2402 bits (160), Expect = 3.768e-13
Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 1
Query:   70 FLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKS--DSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            F + R+QTF  W F++    C   ++AKAGF  T  ++  D  +CF CLKEL+GWE +D P +EH  H+P C F+
Sbjct:   61 FYENRLQTFVGWPFEE-GCVCTPENMAKAGFIHTPSENSPDIAQCFFCLKELEGWEPEDDPEKEHKAHSPSCDFI 134          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Zebrafish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 55.4546 bits (132), Expect = 9.210e-9
Identity = 36/107 (33.64%), Postives = 50/107 (46.73%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYEN--LSGNILSKAELLRITCQNYVVSNADLDQC 396
            R+ TF+NW      ++     LAKAG Y    + D + CF C  +L  WE  D  + EH +H P C F++    +N  LSG  LS             VSN+ + QC
Sbjct:  209 RLDTFQNWTL----ATVTPAELAKAGLYYLG-QGDRVACFSCGGQLGSWEPGDRAVSEHQRHYPNCRFVRGDRADNIPLSGGGLSN------------VSNSAMQQC 298          

HSP 2 Score: 49.2914 bits (116), Expect = 1.091e-6
Identity = 30/69 (43.48%), Postives = 37/69 (53.62%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R+ TF NW   ++    D   LAKAGFY    ++D +KCF C   L  WE  D P  EHAK  P C +L
Sbjct:  301 RLLTFVNWP-SRIPVRPDQ--LAKAGFYYVG-RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYL 365          

HSP 3 Score: 47.7506 bits (112), Expect = 4.236e-6
Identity = 24/71 (33.80%), Postives = 37/71 (52.11%), Query Frame = 1
Query:   79 WRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            +RI T+  +      ++    SLA+AGFY T    D ++CF C    D W+  D P E H + +P C F++
Sbjct:   50 FRISTYAKF---PTTAAVTERSLARAGFYYTG-LGDRVQCFRCNVTADNWQSGDCPAERHKQLSPNCSFIQ 116          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Zebrafish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 55.4546 bits (132), Expect = 9.210e-9
Identity = 36/107 (33.64%), Postives = 50/107 (46.73%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYEN--LSGNILSKAELLRITCQNYVVSNADLDQC 396
            R+ TF+NW      ++     LAKAG Y    + D + CF C  +L  WE  D  + EH +H P C F++    +N  LSG  LS             VSN+ + QC
Sbjct:  209 RLDTFQNWTL----ATVTPAELAKAGLYYLG-QGDRVACFSCGGQLGSWEPGDRAVSEHQRHYPNCRFVRGDRADNIPLSGGGLSN------------VSNSAMQQC 298          

HSP 2 Score: 49.2914 bits (116), Expect = 1.091e-6
Identity = 30/69 (43.48%), Postives = 37/69 (53.62%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R+ TF NW   ++    D   LAKAGFY    ++D +KCF C   L  WE  D P  EHAK  P C +L
Sbjct:  301 RLLTFVNWP-SRIPVRPDQ--LAKAGFYYVG-RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYL 365          

HSP 3 Score: 47.7506 bits (112), Expect = 4.236e-6
Identity = 24/71 (33.80%), Postives = 37/71 (52.11%), Query Frame = 1
Query:   79 WRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            +RI T+  +      ++    SLA+AGFY T    D ++CF C    D W+  D P E H + +P C F++
Sbjct:   50 FRISTYAKF---PTTAAVTERSLARAGFYYTG-LGDRVQCFRCNVTADNWQSGDCPAERHKQLSPNCSFIQ 116          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Xenopus
Match: birc5l (baculoviral IAP repeat containing 5 like [Source:NCBI gene;Acc:733575])

HSP 1 Score: 73.1738 bits (178), Expect = 5.827e-16
Identity = 42/125 (33.60%), Postives = 69/125 (55.20%), Query Frame = 1
Query:   73 LKWRIQTFKNWQFDKMNSSCDSVSLAKAGF-YCTNPKS-DSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVS-NADLDQCISVFTNSLNEIKDY 438
            L  R+ TF NW F + + +C    +A+AGF +C +  S D +KCF CLKEL+GW+ +D PM+EH KH+P C F+ +          L+ +E L++  +   +     ++Q I  F    N ++ +
Sbjct:   28 LATRLSTFANWPFTE-DCACTPERMAEAGFVHCPSDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHSPSCLFIAL----KKKAEELTLSEFLKLDLERTKIKMQKQMNQHIENFQAKANVVRGH 147          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Xenopus
Match: ENSXETT00000024230.1 (baculoviral IAP repeat-containing protein 5.1-like [Source:NCBI gene;Acc:101732421])

HSP 1 Score: 63.5438 bits (153), Expect = 1.499e-12
Identity = 44/121 (36.36%), Postives = 65/121 (53.72%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIG-LYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKD 435
            R+ TF +W F + N  C   ++AKAGF +C T  + D   CF CLKEL+GWE DD P  EH+K +  C FL +     +L+     + E  RI  +++ VS A     ++    S ++I D
Sbjct:   18 RLATFADWPFTE-NCKCTPENMAKAGFVHCPTENEPDVACCFFCLKELEGWEPDDDPWTEHSKRSASCGFLSLTKCVNDLTMEGFLRLEADRI--KSFYVSEASTVNQMTFTLCSRSQITD 135          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Xenopus
Match: ENSXETT00000024239.1 (baculoviral IAP repeat-containing protein 5.1-like [Source:NCBI gene;Acc:101732421])

HSP 1 Score: 63.5438 bits (153), Expect = 1.738e-12
Identity = 34/73 (46.58%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            R+ TF +W F + N  C   ++AKAGF +C T  + D   CF CLKEL+GWE DD P  EH+K +  C FL +
Sbjct:   18 RLATFADWPFTE-NCKCTPENMAKAGFVHCPTENEPDVACCFFCLKELEGWEPDDDPWTEHSKRSASCGFLSL 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Xenopus
Match: birc5 (Rap guanine nucleotide exchange factor 3 [Source:NCBI gene;Acc:100491495])

HSP 1 Score: 63.1586 bits (152), Expect = 3.464e-12
Identity = 34/73 (46.58%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            R+ TF +W F + N  C   ++AKAGF +C T  + D   CF CLKEL+GWE DD P  EH+K +  C FL +
Sbjct:   24 RLATFADWPFTE-NCKCTPENMAKAGFVHCPTENEPDVACCFFCLKELEGWEPDDDPWTEHSKRSASCGFLSL 95          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Xenopus
Match: ENSXETT00000024248.1 (baculoviral IAP repeat-containing protein 5.1-like [Source:NCBI gene;Acc:101732421])

HSP 1 Score: 62.7734 bits (151), Expect = 3.553e-12
Identity = 34/73 (46.58%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            R+ TF +W F + N  C   ++AKAGF +C T  + D   CF CLKEL+GWE DD P  EH+K +  C FL +
Sbjct:   18 RLATFADWPFTE-NCKCTPENMAKAGFVHCPTENEPDVACCFFCLKELEGWEPDDDPWTEHSKRSASCGFLSL 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Mouse
Match: Birc5 (baculoviral IAP repeat-containing 5 [Source:MGI Symbol;Acc:MGI:1203517])

HSP 1 Score: 74.3294 bits (181), Expect = 1.045e-16
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 1
Query:   79 WRIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            +RI TFKNW F + + +C    +A+AGF +C T  + D  +CF C KEL+GWE DD P+EEH KH+P C FL +
Sbjct:   17 YRIATFKNWPFLE-DCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTV 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Mouse
Match: Birc5 (baculoviral IAP repeat-containing 5 [Source:MGI Symbol;Acc:MGI:1203517])

HSP 1 Score: 73.559 bits (179), Expect = 1.376e-16
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 1
Query:   79 WRIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            +RI TFKNW F + + +C    +A+AGF +C T  + D  +CF C KEL+GWE DD P+EEH KH+P C FL +
Sbjct:   17 YRIATFKNWPFLE-DCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTV 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Mouse
Match: Birc3 (baculoviral IAP repeat-containing 3 [Source:MGI Symbol;Acc:MGI:1197007])

HSP 1 Score: 61.2326 bits (147), Expect = 1.066e-10
Identity = 30/72 (41.67%), Postives = 40/72 (55.56%), Query Frame = 1
Query:   76 KWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            K R+ T++ W    ++ +     LAKAGFY   P  D + CF C  +L  WE+ D  M EH +H P CPFLK
Sbjct:  170 KARLLTYETWPLSFLSPA----KLAKAGFYYIGP-GDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLK 236          

HSP 2 Score: 53.1434 bits (126), Expect = 6.722e-8
Identity = 32/69 (46.38%), Postives = 36/69 (52.17%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            RI+TF NW    +     S  LA AGFY T   SD +KCF C   L  WE  D P  EHAK  P C +L
Sbjct:  258 RIRTFSNWPSSAL---VHSQELASAGFYYTG-HSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYL 322          

HSP 3 Score: 51.2174 bits (121), Expect = 3.140e-7
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  142 SLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            SLA+AGFY T   +D +KCF C   LD W++ D PME+H K  P C F++
Sbjct:   49 SLARAGFYYTG-ANDKVKCFCCGLMLDNWKQGDSPMEKHRKLYPSCNFVQ 97          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Mouse
Match: Birc3 (baculoviral IAP repeat-containing 3 [Source:MGI Symbol;Acc:MGI:1197007])

HSP 1 Score: 60.077 bits (144), Expect = 2.013e-10
Identity = 30/72 (41.67%), Postives = 40/72 (55.56%), Query Frame = 1
Query:   76 KWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            K R+ T++ W    ++ +     LAKAGFY   P  D + CF C  +L  WE+ D  M EH +H P CPFLK
Sbjct:  170 KARLLTYETWPLSFLSPA----KLAKAGFYYIGP-GDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLK 236          

HSP 2 Score: 53.1434 bits (126), Expect = 5.059e-8
Identity = 32/69 (46.38%), Postives = 36/69 (52.17%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            RI+TF NW    +     S  LA AGFY T   SD +KCF C   L  WE  D P  EHAK  P C +L
Sbjct:  258 RIRTFSNWPSSAL---VHSQELASAGFYYTG-HSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYL 322          

HSP 3 Score: 50.447 bits (119), Expect = 3.790e-7
Identity = 25/51 (49.02%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  142 SLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            SLA+AGFY T   +D +KCF C   LD W++ D PME+H K  P C F++ 
Sbjct:   49 SLARAGFYYTG-ANDKVKCFCCGLMLDNWKQGDSPMEKHRKLYPSCNFVQT 98          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Mouse
Match: Birc2 (baculoviral IAP repeat-containing 2 [Source:MGI Symbol;Acc:MGI:1197009])

HSP 1 Score: 57.3806 bits (137), Expect = 2.419e-9
Identity = 27/70 (38.57%), Postives = 37/70 (52.86%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            R  T+  W    ++ +     LA+AGFY   P  D + CF C  +L  WE  D  M EH +H P+CPFL+
Sbjct:  180 RFLTYSMWPLSFLSPA----ELARAGFYYIGP-GDRVACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLE 244          

HSP 2 Score: 50.447 bits (119), Expect = 5.888e-7
Identity = 25/57 (43.86%), Postives = 36/57 (63.16%), Query Frame = 1
Query:  142 SLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENL 312
            SLA+AGFY T   +D +KCF C   LD W++ D P+E+H +  P C F++  L  +L
Sbjct:   66 SLARAGFYYTG-VNDKVKCFCCGLMLDNWKQGDSPVEKHRQFYPSCSFVQTLLSASL 121          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q804H7|BI52B_XENLA (Baculoviral IAP repeat-containing protein 5.2-B OS=Xenopus laevis OX=8355 GN=birc5.2-b PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 4.206e-16
Identity = 42/125 (33.60%), Postives = 71/125 (56.80%), Query Frame = 1
Query:   73 LKWRIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVS-NADLDQCISVFTNSLNEIKDY 438
            L  R++TF NW F + + +C    +A+AGF +C T+   D +KCF CLKEL+GW+ +D PM+EH KH+P C F+ +          L+ +E L++  ++  +     ++  I  F    NE++ +
Sbjct:   28 LATRLRTFSNWPFTE-DCACTPERMAEAGFVHCPTDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHSPSCLFIAL----KKKAEELTLSEFLKLDLEHMKIKMQKQMNLHIERFQAKANEVRGH 147          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q50L39|BI52A_XENLA (Baculoviral IAP repeat-containing protein 5.2-A OS=Xenopus laevis OX=8355 GN=birc5.2-a PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.527e-16
Identity = 41/122 (33.61%), Postives = 70/122 (57.38%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVS-NADLDQCISVFTNSLNEIKDY 438
            R++TF NW F + + +C    +A+AGF +C T+   D +KCF CLKEL+GW+ +D PM+EH KH+P C F+ +          L+ +E L++  ++  +     ++  I  F    NE++ +
Sbjct:   31 RLRTFSNWPFTE-DCACTPERMAEAGFVHCPTDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHSPSCLFIAL----KKKAEELTLSEFLKLDLEHTKIKMQKQMNLHIERFQAKANEVRGH 147          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q9JHY7|BIRC5_RAT (Baculoviral IAP repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Birc5 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.341e-16
Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            RI TFKNW F + + SC    +A+AGF +C T  + D  +CF C KEL+GWE DD P+EEH KH+P C FL +
Sbjct:   18 RIYTFKNWPFLE-DCSCTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTV 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. UniProt/SwissProt
Match: sp|O70201|BIRC5_MOUSE (Baculoviral IAP repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Birc5 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.310e-16
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 1
Query:   79 WRIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            +RI TFKNW F + + +C    +A+AGF +C T  + D  +CF C KEL+GWE DD P+EEH KH+P C FL +
Sbjct:   17 YRIATFKNWPFLE-DCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTV 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q28ER3|BIR52_XENTR (Baculoviral IAP repeat-containing protein 5.2 OS=Xenopus tropicalis OX=8364 GN=birc5.2 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.895e-15
Identity = 42/125 (33.60%), Postives = 69/125 (55.20%), Query Frame = 1
Query:   73 LKWRIQTFKNWQFDKMNSSCDSVSLAKAGF-YCTNPKS-DSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVS-NADLDQCISVFTNSLNEIKDY 438
            L  R+ TF NW F + + +C    +A+AGF +C +  S D +KCF CLKEL+GW+ +D PM+EH KH+P C F+ +          L+ +E L++  +   +     ++Q I  F    N ++ +
Sbjct:   27 LATRLSTFANWPFTE-DCACTPERMAEAGFVHCPSDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHSPSCLFIAL----KKKAEELTLSEFLKLDLERTKIKMQKQMNQHIENFQAKANVVRGH 146          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. TrEMBL
Match: T1J1U5 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 6.034e-18
Identity = 44/108 (40.74%), Postives = 65/108 (60.19%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPK-SDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQN---YVVSNADLDQ 393
            R+++F  W + +  S C  V +A+AGFYC + K +D  KCF+C KELDGWE  DVP  EH  H+P CPF+K+G  E+     +   + L++ C+     +VS + L Q
Sbjct:   19 RLKSFNKWPYQR-ESKCTPVEMARAGFYCPDEKFADLAKCFVCDKELDGWEIGDVPWHEHESHSPNCPFIKLGKTESE----MKVDDFLKLACETSTFKIVSESSLSQ 121          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. TrEMBL
Match: B4LXU9 (Uncharacterized protein OS=Drosophila virilis OX=7244 GN=Dvir\GJ24423 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.622e-18
Identity = 50/133 (37.59%), Postives = 76/133 (57.14%), Query Frame = 1
Query:   76 KWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPK--SDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQSLFQELNEL 468
            K R+++FK+W F    S+C    +A+AGFY T  K  +D+  CF+C K LDGWE +D P +EH KHAP C F+K+G  E      L+  + L+I C    V N+++++ I  F +    +KD +S   E   +
Sbjct:   23 KHRVESFKDWPFS-AKSTCSIGKMAEAGFYWTGTKRENDTATCFVCAKTLDGWESEDDPWKEHLKHAPQCEFIKLGCPE----KDLTVEQFLKIFC---TVVNSNIEKNIKQFKSKF--VKDNESKLDEFTHM 145          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. TrEMBL
Match: A0A2H1CK54 (Inhibitor of Apoptosis domain protein (Fragment) OS=Fasciola hepatica OX=6192 GN=D915_05439 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.247e-17
Identity = 44/124 (35.48%), Postives = 68/124 (54.84%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFY-CTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQSLF 450
            R++TFKNW +   N  C    LA++GF+      SD  +CF+C KEL+GWE DD P +EH +H+P CPFLK   YE ++     + +++R +     + +  L +  S     L  I+D  S +
Sbjct:    2 RLETFKNWPYGGRNK-CSPEKLAQSGFFHPMKTGSDVAQCFVCFKELEGWEPDDDPRKEHEQHSPSCPFLKSKPYEEMTALEGLEMDIIRHSNMLQTLRDRTLQEVQSEVDRQLQTIRDTLSKY 124          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. TrEMBL
Match: A0A5K4F172 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.771e-17
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = 1
Query:   79 WRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKS-DSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLS 315
            +R+ T  NW +D  NS C +  +AK+GFY  NP +  + +CF+C+KEL+GWE DD P +EH  H+P CPFLK   YE ++
Sbjct:   17 YRLSTLSNWPYDG-NSLCTAEKMAKSGFYRPNPSNPTTTQCFVCMKELEGWEPDDDPDKEHKSHSPKCPFLKSKQYEQMT 95          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. TrEMBL
Match: A0A183R6M3 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.771e-17
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = 1
Query:   79 WRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKS-DSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLS 315
            +R+ T  NW +D  NS C +  +AK+GFY  NP +  + +CF+C+KEL+GWE DD P +EH  H+P CPFLK   YE ++
Sbjct:   17 YRLSTLSNWPYDG-NSLCTAEKMAKSGFYRPNPSNPTTTQCFVCMKELEGWEPDDDPDKEHKSHSPKCPFLKSKQYEQMT 95          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Cavefish
Match: birc5b (baculoviral IAP repeat containing 5b [Source:ZFIN;Acc:ZDB-GENE-030826-2])

HSP 1 Score: 70.8626 bits (172), Expect = 2.249e-15
Identity = 46/126 (36.51%), Postives = 72/126 (57.14%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YCTNP-KSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEI-KDYQSLF 450
            R+QTF +W F + +  C    +AKAGF +C +  + D + CF CLKEL+GWE +DVP  EHA+ +P C FL++  ++ L+       E  RI  +NY+     +   I+ F + +  I K  ++LF
Sbjct:   23 RLQTFSDWPF-REDCQCTPEQMAKAGFVHCPSENEPDVVCCFYCLKELEGWEPEDVP-SEHARRSPDCAFLQMKTWKELTAIEFFHLEHGRI--RNYIRKMGHMK--IACFRDEVENINKCLKTLF 142          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Cavefish
Match: birc5a (baculoviral IAP repeat containing 5 [Source:NCBI gene;Acc:103025428])

HSP 1 Score: 67.781 bits (164), Expect = 2.986e-14
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query:   46 MNYIPNE----CFLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKS--DSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRI--TCQNYVVSN 378
            M + P+E     F + R+ TF  W F++   +C   ++AKAGF  T   +  D  +CF CLKEL+GWE +D P +EH  H+P C F+ +      S   L+  E LR+    Q +V+  
Sbjct:    1 MTFTPDEDTKLYFYENRLLTFVGWPFEE-GCACTPETMAKAGFIHTPSANSPDVAQCFFCLKELEGWEPEDDPEKEHKAHSPSCTFITL----KKSVESLTVEEFLRLEKERQKFVIKK 114          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Cavefish
Match: BIRC5 (baculoviral IAP repeat-containing protein 5.2-like [Source:NCBI gene;Acc:111192978])

HSP 1 Score: 66.2402 bits (160), Expect = 1.121e-13
Identity = 32/75 (42.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:   70 FLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCT--NPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            F K R+ T+  W FD+   +C S ++A+AGF  T  +   D ++CF C KEL+GWE  D P++EH  H+P C F+
Sbjct:   13 FYKNRLATYSGWPFDE-ECACTSENMAQAGFIHTPSDNSPDVVQCFFCCKELEGWEPQDDPVKEHRSHSPACNFI 86          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 56.9954 bits (136), Expect = 2.154e-9
Identity = 29/69 (42.03%), Postives = 39/69 (56.52%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R+ TF+NW      +S    +LA+AGF+ T    D++KCF C   L  WE  D P +EHAK  P C +L
Sbjct:  165 RLTTFQNW---PPGASVQPDTLAQAGFFYTG-HGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYL 229          

HSP 2 Score: 52.373 bits (124), Expect = 7.719e-8
Identity = 32/106 (30.19%), Postives = 52/106 (49.06%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL----------KIGLYENLSGNILSKAELLRITCQNYV 369
            R+++F++W  D   S  D   LA+AGFY      D+++CF C   L  W   D P+ EH +H P C F+            G  +++ G +LS+ + + +  Q  V
Sbjct:   50 RLRSFEHWATDSPVSPTD---LARAGFYFLG-YGDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGNIPRTPGSPDSVDGQLLSQLQRMGVDEQVSV 151          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 56.6102 bits (135), Expect = 3.155e-9
Identity = 29/69 (42.03%), Postives = 39/69 (56.52%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R+ TF+NW      +S    +LA+AGF+ T    D++KCF C   L  WE  D P +EHAK  P C +L
Sbjct:  165 RLTTFQNW---PPGASVQPDTLAQAGFFYTG-HGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYL 229          

HSP 2 Score: 52.7582 bits (125), Expect = 5.844e-8
Identity = 32/106 (30.19%), Postives = 52/106 (49.06%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL----------KIGLYENLSGNILSKAELLRITCQNYV 369
            R+++F++W  D   S  D   LA+AGFY      D+++CF C   L  W   D P+ EH +H P C F+            G  +++ G +LS+ + + +  Q  V
Sbjct:   50 RLRSFEHWATDSPVSPTD---LARAGFYFLG-YGDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGNIPRTPGSPDSVDGQLLSQLQRMGVDEQVSV 151          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Sea Lamprey
Match: birc5a (baculoviral IAP repeat containing 5a [Source:ZFIN;Acc:ZDB-GENE-030826-1])

HSP 1 Score: 62.3882 bits (150), Expect = 6.164e-13
Identity = 34/75 (45.33%), Postives = 48/75 (64.00%), Query Frame = 1
Query:   73 LKWRIQTFKN-WQFDKMNSSCDSVSLAKAGFYC--TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            L+ R +T+ + W F K N +C    +A AGF    ++ + D++ CF C KELDGWE+DDVP+ EH KH+  C FL
Sbjct:   16 LERRRKTYDDRWPF-KENCACTPEQMAIAGFLHQPSDLELDAVICFFCFKELDGWEQDDVPLIEHKKHSSDCGFL 89          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 50.447 bits (119), Expect = 8.732e-8
Identity = 25/70 (35.71%), Postives = 35/70 (50.00%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            R+ +F  W     +S      LA+AG Y   P +D + CF C   +  WE+ DVP +EH +H   C F K
Sbjct:  169 RLLSFSTW---PESSPVRPADLARAGLYYVGP-NDRVACFYCSGVMRDWEEGDVPAKEHERHFSTCAFAK 234          

HSP 2 Score: 49.2914 bits (116), Expect = 2.195e-7
Identity = 34/103 (33.01%), Postives = 49/103 (47.57%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSK-AELLRIT-CQNYVVSNAD 384
            R+ T++ W      ++  +  LA AGFY T    D++KCF C   L  WE+ D P  EH K  P C FL     E     I+ +  +L+ +T  QN    N +
Sbjct:  252 RLATYQAW---PSTANVAAQPLAIAGFYYTG-HGDNVKCFHCDGGLRNWEQGDNPWYEHGKWFPRCAFLLQQKGEAFVNEIMRQHPQLIDLTRSQNAAAQNGN 350          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Sea Lamprey
Match: birc6 (baculoviral IAP repeat containing 6 [Source:ZFIN;Acc:ZDB-GENE-091202-7])

HSP 1 Score: 50.447 bits (119), Expect = 1.077e-7
Identity = 28/78 (35.90%), Postives = 36/78 (46.15%), Query Frame = 1
Query:   64 ECFLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFY--CTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLK 291
            E F  W    ++  Q D M         A+AGFY   T+   D   CF C   L  WE  D P  EH +H+P CP++K
Sbjct:  257 ETFTSWPHAHYRWAQPDPM---------AQAGFYHQPTSNGDDRAMCFTCSVCLVSWEPTDEPWSEHERHSPNCPYVK 325          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Nematostella
Match: EDO32646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG7])

HSP 1 Score: 83.1889 bits (204), Expect = 1.343e-20
Identity = 40/94 (42.55%), Postives = 59/94 (62.77%), Query Frame = 1
Query:   76 KWRIQTFKNWQFDKMNSSCDSVSLAKAGFYC--TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRI 351
            K R++TFK+W F+ M+  C +  +A AGFY   T+   D  +CF+C KELDGWE +D P +EH KH+P C F+K+    N S N ++  + L +
Sbjct:   14 KKRLETFKDWPFNHMDCKCTAEKMAAAGFYHCETDDDPDVARCFVCFKELDGWEPEDDPWQEHKKHSPKCEFVKL----NKSSNEITVQQFLEL 103          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Nematostella
Match: EDO35786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK5])

HSP 1 Score: 53.5286 bits (127), Expect = 8.885e-9
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 1
Query:   58 PNEC-FLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            PN+   +  R++TF  W      SS +   LA+AGF  T  + D ++CF C   L  W+ DD P+E H +  P CP L
Sbjct:  129 PNDLNLVGARVRTFNFWP---ATSSANVFELARAGFVFTG-RDDVVECFKCKGTLKQWKVDDRPIESHREFYPDCPLL 202          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Nematostella
Match: EDO30381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y6])

HSP 1 Score: 51.6026 bits (122), Expect = 4.394e-8
Identity = 27/69 (39.13%), Postives = 37/69 (53.62%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R+ TF +W     +S      L+ AGFY      DS+KC+ C   L  WE DD+P  EH K +P+CP +
Sbjct:   81 RLTTFVDW---PESSPVRPWELSSAGFYYLG-DQDSVKCYKCGVALRNWEPDDLPWVEHEKWSPHCPLV 145          

HSP 2 Score: 47.7506 bits (112), Expect = 8.084e-7
Identity = 26/69 (37.68%), Postives = 35/69 (50.72%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R++++ +W     N       LA AGFY T    D ++CF C  +L  W   D P EEH KH P C F+
Sbjct:    7 RLESYIHW---PENCPVRPRELAMAGFYYTG-CGDQVRCFSCDLQLGKWVDGDEPFEEHLKHRPSCGFI 71          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Medaka
Match: birc5a (baculoviral IAP repeat-containing protein 5.2 [Source:NCBI gene;Acc:101155061])

HSP 1 Score: 73.1738 bits (178), Expect = 2.054e-16
Identity = 35/73 (47.95%), Postives = 48/73 (65.75%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCT--NPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            R++TF+NW FDK + +C   ++A+AGF  T  +   D   CF CLKEL+GWE DD P +EH  HAP C F+ +
Sbjct:   14 RLKTFENWPFDK-DCTCTPENMARAGFVHTPSDNSPDIAMCFFCLKELEGWEPDDDPQKEHKSHAPSCSFISL 85          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Medaka
Match: birc5a (baculoviral IAP repeat-containing protein 5.2 [Source:NCBI gene;Acc:101155061])

HSP 1 Score: 73.1738 bits (178), Expect = 2.294e-16
Identity = 35/73 (47.95%), Postives = 48/73 (65.75%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCT--NPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI 294
            R++TF+NW FDK + +C   ++A+AGF  T  +   D   CF CLKEL+GWE DD P +EH  HAP C F+ +
Sbjct:   16 RLKTFENWPFDK-DCTCTPENMARAGFVHTPSDNSPDIAMCFFCLKELEGWEPDDDPQKEHKSHAPSCSFISL 87          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Medaka
Match: birc5b (baculoviral IAP repeat-containing protein 5.1-A [Source:NCBI gene;Acc:101168459])

HSP 1 Score: 60.4622 bits (145), Expect = 1.776e-11
Identity = 41/110 (37.27%), Postives = 58/110 (52.73%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGF-YC-TNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKI-GLYENLSGN---ILSKAEL---LRITCQNYVVSNAD 384
            R Q+F +W F +   +C    +AKAGF +C +  + D   CF CL EL+GWE DD P  EHAK +P C FL +  ++  L+ +   IL K  L   +R  C   +    D
Sbjct:   23 REQSFADWPF-REECNCTPEKMAKAGFVHCPSQNEPDVACCFFCLIELEGWEPDDDPWTEHAKRSPNCGFLSMKKIFNELTVSEFFILEKERLKVFIRKVCHKKMAQLRD 131          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000034629.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 55.4546 bits (132), Expect = 6.043e-9
Identity = 37/103 (35.92%), Postives = 52/103 (50.49%), Query Frame = 1
Query:   76 KWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPF----------LKIGLYENLSGNILSKAELLRIT 354
            + R+QTF+NW  +   +S D   LAKAGFY      D ++CF C   L  W   D P  EH++H P C F          L+ G  + + G +LS  +L R+T
Sbjct:   21 RERLQTFQNWPDEAPVTSED---LAKAGFYFLG-SEDKVRCFCCGGILRHWADGDCPTAEHSRHFPNCKFILGQAVGNIPLQPGSSDFVDGQLLS--QLQRMT 117          

HSP 2 Score: 55.0694 bits (131), Expect = 8.398e-9
Identity = 30/69 (43.48%), Postives = 37/69 (53.62%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R+ TF NW      +S    +LA AGF+ T    D++KCF C   L  WE  D P +EHAK  P C FL
Sbjct:  138 RLTTFHNW---PSEASIQPDALASAGFFYTG-HGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFL 202          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000012200.2 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 55.4546 bits (132), Expect = 6.361e-9
Identity = 30/69 (43.48%), Postives = 37/69 (53.62%), Query Frame = 1
Query:   82 RIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFL 288
            R+ TF NW      +S    +LA AGF+ T    D++KCF C   L  WE  D P +EHAK  P C FL
Sbjct:  102 RLTTFHNW---PSEASIQPDALASAGFFYTG-HGDNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFL 166          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Planmine SMEST
Match: SMESG000033647.1 (SMESG000033647.1)

HSP 1 Score: 276.944 bits (707), Expect = 2.216e-96
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 1
Query:   46 MNYIPNECFLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQ 441
            MNYIPNECFLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQ
Sbjct:    1 MNYIPNECFLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQ 132          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Planmine SMEST
Match: SMESG000033647.1 (SMESG000033647.1)

HSP 1 Score: 225.713 bits (574), Expect = 2.000e-76
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 1
Query:  118 MNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQ 441
            MNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQ
Sbjct:    1 MNSSCDSVSLAKAGFYCTNPKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELLRITCQNYVVSNADLDQCISVFTNSLNEIKDYQ 108          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.433e-8
Identity = 32/85 (37.65%), Postives = 45/85 (52.94%), Query Frame = 1
Query:  106 QFDKMNSSCDSV--------SLAKAGFYCTN--PKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPF---LKIG----LYEN 309
            +F+++NS   SV        +LAK+GFY        D +KC  C   +  WEK+D+PM++H    P CPF   L +G    LYEN
Sbjct:   61 EFERINSFAKSVIFNQDQVKTLAKSGFYYKENLMGPDQVKCIYCQGTISDWEKNDIPMKKHKLKFPTCPFMIYLNVGNEPLLYEN 145          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.463e-8
Identity = 32/85 (37.65%), Postives = 45/85 (52.94%), Query Frame = 1
Query:  106 QFDKMNSSCDSV--------SLAKAGFYCTN--PKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPF---LKIG----LYEN 309
            +F+++NS   SV        +LAK+GFY        D +KC  C   +  WEK+D+PM++H    P CPF   L +G    LYEN
Sbjct:   61 EFERINSFAKSVIFNQDQVKTLAKSGFYYKENLMGPDQVKCIYCQGTISDWEKNDIPMKKHKLKFPTCPFMIYLNVGNEPLLYEN 145          
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Planmine SMEST
Match: SMESG000023072.1 (SMESG000023072.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.507e-8
Identity = 32/85 (37.65%), Postives = 45/85 (52.94%), Query Frame = 1
Query:  106 QFDKMNSSCDSV--------SLAKAGFYCTN--PKSDSLKCFMCLKELDGWEKDDVPMEEHAKHAPYCPF---LKIG----LYEN 309
            +F+++NS   SV        +LAK+GFY        D +KC  C   +  WEK+D+PM++H    P CPF   L +G    LYEN
Sbjct:   50 EFERINSFAKSVIFNQDQVKTLAKSGFYYKENLMGPDQVKCIYCQGTISDWEKNDIPMKKHKLKFPTCPFMIYLNVGNEPLLYEN 134          
The following BLAST results are available for this feature:
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BIRC57.821e-1549.32baculoviral IAP repeat containing 5 [Source:HGNC S... [more]
BIRC59.879e-1550.00baculoviral IAP repeat containing 5 [Source:HGNC S... [more]
BIRC53.654e-1050.00baculoviral IAP repeat containing 5 [Source:HGNC S... [more]
BIRC55.192e-1038.61baculoviral IAP repeat containing 5 [Source:HGNC S... [more]
BIRC39.586e-1040.00baculoviral IAP repeat containing 3 [Source:HGNC S... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bir-11.247e-1345.45Chromosomal passenger complex protein bir-1 [Sour... [more]
bir-22.341e-1049.33Baculoviral IAP repeat-containing protein bir-2 [... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Det1.073e-1646.58gene:FBgn0264291 transcript:FBtr0083408[more]
Diap12.668e-1035.23gene:FBgn0260635 transcript:FBtr0075500[more]
Diap12.668e-1035.23gene:FBgn0260635 transcript:FBtr0333618[more]
Diap12.668e-1035.23gene:FBgn0260635 transcript:FBtr0075501[more]
Diap12.668e-1035.23gene:FBgn0260635 transcript:FBtr0333619[more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc5b2.661e-1345.95baculoviral IAP repeat containing 5b [Source:ZFIN;... [more]
birc5b2.833e-1345.95baculoviral IAP repeat containing 5b [Source:ZFIN;... [more]
birc5a3.768e-1344.00baculoviral IAP repeat containing 5a [Source:ZFIN;... [more]
birc29.210e-933.64baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
birc29.210e-933.64baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc5l5.827e-1633.60baculoviral IAP repeat containing 5 like [Source:N... [more]
ENSXETT00000024230.11.499e-1236.36baculoviral IAP repeat-containing protein 5.1-like... [more]
ENSXETT00000024239.11.738e-1246.58baculoviral IAP repeat-containing protein 5.1-like... [more]
birc53.464e-1246.58Rap guanine nucleotide exchange factor 3 [Source:N... [more]
ENSXETT00000024248.13.553e-1246.58baculoviral IAP repeat-containing protein 5.1-like... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Birc51.045e-1650.00baculoviral IAP repeat-containing 5 [Source:MGI Sy... [more]
Birc51.376e-1650.00baculoviral IAP repeat-containing 5 [Source:MGI Sy... [more]
Birc31.066e-1041.67baculoviral IAP repeat-containing 3 [Source:MGI Sy... [more]
Birc32.013e-1041.67baculoviral IAP repeat-containing 3 [Source:MGI Sy... [more]
Birc22.419e-938.57baculoviral IAP repeat-containing 2 [Source:MGI Sy... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q804H7|BI52B_XENLA4.206e-1633.60Baculoviral IAP repeat-containing protein 5.2-B OS... [more]
sp|Q50L39|BI52A_XENLA5.527e-1633.61Baculoviral IAP repeat-containing protein 5.2-A OS... [more]
sp|Q9JHY7|BIRC5_RAT6.341e-1652.05Baculoviral IAP repeat-containing protein 5 OS=Rat... [more]
sp|O70201|BIRC5_MOUSE7.310e-1650.00Baculoviral IAP repeat-containing protein 5 OS=Mus... [more]
sp|Q28ER3|BIR52_XENTR2.895e-1533.60Baculoviral IAP repeat-containing protein 5.2 OS=X... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1J1U56.034e-1840.74Uncharacterized protein OS=Strigamia maritima OX=1... [more]
B4LXU98.622e-1837.59Uncharacterized protein OS=Drosophila virilis OX=7... [more]
A0A2H1CK541.247e-1735.48Inhibitor of Apoptosis domain protein (Fragment) O... [more]
A0A5K4F1721.771e-1747.50Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183R6M31.771e-1747.50Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc5b2.249e-1536.51baculoviral IAP repeat containing 5b [Source:ZFIN;... [more]
birc5a2.986e-1435.29baculoviral IAP repeat containing 5 [Source:NCBI g... [more]
BIRC51.121e-1342.67baculoviral IAP repeat-containing protein 5.2-like... [more]
birc72.154e-942.03baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc73.155e-942.03baculoviral IAP repeat-containing protein 7 [Sourc... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
birc5a6.164e-1345.33baculoviral IAP repeat containing 5a [Source:ZFIN;... [more]
birc28.732e-835.71baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
birc61.077e-735.90baculoviral IAP repeat containing 6 [Source:ZFIN;A... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO326461.343e-2042.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357868.885e-937.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303814.394e-839.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc5a2.054e-1647.95baculoviral IAP repeat-containing protein 5.2 [Sou... [more]
birc5a2.294e-1647.95baculoviral IAP repeat-containing protein 5.2 [Sou... [more]
birc5b1.776e-1137.27baculoviral IAP repeat-containing protein 5.1-A [S... [more]
ENSORLT00000034629.16.043e-935.92baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
ENSORLT00000012200.26.361e-943.48baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033647.12.216e-96100.00SMESG000033647.1[more]
SMESG000033647.12.000e-76100.00SMESG000033647.1[more]
SMESG000023072.14.433e-837.65SMESG000023072.1[more]
SMESG000023072.14.463e-837.65SMESG000023072.1[more]
SMESG000023072.14.507e-837.65SMESG000023072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009506 ID=SMED30009506|Name=Baculoviral IAP repeat-containing protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=624bp
TTTAAATTCGAAAACTAAAATAATTAATTTTGATACAATATTTCGATGAA
TTACATTCCTAATGAATGTTTTTTGAAGTGGAGAATTCAAACTTTTAAAA
ACTGGCAGTTTGATAAAATGAATAGTTCTTGCGATTCAGTAAGTTTAGCT
AAAGCAGGATTTTATTGTACTAATCCTAAATCGGATTCGTTAAAATGTTT
CATGTGCTTGAAAGAGTTAGATGGATGGGAGAAAGACGACGTTCCAATGG
AAGAACATGCCAAACATGCCCCTTATTGTCCATTTTTGAAAATTGGATTA
TATGAAAATTTATCTGGAAATATTTTATCAAAAGCTGAATTACTTAGGAT
CACATGTCAGAACTATGTTGTTTCCAATGCTGATTTAGATCAATGTATTA
GTGTTTTTACCAATTCTCTGAATGAAATCAAAGATTATCAAAGCCTGTTC
CAAGAACTAAACGAGCTAAATAAATTTATATTGTCGTGATTTTAAGTAAA
CAATTAGAATGCATAATTTCTTAAAATTATTTTGAAAGATTTCTGACTGC
GTTAAAAGTTACAAAACTTGAATGTCTTAATTTATAGTTTTATTAAATGT
TTATGAATAAATAATTAAAGCTGC
back to top

protein sequence of SMED30009506-orf-1

>SMED30009506-orf-1 ID=SMED30009506-orf-1|Name=SMED30009506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MNYIPNECFLKWRIQTFKNWQFDKMNSSCDSVSLAKAGFYCTNPKSDSLK
CFMCLKELDGWEKDDVPMEEHAKHAPYCPFLKIGLYENLSGNILSKAELL
RITCQNYVVSNADLDQCISVFTNSLNEIKDYQSLFQELNELNKFILS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001370BIR_rpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane