Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30009502
Length (bp)1820
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30009502) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30009502) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30009502) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30009502) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009502

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30009502SMESG000016740.1 dd_Smed_v4_8944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009502SMESG000016740.1 dd_Smed_v4_8944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009502SMESG000016740.1 dd_Smed_v4_8944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009502SMESG000016740.1 dd_Smed_v4_8944_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 155.992 bits (393), Expect = 1.803e-40
Identity = 89/258 (34.50%), Postives = 143/258 (55.43%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K E LG+GA+G VY  ++ +G +  AVK +     ++    KE++ L  E  +   + H  I+   G+  +E  + IFMEF  GG++ + I++ G L      +++KQIL+GV +LH+  ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P     S +  + ++  + +DQ++RP+A QLL
Sbjct:  245 KGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTRDQHERPSALQLL 501          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 153.68 bits (387), Expect = 2.507e-38
Identity = 89/258 (34.50%), Postives = 143/258 (55.43%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K E LG+GA+G VY  ++ +G +  AVK +     ++    KE++ L  E  +   + H  I+   G+  +E  + IFMEF  GG++ + I++ G L      +++KQIL+GV +LH+  ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P     S +  + ++  + +DQ++RP+A QLL
Sbjct:  950 KGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTRDQHERPSALQLL 1206          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 153.68 bits (387), Expect = 2.575e-38
Identity = 89/258 (34.50%), Postives = 143/258 (55.43%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K E LG+GA+G VY  ++ +G +  AVK +     ++    KE++ L  E  +   + H  I+   G+  +E  + IFMEF  GG++ + I++ G L      +++KQIL+GV +LH+  ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P     S +  + ++  + +DQ++RP+A QLL
Sbjct: 1063 KGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTRDQHERPSALQLL 1319          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 153.68 bits (387), Expect = 2.575e-38
Identity = 89/258 (34.50%), Postives = 143/258 (55.43%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K E LG+GA+G VY  ++ +G +  AVK +     ++    KE++ L  E  +   + H  I+   G+  +E  + IFMEF  GG++ + I++ G L      +++KQIL+GV +LH+  ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P     S +  + ++  + +DQ++RP+A QLL
Sbjct: 1063 KGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTRDQHERPSALQLL 1319          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 147.902 bits (372), Expect = 3.495e-37
Identity = 104/300 (34.67%), Postives = 155/300 (51.67%), Query Frame = 1
Query:  895 DIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLL---INEMRNQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            DI       MDI   +       P + RL      + LGQGAFG+VY C      ++ AVK +   P S    +KE   L   I  ++N + H RI++ YG     +EK L IFME+  GG++++++   G L+     ++++QILEGV +LH   I+HRDIK  NIL D+  NVKL DF  S+          G KS+T   GTP +++PE+++   Y   ADIWSV  T   M+T KPP+   +  +AI ++I T          +S   R+ +K +   +   RP+A +LL +   H
Sbjct:  332 DIDNPTLTVMDISPPSRSPR--APTNWRL-----GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSP-ETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVT---GTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAI-FKIATQPTNPKLPPHVSDYTRDFLKRIF-VEAKLRPSADELLRHMFVH 617          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 150.984 bits (380), Expect = 1.953e-38
Identity = 85/252 (33.73%), Postives = 143/252 (56.75%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E +G+G+FG+VYK I  +  +  A+K+I   +  +  E      ++ +Q +   + K +GSF K  KL I ME+  GG+  + ++K GKL    +    ++IL+G+E+LH    IHRDIK  N+L+  + +VK+ADF  +   T+  K   TF G+P ++APE++    Y + ADIWS+G T   +  G+PP++ +  P  +++ I  N   V + +  S   +E ++  +NKD   RP+A+ LL +Q  
Sbjct:   36 KQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLH-PMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 150.599 bits (379), Expect = 2.183e-38
Identity = 85/252 (33.73%), Postives = 143/252 (56.75%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E +G+G+FG+VYK I  +  +  A+K+I   +  +  E      ++ +Q +   + K +GSF K  KL I ME+  GG+  + ++K GKL    +    ++IL+G+E+LH    IHRDIK  N+L+  + +VK+ADF  +   T+  K   TF G+P ++APE++    Y + ADIWS+G T   +  G+PP++ +  P  +++ I  N   V + +  S   +E ++  +NKD   RP+A+ LL +Q  
Sbjct:   16 KQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLH-PMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 265          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 150.599 bits (379), Expect = 2.234e-38
Identity = 85/252 (33.73%), Postives = 143/252 (56.75%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E +G+G+FG+VYK I  +  +  A+K+I   +  +  E      ++ +Q +   + K +GSF K  KL I ME+  GG+  + ++K GKL    +    ++IL+G+E+LH    IHRDIK  N+L+  + +VK+ADF  +   T+  K   TF G+P ++APE++    Y + ADIWS+G T   +  G+PP++ +  P  +++ I  N   V + +  S   +E ++  +NKD   RP+A+ LL +Q  
Sbjct:   21 KQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLH-PMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 150.214 bits (378), Expect = 8.164e-38
Identity = 85/252 (33.73%), Postives = 143/252 (56.75%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E +G+G+FG+VYK I  +  +  A+K+I   +  +  E      ++ +Q +   + K +GSF K  KL I ME+  GG+  + ++K GKL    +    ++IL+G+E+LH    IHRDIK  N+L+  + +VK+ADF  +   T+  K   TF G+P ++APE++    Y + ADIWS+G T   +  G+PP++ +  P  +++ I  N   V + +  S   +E ++  +NKD   RP+A+ LL +Q  
Sbjct:  186 KQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLH-PMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 435          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 142.51 bits (358), Expect = 1.470e-35
Identity = 86/252 (34.13%), Postives = 139/252 (55.16%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNND-NVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E +G+G+FG+VYK I  +  +  A+K+I   +  +  E      ++ +Q +   + K +GSF K  KL I ME+  GG+  + ++K GKL    +    ++IL+G+E+LH    IHRDIK  N+LLD     VK+ D+  ++         TF GTP F+APE+V    Y+  ADIWS+G T   +  G+PP++ +  P  +++ I  N   V + +  S   +E ++  +NKD   RP+A+ LL +Q  
Sbjct:   36 KQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALD-LTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVLKANTFVGTPFFMAPEVVKG-EYSIEADIWSLGITAIELANGEPPHSDLH-PMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343587)

HSP 1 Score: 137.117 bits (344), Expect = 5.134e-35
Identity = 85/271 (31.37%), Postives = 139/271 (51.29%), Query Frame = 1
Query:  991 DKSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLL------INEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIV------NDIHYTFSADIWSVGATNFNMITGKPPYNH---IDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            +  E LG+G    V +CI ++  K++A K+I     +E G T  + +L      I+ +R  + H  II +   F  +  + +  E    G L + ++    LS +      +QI EGVE++H   I+HRD+KP NILLD N NVK+ DF +++  +  + LT   GTP ++APE +          Y+   DIW+ G   F ++ G PP+ H   + +   IM   G   F  PE ADIS D +++I+  +  D ++R T  ++L +  F+
Sbjct:   24 EPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIME--GKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0090002)

HSP 1 Score: 136.732 bits (343), Expect = 1.201e-34
Identity = 85/271 (31.37%), Postives = 139/271 (51.29%), Query Frame = 1
Query:  991 DKSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLL------INEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIV------NDIHYTFSADIWSVGATNFNMITGKPPYNH---IDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            +  E LG+G    V +CI ++  K++A K+I     +E G T  + +L      I+ +R  + H  II +   F  +  + +  E    G L + ++    LS +      +QI EGVE++H   I+HRD+KP NILLD N NVK+ DF +++  +  + LT   GTP ++APE +          Y+   DIW+ G   F ++ G PP+ H   + +   IM   G   F  PE ADIS D +++I+  +  D ++R T  ++L +  F+
Sbjct:   24 EPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIME--GKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343648)

HSP 1 Score: 136.732 bits (343), Expect = 1.201e-34
Identity = 85/271 (31.37%), Postives = 139/271 (51.29%), Query Frame = 1
Query:  991 DKSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLL------INEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIV------NDIHYTFSADIWSVGATNFNMITGKPPYNH---IDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            +  E LG+G    V +CI ++  K++A K+I     +E G T  + +L      I+ +R  + H  II +   F  +  + +  E    G L + ++    LS +      +QI EGVE++H   I+HRD+KP NILLD N NVK+ DF +++  +  + LT   GTP ++APE +          Y+   DIW+ G   F ++ G PP+ H   + +   IM   G   F  PE ADIS D +++I+  +  D ++R T  ++L +  F+
Sbjct:   24 EPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIME--GKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0301501)

HSP 1 Score: 136.732 bits (343), Expect = 7.736e-34
Identity = 85/271 (31.37%), Postives = 139/271 (51.29%), Query Frame = 1
Query:  991 DKSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLL------INEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIV------NDIHYTFSADIWSVGATNFNMITGKPPYNH---IDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            +  E LG+G    V +CI ++  K++A K+I     +E G T  + +L      I+ +R  + H  II +   F  +  + +  E    G L + ++    LS +      +QI EGVE++H   I+HRD+KP NILLD N NVK+ DF +++  +  + LT   GTP ++APE +          Y+   DIW+ G   F ++ G PP+ H   + +   IM   G   F  PE ADIS D +++I+  +  D ++R T  ++L +  F+
Sbjct:   24 EPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIME--GKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0301500)

HSP 1 Score: 136.732 bits (343), Expect = 7.736e-34
Identity = 85/271 (31.37%), Postives = 139/271 (51.29%), Query Frame = 1
Query:  991 DKSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLL------INEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIV------NDIHYTFSADIWSVGATNFNMITGKPPYNH---IDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            +  E LG+G    V +CI ++  K++A K+I     +E G T  + +L      I+ +R  + H  II +   F  +  + +  E    G L + ++    LS +      +QI EGVE++H   I+HRD+KP NILLD N NVK+ DF +++  +  + LT   GTP ++APE +          Y+   DIW+ G   F ++ G PP+ H   + +   IM   G   F  PE ADIS D +++I+  +  D ++R T  ++L +  F+
Sbjct:   24 EPKEILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNLCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIME--GKYSFTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPFFN 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 158.688 bits (400), Expect = 1.534e-43
Identity = 96/267 (35.96%), Postives = 148/267 (55.43%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP----KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR-------TKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL-HNQIFH 1746
            K E LG+GA+G VY  ++ +G +  AVK +      SE    KE+  L  E  +   + H+ I+   G+   E  + IFME+  GG++ N + + G L  +  + +S+QILEGV +LH   +IHRD+K  NI+L     VKL DF  +R       + G+K   L +  GTP ++APE++N+  +   +DIWS+G T F M TGKPP  H++  +A+ Y     G       D S D ++ ++A + +DQ +RP+A +LL H  I H
Sbjct:   23 KGEVLGKGAYGTVYCGLTSQG-QLIAVKQVALDASTSEIAE-KEYDRLEREVDLLKNLKHTNIVGFLGTALSENIVSIFMEYIPGGSISNILGQFGPLPEKVFVLYSQQILEGVAYLHANRVIHRDLKGNNIMLMPTGVVKLIDFGCARRLSCLQTSTGSKGDLLKSVHGTPYWMAPEVINETGHGRKSDIWSIGCTVFEMATGKPPLAHMNKMAALYYIGARRGLMPSLSDDFSTDAKDFVQACLTRDQRQRPSAEELLRHPFISH 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 22 [Source:ZFIN;Acc:ZDB-GENE-070928-11])

HSP 1 Score: 149.828 bits (377), Expect = 6.296e-38
Identity = 95/259 (36.68%), Postives = 146/259 (56.37%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP-KSECGNT-KEFKLLINEMR--NQINHSRIIKVYGSFTK--EKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            + + LG+GAFG VY C      ++ A K +P   EC  T KE   L  E++    ++H RI++ YG      +KKL IF+EF  GG++++++   G L+ +   R+++QIL+GV +LH   I+HRDIK  NIL D++ NVKL DF  S+          G KS+T   GTP +++PE++N   Y   ADIWSV  T   M+T KPP+   +  +AI ++I T   +      +S   R+ ++ +   ++  RPTA  LL
Sbjct:  362 QGKLLGRGAFGVVYLCYDVDTGRELAAKQVPFDPECQETSKEVNALECEIQLLKNLHHERIVQYYGCLRDPVQKKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVT---GTPYWMSPEVINGEGYGRKADIWSVACTVVEMLTQKPPWAEYEAMAAI-FKIATQPTKPNLPEGVSDACRDFLRQIF-VEEKWRPTAEGLL 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 149.443 bits (376), Expect = 7.293e-38
Identity = 95/264 (35.98%), Postives = 144/264 (54.55%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            + LGQGAFG+V+ C      ++ AVK +   P S    +KE   L  E++    + H RI++ YG    T EK L IFME+  GG++++++   G L+     ++++QILEGV +LH   I+HRDIK  NIL D+  NVKL DF  SR          G KS+T   GTP +++PE+++   Y   ADIWS+G T   M+T +PP+   +  +AI ++I T          +S   R+ +K +   +  +RP A  LL +   H
Sbjct:  358 KLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSP-ETSKEVSALECEIQLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVT---GTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAI-FKIATQPTNPTLPPHVSDHCRDFLKRIF-VETKQRPAAEDLLRHTFVH 615          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 149.058 bits (375), Expect = 9.737e-38
Identity = 95/264 (35.98%), Postives = 144/264 (54.55%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            + LGQGAFG+V+ C      ++ AVK +   P S    +KE   L  E++    + H RI++ YG    T EK L IFME+  GG++++++   G L+     ++++QILEGV +LH   I+HRDIK  NIL D+  NVKL DF  SR          G KS+T   GTP +++PE+++   Y   ADIWS+G T   M+T +PP+   +  +AI ++I T          +S   R+ +K +   +  +RP A  LL +   H
Sbjct:  366 KLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSP-ETSKEVSALECEIQLLKNLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVT---GTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAI-FKIATQPTNPTLPPHVSDHCRDFLKRIF-VETKQRPAAEDLLRHTFVH 623          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 147.902 bits (372), Expect = 2.015e-37
Identity = 90/260 (34.62%), Postives = 145/260 (55.77%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSFT--KEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--------TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            + + LGQGAFG+VY C      ++ A K +   P S    +KE   L  E++    ++H RI++ YG      EK L IFME+  GG++++++   G L+     ++++QILEG+ +LH   I+HRDIK  NIL D+  NVKL DF  S+        + G +S+T   GTP +++PE+++   Y   AD+WS+G T   M+T KPP+   +  +AI ++I T        + IS   R+ ++ +   +   RP+A +LL
Sbjct:  346 RGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASP-ETSKEVSALECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVT---GTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAI-FKIATQPTNPQLPSHISEHTRDFLRCIF-VEAKYRPSAEELL 599          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 152.14 bits (383), Expect = 1.593e-38
Identity = 90/258 (34.88%), Postives = 143/258 (55.43%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSFT--KEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            + + LGQGAFG+VY C      ++ A K +   P S    +KE   L  E++    ++H RI++ YGS     EK L IFME+  GG++++++   G L+     R+++QILEGV +LH   I+HRDIK  NIL D+  NVKL DF  S+           + +  GTP +++PE+++   Y   AD+WS+G T   M+T KPP+   +  +AI ++I T         + S   R+ +K ++  +  +RPTA +L+ 
Sbjct:  367 RGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSP-ETSKEVSALECEIQLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAI-FKIATQPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIR 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 151.754 bits (382), Expect = 1.710e-38
Identity = 90/258 (34.88%), Postives = 143/258 (55.43%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSFTK--EKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            + + LGQGAFG+VY C      ++ A K +   P S    +KE   L  E++    ++H RI++ YGS     EK L IFME+  GG++++++   G L+     R+++QILEGV +LH   I+HRDIK  NIL D+  NVKL DF  S+           + +  GTP +++PE+++   Y   AD+WS+G T   M+T KPP+   +  +AI ++I T         + S   R+ +K ++  +  +RPTA +L+ 
Sbjct:  349 RGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSP-ETSKEVSALECEIQLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAI-FKIATQPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIR 603          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 150.599 bits (379), Expect = 4.338e-38
Identity = 95/258 (36.82%), Postives = 146/258 (56.59%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            + LGQGAFG+VY C      ++ AVK +   P S    +KE   L  E++    + H RI++ YG    ++EK L IFME+  GG++++++   G L+     ++++QILEGV +LH   I+HRDIK  NIL D++ NVKL DF  S+          G KS+T   GTP +++PE+++   Y   ADIWSVG T   M+T KPP+   +  +AI ++I T        A +S   R+ +K +   +   RP++ +LL
Sbjct:  343 KLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDS-LETSKEVNALECEIQLLKNLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVT---GTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAI-FKIATQPTNPQLPAHVSEHCRDFLKRIF-VEAKVRPSSEELL 594          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 149.828 bits (377), Expect = 7.969e-38
Identity = 95/260 (36.54%), Postives = 147/260 (56.54%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHN 1734
            + LGQGAFG+VY C      ++ AVK +   P S    +KE   L  E++    + H RI++ YG    ++EK L IFME+  GG++++++   G L+     ++++QILEGV +LH   I+HRDIK  NIL D++ NVKL DF  S+          G KS+T   GTP +++PE+++   Y   ADIWSVG T   M+T KPP+   +  +AI ++I T        A +S   R+ +K +   +   RP++ +LL +
Sbjct:  371 KLLGQGAFGRVYLCYDADTGRELAVKQVQFDPDS-LETSKEVNALECEIQLLKNLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVT---GTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAI-FKIATQPTNPQLPAHVSEHCRDFLKRIF-VEAKVRPSSEELLRH 624          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 148.288 bits (373), Expect = 2.480e-37
Identity = 90/261 (34.48%), Postives = 147/261 (56.32%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQIN------HSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHN 1734
            + LG+GAFG+VY C      ++ AVK +P     +++E    +N +  +I       H RI++ YG      E+KL IF+E+  GG++++++   G L+     R+++QIL+GV +LH   I+HRDIK  NIL D+  NVKL DF  S+          G KS+T   GTP +++PE+++   Y   AD+WSV  T   M+T KPP++  +  +AI ++I T   +      +S   R+ +K +   ++ +RPTA +LL +
Sbjct:  358 KLLGRGAFGEVYLCYDVDKGRELAVKQVPFDP--DSQETSKEVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVT---GTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAI-FKIATQPTKPRLPDTVSDACRDFMKQIF-VEEKRRPTAEELLRH 611          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 156.762 bits (395), Expect = 7.275e-41
Identity = 90/263 (34.22%), Postives = 141/263 (53.61%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E LG+GA+G VY  ++  G +  AVK +      +    KE++ L  E  +   + H  I+   G+  +E  L IFMEF  GG++ + I++ G L      ++++QIL+GV +LH   ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P  A  S    + ++  + +DQ++RP+A QLL +   
Sbjct:  250 KGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFL 511          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 154.451 bits (389), Expect = 9.478e-39
Identity = 90/258 (34.88%), Postives = 140/258 (54.26%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K E LG+GA+G VY  ++  G +  AVK +      +    KE++ L  E  +   + H  I+   G+  +E  L IFMEF  GG++ + I++ G L      ++++QIL+GV +LH   ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P  A  S    + ++  + +DQ++RP+A QLL
Sbjct: 1250 KGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLL 1506          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 153.68 bits (387), Expect = 1.739e-38
Identity = 90/263 (34.22%), Postives = 141/263 (53.61%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E LG+GA+G VY  ++  G +  AVK +      +    KE++ L  E  +   + H  I+   G+  +E  L IFMEF  GG++ + I++ G L      ++++QIL+GV +LH   ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P  A  S    + ++  + +DQ++RP+A QLL +   
Sbjct: 1046 KGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFL 1307          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 153.295 bits (386), Expect = 1.968e-38
Identity = 90/263 (34.22%), Postives = 141/263 (53.61%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E LG+GA+G VY  ++  G +  AVK +      +    KE++ L  E  +   + H  I+   G+  +E  L IFMEF  GG++ + I++ G L      ++++QIL+GV +LH   ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P  A  S    + ++  + +DQ++RP+A QLL +   
Sbjct:  946 KGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFL 1207          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 147.517 bits (371), Expect = 3.278e-37
Identity = 95/265 (35.85%), Postives = 146/265 (55.09%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLL---INEMRNQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            + LGQGAFG+VY C      ++ AVK +   P+S    +KE   L   I  ++N + H RI++ YG     +EK L IFME+  GG++++++   G L+     ++++QILEGV +LH   I+HRDIK  NIL D+  N+KL DF  S+          G KS+T   GTP +++PE+++   Y   ADIWSV  T   M+T KPP+   +  +AI ++I T          +S   R+ +K +   +   RP+A +LL +   H
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESP-ETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVT---GTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAI-FKIATQPTNPKLPPHVSDYTRDFLKRIF-VEAKLRPSAEELLRHMFVH 617          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9FZ36|M3K2_ARATH (Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.165e-39
Identity = 93/260 (35.77%), Postives = 150/260 (57.69%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVK-LIPKSECGNTKEFKLLINEMRNQI------NHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIR-FSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K + +G+GAFG VY  ++    +  AVK ++  S C + ++ +  I E+  ++      +H  I++  G+  +++ L I +EF  GG++ + + K G    ESV+R ++ Q+L G+E+LH   I+HRDIK  NIL+DN   +KLADF  S+         GAKS+    GTP ++APE++    ++FSADIWSVG T   M+TGK P++      A ++ IGT     P   +IS D  + +   + ++ N RPTA++LL
Sbjct:   70 KGQLIGRGAFGTVYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFP-ESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGCIKLADFGASKQVAELATISGAKSM---KGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKEIAAIFHIGTTKSHPPIPDNISSDANDFLLKCLQQEPNLRPTASELL 325          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|F4HRJ4|M3K3A_ARATH (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.572e-38
Identity = 89/257 (34.63%), Postives = 150/257 (58.37%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPK-SECGNTKEFKLLINE---MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGA-KSLTTFAGTPNFIAPEIV-NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDAD-ISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K +FLG G FG+VY   + +  K  A+K +   S+   +KE    +N+   + NQ+ H  I++ YGS   E+ L +++E+ +GG++   +   G  +   +  +++QIL G+ +LH  + +HRDIK  NIL+D N  +KLADF  ++   A  ++ +F G+P ++APE+V +   YT + DIWS+G T   M T KPP++  +  +AI ++IG N  + PE  D +S D +  I+  + ++   RPTA+QLL +   
Sbjct:  216 KGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAI-FKIG-NSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFL 470          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P25323|MYLKA_DICDI (Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 3.451e-38
Identity = 87/251 (34.66%), Postives = 140/251 (55.78%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLIN-EMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDN---VKLADFDWSRTKGAK-SLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPED--ADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            E LG+GAF  VY   +++  ++YA+K+I KSE G   E  L +  ++  ++NH  II +   F   +KL + ME   GG L +KI ++G  S        K+I+  V +LH ++I+HRD+KP N+LL + +N   V +ADF  S+  G    + T  GTP+++APE++N   Y    D+WS+G   + ++ G PP+    +P  I  QI    +E PE+    IS + ++ I  ++  D +KR  AT  L+
Sbjct:   12 EELGRGAFSIVYLGENKQTKQRYAIKVINKSELGKDYEKNLKMEVDILKKVNHPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEADAANLVKKIVSAVGYLHGLNIVHRDLKPENLLLKSKENHLEVAIADFGLSKIIGQTLVMQTACGTPSYVAPEVLNATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPE-IFEQIMEANYEFPEEYWGGISKEAKDFIGKLLVVDVSKRLNATNALN 261          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O22042|M3K3_ARATH (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 4.219e-38
Identity = 90/261 (34.48%), Postives = 145/261 (55.56%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSEC-----GNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR-------TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            K E +G GAFG+VY  ++    +  A+K +   P S       G+ +E +  +  ++N ++H  I++  G+  +   L I MEF  GG++ + + K G      +I ++KQ+L G+E+LH   I+HRDIK  NIL+DN   ++LADF  S+         GAKS+    GTP ++APE++    ++FSADIWSVG T   M TGKPP++      A +  IG      P   D+S + ++ +   ++K+ + R +AT+LL 
Sbjct:   70 KGELIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLLKN-LSHPNIVRYLGTVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDIKGANILVDNKGCIRLADFGASKKVVELATVNGAKSM---KGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMATGKPPWSEQYQQFAAVLHIGRTKAHPPIPEDLSPEAKDFLMKCLHKEPSLRLSATELLQ 326          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|E9Q3S4|M3K19_MOUSE (Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus OX=10090 GN=Map3k19 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.216e-37
Identity = 90/263 (34.22%), Postives = 141/263 (53.61%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP---KSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFD------WSRTKGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            K E LG+GA+G VY  ++  G +  AVK +      +    KE++ L  E  +   + H  I+   G+  +E  L IFMEF  GG++ + I++ G L      ++++QIL+GV +LH   ++HRDIK  N++L     +KL DF       W+   G  S  L +  GTP ++APE++N+  Y   +DIWS+G T F M TGKPP   +D  +A+ Y     G   P  A  S    + ++  + +DQ++RP+A QLL +   
Sbjct: 1046 KGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFL 1307          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 8.750e-59
Identity = 144/414 (34.78%), Postives = 220/414 (53.14%), Query Frame = 1
Query:  526 PIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGAKSLTTFA----------GTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNG---FEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            PI  AC++GH +++K  +   C++++ D + R A HY  +    DI+ LLIE    +   D     PIH AC   +I   + L    CD+        +P+   +    + +IK+    I    I+ E+A  M ++C   C+HKFC  S + K I   + +  G++G V+       D+K+AVK IPK      +  +  IN+ +N + H RI+K +G+F K++   IFME+    TLQ K  K  K S   ++ F+KQILE +  LH+  IIHRDIKP N+LLD + N+KL+DF  S       L++ A          GT  + APEI+N   YT S DIWS+GAT   + TG+PPY+++    AI+  I T     +++PE   +   +  +I  M+ KDQ KR +A +LL
Sbjct:  542 PILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKL----IKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNI-RARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYL--DTLQKK--KYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLL-----LSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLG-DGAIITVISTTREIEYKLPE--YMPKYISNLIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0R3RIB6 (Protein kinase domain-containing protein OS=Elaeophora elaphi OX=1147741 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.643e-46
Identity = 102/259 (39.38%), Postives = 158/259 (61.00%), Query Frame = 1
Query: 1006 LGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQIN------HSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR---TKGAKSLTTFAGTPNFIAPEIV-NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTN--GFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            +G GAFGKVY C+     K+ A+K    + C   K     I ++ N+IN      H+RI++  G+   E  +CIF+E+  GG++++ I+  G LS     +++ Q+L+G+E+LH+ +IIHRDIKP NIL D+N NVK+ DF  ++   T  ++   TF GTPN++APE+V     +   ADIWSVG T   M+T KPP++ ++ P AI++ I  +   +E+P  AD   DL   I  +  ++ +KRP+A+QLL+N  FH
Sbjct:  225 IGSGAFGKVYVCVDVDTGKEVALKRF--NICRADKHLTNHIIQLGNEINLLSTIQHARIVQYLGAQQIEDSICIFIEYMTGGSVKDYIATYGPLSSTVAGKYTYQVLQGLEYLHRNEIIHRDIKPANILRDSNGNVKIGDFGSAKRLQTICSQQAATFIGTPNYMAPEVVLGHTTHGRKADIWSVGCTLVEMLTTKPPWDDLE-PMAIIFNIAKHNPSYELPLGADP--DLAHFINVVFERNVDKRPSASQLLNNFAFH 478          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A044RDS9 (Protein kinase domain-containing protein OS=Onchocerca volvulus OX=6282 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 9.797e-46
Identity = 101/255 (39.61%), Postives = 157/255 (61.57%), Query Frame = 1
Query: 1006 LGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQIN------HSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGA---KSLTTFAGTPNFIAPEIV-NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNG--FEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHN 1734
            +G G FGKVY C+     K+ A+K    + C + K  K  I ++ N+IN      H RI++  G+      +CIF+E+  GG++++ I+  G LS     +++ Q+L+G+E+LH+ +IIHRDIKP NIL D+N NVK+ DF  ++   A   +  +TF GTPN++APE+V     +   ADIWSVG T   M+T KPP+N+++ P AI++ I  +   +E+P DAD    L ++I     +D +KRP+A+QLL+N
Sbjct:  226 IGSGTFGKVYVCVDVDTGKEVALKRF--NICRSDKHLKNHIIQLENEINLLSTIQHDRIVQYLGAQQINDSICIFIEYMTGGSVKDYIATYGSLSCAVAGKYTYQVLQGLEYLHRNEIIHRDIKPANILRDSNGNVKIGDFGSAKRLQAICSQQTSTFIGTPNYMAPEVVLGHTRHGRKADIWSVGCTLVEMLTMKPPWNNLE-PMAIIFNIAQHNPTYELPLDADPI--LAQLINWTFERDVDKRPSASQLLNN 475          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A182GGY8 (ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.012e-45
Identity = 90/231 (38.96%), Postives = 139/231 (60.17%), Query Frame = 1
Query:  217 KNQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEE 909
            K    +H+ACQ GH E+V++LI    +IEAL++ +W PLH AC      +V+ L+++   I+  N DNWTPLH +  +G  EVV+ LI  K ++EAL  DNW P+H AC+ GH EV+++L+    +IEA ++   T  H     G+  ++++LI    N+EA    NW P+H AC NGH  +VE L R   +++A T DN TP+       + +++++L KE A+ D + E
Sbjct: 1398 KKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAE 1628          

HSP 2 Score: 167.548 bits (423), Expect = 1.056e-39
Identity = 83/230 (36.09%), Postives = 140/230 (60.87%), Query Frame = 1
Query:  220 NQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEE 909
            N   +H+ACQ GH E+V++LI +  +IEAL++ ++ PLH A       +V+ L+++   I+    +NWTPLH A   G  EVV+ LI  K+++EALT DNW P+H AC+ GH EV+++L+    +I+A  + + T  H  C  G+ +++++LI    N++A       P+H AC NGH  +VE L  +  +++A   DN TP+    +K +++++K+L  E A+ D + +
Sbjct: 1498 NWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQ 1727          

HSP 3 Score: 165.622 bits (418), Expect = 5.063e-39
Identity = 82/240 (34.17%), Postives = 140/240 (58.33%), Query Frame = 1
Query:  220 NQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFD-IVEEMAQAMDIQC 936
            N   +H AC  GH E+V++LI +  +IEAL++ +W PLH +CR     +V+ L+++   I+  N DNWTPLH A   G  EVV+ LI  ++++EAL   N+ P+H A   GH +V+++L+    +IEA  ++  T  H  C  G+ +++++LI    N+EA    NW P+H AC NGH  +VE L ++  ++ A      TP+       +++++++L  E A+ D + E+ +  + + C
Sbjct: 1432 NWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLAC 1671          

HSP 4 Score: 165.236 bits (417), Expect = 5.970e-39
Identity = 82/222 (36.94%), Postives = 134/222 (60.36%), Query Frame = 1
Query:  232 IHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFD 897
            +H ACQ GH E+V++L+ +  +I+AL EK + PLH AC+     +V+ L+ +   ID       TPLH A   G  EVV+ LI  K+++EAL   NW P+H AC  GH EV+++L+    +IEA ++D  T  H  C  G+ +++++LI    N+EA +  NW P+H AC +GH  +VE L R+  +++A    N+TP+       ++K++++L +E A+ +
Sbjct: 1337 LHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIE 1558          

HSP 5 Score: 163.696 bits (413), Expect = 2.190e-38
Identity = 78/230 (33.91%), Postives = 141/230 (61.30%), Query Frame = 1
Query:  220 NQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEE 909
            N   +H++C+ GH E+V++LI +  +IEAL++ +W PLH AC++    +V+ L+++   I+  N  N+TPLH A+  G  +VV+ LI  K+++EAL  +NW P+H ACR GH EV+++L+    +IEA  +D  T  H  C  G+ +++++L++   N++A     + P+H AC NGH  +VE L  +  ++ A T    TP+       +++++++L  E A+ + + +
Sbjct: 1465 NWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQ 1694          

HSP 6 Score: 161.384 bits (407), Expect = 1.267e-37
Identity = 79/221 (35.75%), Postives = 134/221 (60.63%), Query Frame = 1
Query:  220 NQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKE 882
            N   +H+ACQ GH E+V++LI +N +I+AL E  + PLH AC       V  L+ +   ID  + + +TPLH A   G +EVV+ L+  K++++AL    + P+H AC+ GH EV+++L+    +I+A  + + T  H  C  G+ +++++LI    N+EA +  NW P+H ACHNGH  +VE L R+  +++A   DN TP+       +++++++L +E
Sbjct: 1267 NWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIRE 1487          

HSP 7 Score: 160.614 bits (405), Expect = 2.113e-37
Identity = 79/226 (34.96%), Postives = 138/226 (61.06%), Query Frame = 1
Query:  232 IHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEE 909
            +H+AC +GH E V++LI +  +I+ALDE  + PLH AC+     +V+ L+K+   ID      +TPLH A   G  EVV+ LI  K++++ALT     P+H AC+ GH EV+++L+    +IEA ++   T  H+ C  G+ +++++LI    N+EA +  NW P+H +C +GH  +VE L R+  +++A   DN TP+       +++++++L +E A+ + + +
Sbjct: 1304 LHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQ 1529          

HSP 8 Score: 154.836 bits (390), Expect = 1.790e-35
Identity = 72/203 (35.47%), Postives = 122/203 (60.10%), Query Frame = 1
Query:  220 NQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPI 828
            N   +HIA   GH ++V++LI +  +IEAL +++W PLH ACR     +V+ L++    I+    DNWTPLH A   G +EVV+ L+  K++++AL    + P+H AC+ GH EV+++L+    +I+A  + + T  H  C  G+ +++++L+    N+EA +  NW P+H AC  GH  +V+ L  +  ++ A T   +TP+
Sbjct: 1531 NYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPL 1733          

HSP 9 Score: 150.599 bits (379), Expect = 3.462e-34
Identity = 74/217 (34.10%), Postives = 128/217 (58.99%), Query Frame = 1
Query:  232 IHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKE 882
            +H ACQ G  E+V++LI +  +IEAL++ +W PLH AC+     +V+ L+K+N  ID      +TPLH A   G  E V+ LI  K++++AL  + + P+H AC+ GH EV+++L+    +I+A  + + T  H  C  G+ +++++LI    N++A       P+H AC NGH  +VE L R   +++A    N TP+       +++++++L +E
Sbjct: 1238 LHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIRE 1454          

HSP 10 Score: 150.599 bits (379), Expect = 4.188e-34
Identity = 80/226 (35.40%), Postives = 129/226 (57.08%), Query Frame = 1
Query:  217 KNQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHF 894
            +N   +H+AC+ GH E+V++LI    +IEAL + +W PLH AC+     +V+ L+K+   ID      +TPLH A   G  EVV+ LI  K++++ALT     P+H AC+ GH EV+++L+    +IEA ++D  T  H  C KG+ +++ +LI    N++A       P+H AC  GH  +VE   RK  ++ A   +  TP++      + ++ K++ KE A F
Sbjct: 1563 ENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIM-KEKAKF 1787          

HSP 11 Score: 149.443 bits (376), Expect = 8.811e-34
Identity = 77/237 (32.49%), Postives = 133/237 (56.12%), Query Frame = 1
Query:  229 AIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFD-IVEEMAQAMDIQC 936
            A+HI+   GH  IV+LL++   ++ A D  ++ PLH AC      +V+ L+     ID    +  TPLH+A   G  EVV+ LI  K+++EAL   NW P+H AC+ GH EV+++L+  N +I+A  + + T  H  C +G+ + + +LI    N++A D   + P+H AC NGH  +VE L ++  ++ A      TP+       +++++++L  E A+ D + E+ +  + + C
Sbjct: 1171 ALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLAC 1407          

HSP 12 Score: 139.043 bits (349), Expect = 2.538e-30
Identity = 70/227 (30.84%), Postives = 130/227 (57.27%), Query Frame = 1
Query:  232 IHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEM 912
            +H AC  G  E+V++LI    +I+AL +    PLH AC+     +V+ L+++   I+  N  NWTPLH A   G  EVV+ LI   ++++ALT   + P+H AC  GH E +++L+    +I+A D+++ T  H  C  G+ +++++L++   N++A     + P+H AC NGH  +VE L  +  ++ A T    TP+       +++++++L +  A+ + + ++
Sbjct: 1205 LHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQV 1431          

HSP 13 Score: 123.635 bits (309), Expect = 2.204e-25
Identity = 68/226 (30.09%), Postives = 120/226 (53.10%), Query Frame = 1
Query:  232 IHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEE 909
            +HIA   G  E VK LIN   ++ A     +  LH +       IV+ LL     ++  + + +TPLH+A   G  EVV+ LI  K++++AL  +   P+H AC+ G  EV+++L+    +IEA ++   T  H  C  G+ +++++LI+ N N++A     + P+H AC  GH   V+ L  +  ++ A   +  TP+       + +++++L KE A+ D + E
Sbjct: 1139 MHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAE 1364          

HSP 14 Score: 115.161 bits (287), Expect = 1.062e-22
Identity = 69/269 (25.65%), Postives = 132/269 (49.07%), Query Frame = 1
Query:  226 NAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEE-------------MAQAMDI------QCDAYCDHKFCPYSL 975
            +A   A Q GH  +  +L  K  +     + D   +H A  +  +  V  L+     ++  ++  +T LH +A  G   +V+ L++  +++ A   + + P+H AC  G  EV+++L+    +I+A  K++ T  H+ C  G  +++++LI    N+EA +  NW P+H AC NGH  +VE L ++  ++ A T   +TP+     + +++ +++L  E A+ D ++E              A+ ++I        DA  + KF P  L
Sbjct: 1104 SAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHL 1372          

HSP 15 Score: 99.7525 bits (247), Expect = 7.552e-18
Identity = 74/291 (25.43%), Postives = 129/291 (44.33%), Query Frame = 1
Query:  208 RKLKNQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDP----------------------------------KNIDNWTPL-HYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSL 975
            R  +  +A+H A       I K LI+K  ++     +   PL+ A       +V  L+++  E  P                                  K+ID   PL H AAG G  E VK+LIN  +++ A +   +  +H +   GH  ++++LLDN  ++ A D ++ T  H+ C+ G  +++++LI    N++A       P+H AC NG   +VE L R+  +++A    N TP+       +++++++L KE A+               DA  +HK+ P  L
Sbjct: 1032 RNTEGWSALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDG--PLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANI--------------DALTEHKYTPLHL 1306          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I7VS83 (STE/STE11/MEKK2 protein kinase OS=Loa loa OX=7209 GN=LOAG_05805 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.765e-45
Identity = 99/259 (38.22%), Postives = 158/259 (61.00%), Query Frame = 1
Query: 1006 LGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQIN------HSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR---TKGAKSLTTFAGTPNFIAPEIV-NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIG--TNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            +G GAFGKVY C+     K+ A+K    + C   K  K  I ++ N+IN      H RI++  G+   +  +CIF+E+  GG++++ I+  G LS     +++ Q+L+G+E+LH+ +IIHRDIKP NIL D+N NVK+ DF  ++   T  ++  +TF GTPN++APE+V     +   ADIWSVG T   M+T KPP++ ++ P AI++ I      +E+P +AD +  L  ++  +  ++  KRP+A+QLL+N  F 
Sbjct:  226 IGSGAFGKVYVCVDVDTGKEVALKRF--NICRGDKHLKNHIIQLGNEINLLSTIQHGRIVQYLGAQQIDDSICIFIEYMTGGSVKDCIATYGPLSSAVAGKYTYQVLQGLEYLHRNEIIHRDIKPANILRDSNGNVKIGDFGSAKRLQTICSQQASTFIGTPNYMAPEVVLGRTKHGRKADIWSVGCTLVEMLTTKPPWDDLE-PMAIIFNIAHHNPSYELPLEADPA--LAYLVSTIFERNVEKRPSASQLLNNIAFQ 479          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 151.369 bits (381), Expect = 1.326e-38
Identity = 91/256 (35.55%), Postives = 145/256 (56.64%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP-KSECGNT-KEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            + + LG+GAFG+VY C      ++ AVK +P   EC  T KE   L  E++    + H RI++ YG     +++KL IF+EF  GG++++++   G L+ +   R+++QIL+GV +LH   I+HRDIK  NIL D++ NVKL DF  S+           + T  GTP +++PE++N   Y   AD+WSV  T   M+T KPP+   +  +AI ++I T   +      +S   R+ ++ +   ++  RPTA  LL
Sbjct:  359 QGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVNALECEIQLLKNLRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAI-FKIATQPTKPNLPEGVSDACRDFLRQVF-VEEKWRPTAEGLL 612          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 151.369 bits (381), Expect = 1.327e-38
Identity = 91/256 (35.55%), Postives = 145/256 (56.64%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP-KSECGNT-KEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            + + LG+GAFG+VY C      ++ AVK +P   EC  T KE   L  E++    + H RI++ YG     +++KL IF+EF  GG++++++   G L+ +   R+++QIL+GV +LH   I+HRDIK  NIL D++ NVKL DF  S+           + T  GTP +++PE++N   Y   AD+WSV  T   M+T KPP+   +  +AI ++I T   +      +S   R+ ++ +   ++  RPTA  LL
Sbjct:  356 QGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVNALECEIQLLKNLRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAI-FKIATQPTKPNLPEGVSDACRDFLRQVF-VEEKWRPTAEGLL 609          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 143.665 bits (361), Expect = 2.423e-38
Identity = 83/259 (32.05%), Postives = 138/259 (53.28%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNT--KEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT------KGAKS--LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHN 1734
            K E LG+GA+G VY  ++ +G      +++       T  KE+  L  E  +   + H  I+   G+   +  + IFME+  GG++ + +++ G L  +    +++Q+LEGV +LH+  +IHRD+K  N++L     VKL DF  +R        G  S  L +  GTP ++APE++N+  +   +D+WS+G T F M TGKPP  H+   +A+ Y     G   P   D S + +  +KA +  +Q +RP+A  LL +
Sbjct:   18 KGEVLGRGAYGTVYCGLTSQGQLIAVKQVLLDVSTSETAEKEYSRLEREVDLLKNLEHPNIVGFLGTALTDNVISIFMEYVPGGSISSVLNRFGPLPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGVVKLIDFGCARRLNRLTHSGGNSDLLKSVHGTPYWMAPEVINETGHGKKSDVWSIGCTVFEMATGKPPLAHMGKMAALFYIGARKGLMPPLPDDFSEEAKSFVKACL-INQKQRPSAADLLRH 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 150.214 bits (378), Expect = 3.987e-38
Identity = 96/264 (36.36%), Postives = 146/264 (55.30%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            + LGQGAFG+V+ C      ++ AVK +   P S    +KE   L  E++    + H RI++ YG    T E+ L IFME+  GG++++++   G L+     ++++QILEGV +LH   I+HRDIK  NIL D+  NVKL DF  SR          G KS+T   GTP +++PE+++   Y   ADIWSVG T   M+T +PP+   +  +AI ++I T        A +S   R+ +K +   +  +RP A +LL +   H
Sbjct:  363 KLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSP-ETSKEVSALECEIQLLKNLFHERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVT---GTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAI-FKIATQPTNPALPAHVSDHCRDFLKRIF-VETKQRPAAEELLRHIFVH 620          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 146.362 bits (368), Expect = 8.053e-37
Identity = 90/262 (34.35%), Postives = 147/262 (56.11%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSFT--KEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--------TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHN 1734
            + + LGQGAFG+VY C      ++ A K +   P S    +KE   L  E++    ++H RI++ YG      EK L IFME+  GG++++++   G L+     ++++QILEG+ +LH   I+HRDIK  NIL D+  NVKL DF  S+        + G +S+T   GTP +++PE+++   Y   AD+WS+G T   M+T KPP+   +  +AI ++I T        +  S   R+ I+ +  + ++ RP+A +LL +
Sbjct:  358 RGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASP-ETSKEVSTLECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVT---GTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAI-FKIATQPTNPILPSHTSEQTRDFIRRIFVEAKH-RPSAEELLRH 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 152.525 bits (384), Expect = 1.121e-39
Identity = 91/266 (34.21%), Postives = 143/266 (53.76%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNK---DQNKRPTATQLLHNQIFH 1746
            + + LGQGAFG+VY C      ++ AVK +   P S    +KE   L  E++    + H RI++ +G     ++K L IFME+  GG++++++   G L+     ++++QILEGV  LH   I+HRDIK  NIL D+  NVKL DF  S+          ++ +  GTP +++PE++N   Y   ADIWSVG T   M+T KPP+   +  +AI ++I T     P D  +     E  + ++ +   +   RP+A  LL +   H
Sbjct:  361 RGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGS-VETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAI-FKIATQ----PTDPRLPLHASEHARDLLRRIFVEAKLRPSAEDLLRHPFVH 620          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 1.176e-33
Identity = 79/257 (30.74%), Postives = 140/257 (54.47%), Query Frame = 1
Query:  988 IDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKI-SKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDN--NDNVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTN-GFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL-HNQI 1740
            I + + LG G FG+V+KC+ R      A K+I         E    I+ M NQ+ H+ ++++Y ++  +    + ME+  GG L ++I S++  L+    I F +QI EG+ ++HQ  I+H D+KP NIL  N   + +K+ DF  +R  K  + L    GTP F+APE+VN  + +F  D+WS+G   + +++G  P+   D    +   +  N  F+     ++S + ++ I  ++ K+++ R +A+Q L HN +
Sbjct:   33 IKQKDVLGGGRFGRVHKCVERTSGMTLAAKVIKAKGVKEKDEVNNEISIM-NQLKHNNLLQLYDAYESKNDFVLIMEYIHGGELFDRIVSEDYNLTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVNRKGNQIKIIDFGLARRYKPREKLKVHFGTPEFLAPEVVNYDYVSFPTDMWSLGVIAYMLLSGLSPFMGEDDNETLTNIVNVNWDFDDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLKHNWL 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 130.954 bits (328), Expect = 3.460e-33
Identity = 85/255 (33.33%), Postives = 134/255 (52.55%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIK--PGNILLDNNDNVKLADFDWSR--TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            K E +G+G+FG+V+K I  +  +  A+K+I   E  +  E       + +Q +   +   +GS+ K  KL I ME+  GG+  + I K G L    +    ++IL+G+++LH    IHRDIK    N+LL    +VKLADF  +   T       TF GTP ++APE++    Y F ADIWS+G T   +  G+PP + +  P  +++ I  N     E  + S   +E + + +NKD   RPTA +LL ++   
Sbjct:   28 KQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLI-KPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELH-PMRVLFLIPKNNPPTLE-GNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQ 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 124.405 bits (311), Expect = 7.829e-32
Identity = 80/256 (31.25%), Postives = 135/256 (52.73%), Query Frame = 1
Query:  988 IDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDN--NDNVKLADFDWSRT-KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPED--ADISFDLREMIKAMMNKDQNK-RPTATQLLHNQ 1737
            +  S+ LG G FG+V +C  +      A K+I        +E K  IN M NQ+NH  +++++ ++     + + ME+  GG L N+I  +  LS    + F +QI EGV ++HQ  I+H D+KP NIL  +     +K+ DF  +R  K  + L    GT  F+APE+VN    +F  D+WSVG   + +++G  P+   D  S  +  I T+ +E   +  +++S D ++ I  ++ K + + R +A   L +Q
Sbjct:   27 LSHSDVLGGGRFGRVMRCQEKSSGLTLAAKVIRVKSPKEKEEVKNEINIM-NQLNHVNLVQLFDAYESRSDITLIMEYVEGGELFNRIIDQSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSRWGYQIKIIDFGLARRYKPREKLKVSFGTSEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLG-DDESETLNNIVTSNWEFDGEVFSEVSEDAKDFITNLLVKGKKRWRLSAKGALQHQ 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 128.257 bits (321), Expect = 3.791e-31
Identity = 83/254 (32.68%), Postives = 133/254 (52.36%), Query Frame = 1
Query:  997 SEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--TKGAKSLTTFAGTPNFIAPEIV---NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDAD---ISFDLREMIKAMMNKDQNKRPTATQLL 1728
            +E LG G +G V+K  + +  +  A+K+I K E G+  +F ++  E  M  +  H+ I+  YGS+ +  KL I ME   GG+LQ+     G L+   +   +++ L+G+ +LH    +HRDIK  NILL ++ +VKLADF  S   T       +F GTP ++APE+        Y    D+W+VG T   +   +PP   +  P   ++ +  +GF+ P+  D    S      IK  + K+  KRPTA ++L
Sbjct:   17 AERLGSGTYGDVHKARNVQTGELVAIKII-KLEPGD--DFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIYHVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNHQCDVWAVGITAIELAELQPPMFDLH-PMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKML 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 140.584 bits (353), Expect = 2.305e-35
Identity = 86/244 (35.25%), Postives = 139/244 (56.97%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGK-LSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            + +G+G++G VYK I++  D+  A+K +         +    I+ ++N +NH+ I+K +G   K  +L I +E+ A G+L+  IS+    LS      +  Q L G+++LH   +IHRDIK  NILL  ++ VKLADF  S    + +L T AGT N++APEI+ +   +  +DIWS+GAT   M+T  PPY+++   + I Y +  + +  P  +  S  L++ +     K+  KRPTA QLL
Sbjct:   29 QVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKN-LNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-TLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLT-DANIYYAVENDTYYPP--SSFSEPLKDFLSKCFVKNMYKRPTADQLL 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 136.346 bits (342), Expect = 5.351e-34
Identity = 85/267 (31.84%), Postives = 143/267 (53.56%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLIPKSEC-----GNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDN--VKLADFDWSRTKGAKS-LTTFAGTPNFIAPEIVNDI-------------HYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGF-EVP-EDADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            E +GQGAF  V K I R   K +AVK+I K +      G T+E ++L      ++NH RI+++ G +   +   + MEF +GG L + ++  G +  ++    S+QIL  ++++H M I HRD+KP NIL++ +D   VK+ DF  ++ +G  S + TF GT  ++APE++                 Y+   D+WS+G   + ++TG  P++       +  QIG   + E P +D  IS + R+ I +++  D N R TA + L+
Sbjct:  202 EVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVL-----QKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSG-STQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALN 462          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 133.65 bits (335), Expect = 2.761e-33
Identity = 76/257 (29.57%), Postives = 138/257 (53.70%), Query Frame = 1
Query:  976 RLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGAKSLT--TFAGTPNFIAPEIVNDIH--YTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            R K   +  FLG+G F + ++     G+  +A K + K+   + K  K L++E++    ++H  I++    F  +  + I +E    G+L   + +   L+   V  F+ QI   ++++H   +IHRD+K GNI  D+N N+K+ DF  +     +S    T  GTPN+IAPE++   H  ++F  DIWS+G   + ++ GKPP+   D+ + I  +I    F  P D  IS + + +I+ +++ D  +RP+ T+++
Sbjct:   78 RGKDYHRGHFLGEGGFARCFQIKDDSGEI-FAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDV-NTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIM 332          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 134.035 bits (336), Expect = 3.691e-33
Identity = 88/292 (30.14%), Postives = 153/292 (52.40%), Query Frame = 1
Query:  940 AYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKS--ECGNTK-----------------EFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWS--RTKGAKSLTTFAGTPNFIAPEIVNDIHYT-FSADIWSVGATNFNMITGKPPYNHIDIP-SAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            A  D+   P+ L        E LG G+ GKV    +    ++ AVK+I K+    GN                   E +++I ++   +NH  ++++Y  +     L + +E+A  G L N + + G L     IRF +QI+ GV + H + I+HRD+KP N+LLD+  N+K+ADF  +   T+G K L T  G+P++ APEIV+ I Y  F++D+WS G   F ++TG+ P++  D     ++ ++    FE+P D +IS + +++I+ ++  D  +R     +L + +  
Sbjct:   10 AIKDNTIGPWKL-------GETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKL---LNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEG-KLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 132.494 bits (332), Expect = 1.356e-32
Identity = 87/271 (32.10%), Postives = 140/271 (51.66%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKE-FKLLINEMR--NQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIR-FSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT------------------KGAKSLTTFAGTPNFIAPEIVND--IHYTFSA-DIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGF-EVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K  F+G G FG+VY  I+ +  +  AVK I   +    K+ F L+  EM     +NH  I++ YG      K+ IFME+  GG+L + +   G++  E V + ++ ++LEG+ +LHQ  ++HRDIKP NILLD N  +K  DF  +RT                     KSL    GTP ++APE ++   +     A D+W++G     M TG+ P++++D   AIMY +      ++P   +++   R  ++  + +D   R TA +LL
Sbjct: 1036 KRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLD-HGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 164.081 bits (414), Expect = 2.802e-46
Identity = 96/253 (37.94%), Postives = 142/253 (56.13%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTK--EFKLLINEMR--NQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWS-RTKGAKSLTTFA---GTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLL 1728
            K + LG GAFG+VY C      ++ AVK I   +  ++   E K L  E+       + RI++ YG  T +  + IFME+  GG++   I + G L+     ++S+QILEG+ +LH   I+HRDIK  NIL D   NVKLADF  S R +  +S T F    GTP ++APE++N   Y   AD+WSVG T   M+T KPP+   + P A +++I T   E    +D+S D  E +++ +  +   RP+A +LL
Sbjct:    6 KGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFE-PMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELL 257          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 142.51 bits (358), Expect = 2.047e-38
Identity = 86/266 (32.33%), Postives = 143/266 (53.76%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGD--KKYAVKLIPKSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKK--LCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--------TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPE-DADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            K   LG+GAFG V+  +   G+      V+L P +     ++++ L  E  +   + H  I++  G+   + +  + IFMEF  GG++   + + G        R+++QIL+GV +LH  ++IHRDIK GNI+L  N  +KL DF  ++           +  L +  GTP ++APE++ +  +   +DIWS+G T F M TG+PP++++   SAI + IG NG  VP  D   S    + + + M +DQ+ RP+A +LL +    
Sbjct:    7 KGNVLGKGAFGTVFLGLVNTGELIAVKQVELHPNNVDAAERQYEKLQEEVGLLKSLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAI-FAIG-NGSPVPRLDESFSAAAIDFVTSCMTRDQDTRPSADELLRHDFLQ 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 135.191 bits (339), Expect = 3.088e-35
Identity = 86/258 (33.33%), Postives = 134/258 (51.94%), Query Frame = 1
Query:  991 DKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGK-LSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWS--RTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPED-ADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            D  E LG+G++G V+K + ++  +  A+K +P        + + +I E  M  Q +   ++K YGS+ K   L I ME+   G++ + +    K L+ E +    K  L+G+E+LH    IHRDIK GNILL++  + KLADF  +   T       T  GTP ++APE++ ++ Y   ADIWS+G T   M  GKPPY  I  P   ++ I T       D    S D ++ +   + K+  +R TAT+LL +    
Sbjct:   25 DVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVD-----TDLQEIIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIH-PMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQ 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: OBSCURIN (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL2])

HSP 1 Score: 134.42 bits (337), Expect = 3.944e-35
Identity = 76/235 (32.34%), Postives = 134/235 (57.02%), Query Frame = 1
Query: 1006 LGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSFT--KEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDN--VKLADFDWSRTKGAK-SLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPY-NHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMM 1686
            LG+G FG V KC+++K  K++A K I   +C   ++ + +I+EM   N I H R++++  +F    ++++ + ME   GG L  K+ +E  +S   V  + KQILEG+EH+H+ +++H D+KP NI++   D+  +KL DF  +R    K +L    GTP F+APE++     T + D+WS+G   + +++G  P+    D  +    Q     F+ P   DIS + ++ I+ ++
Sbjct:   27 LGKGRFGVVCKCVNKKTGKQFAAKFI---KCSKPQDREDVIHEMEIMNTIRHKRLLRLADAFETPSQQEMILVMELVTGGELFEKVVEEEFISENDVTHYMKQILEGLEHMHKQEVLHLDLKPENIMIVKQDSRQIKLIDFGLARKYNPKENLKVMFGTPEFVAPEVLTYDRITPATDMWSIGVIAYVLLSGLSPFMGDNDAETLANVQTAEWDFDDPVFDDISDEAKDFIEKLL 258          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL3])

HSP 1 Score: 135.961 bits (341), Expect = 5.963e-34
Identity = 72/255 (28.24%), Postives = 133/255 (52.16%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECG-NTKEFKLLINE--MRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWS-RTKGAK-SLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            +   LG+G F +VY+      +K YA+K++PK     +TKE++ +  E  +   + H  ++  +GSF  E    I +E  +  +L   +   GKL+   V  F +Q +E   +LH+  +IHRDIK GN  +++N  ++L DF  + R K  +  + T  GTPN+IAPE+++   +++  D W++G   + M+ G PP+    +      +I  N + +P  + +S     +I+ M++ +   RP  + +  +  F
Sbjct:   19 RGRLLGKGGFARVYEVTDMSTNKIYALKVVPKKRLSKSTKEYRKIEMEIELHRTLRHHYVVGFHGSFQDEMNFYILLELCSRKSLVQMLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRDIKVGNFFINSNMELRLGDFGLAVRLKPDEYKIRTMCGTPNYIAPEVLSKEGHSYEVDTWALGCVMYTMLVGHPPFETKSLRETYR-RIRNNDYTIP--SRVSDSAARLIQRMLHANPENRPKLSDIFSDDFF 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 152.525 bits (384), Expect = 8.473e-39
Identity = 97/264 (36.74%), Postives = 146/264 (55.30%), Query Frame = 1
Query: 1000 EFLGQGAFGKVYKCISRKGDKKYAVKLI---PKSECGNTKEFKLLINEMR--NQINHSRIIKVYGSF--TKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            + LGQGAFG+VY C      ++ AVK +   P+S    +KE   L  E++    + H RI++ YG    T E+ L IFME   GG++++++   G L+     R+++QILEGV +LH   I+HRDIK  NIL D+  NVKL DF  SR          G KS+T   GTP +++PE+++   Y   ADIWSVG T   M+T +PP+   +  +AI ++I T          +S   RE ++ +   +  +RP+A +LL +   H
Sbjct:  393 KLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESP-ETSKEVSALECEIQLLKNLCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVT---GTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAI-FKIATQPTNPELPVHVSDHCREFLRRIF-VETKQRPSADELLRHIFVH 650          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 148.288 bits (373), Expect = 1.389e-37
Identity = 92/260 (35.38%), Postives = 147/260 (56.54%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP-KSECGNT-KEFKLLINEMR--NQINHSRIIKVYGSFTK--EKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            + + LG+GAFG+VY C      ++ A K +P   +C  T KE   L  E++    + H RI++ YG      ++KL IF+EF  GG++++++   G L+ +   R+++QIL+GV +LH   I+HRDIK  NIL D++ NVKL DF  S+          G KS+T   GTP +++PE++N   Y   AD+WSV  T   M+T KPP+   +  +AI ++I T   +      +S   R+ ++ +   ++  RPTA  LL+
Sbjct:  329 QGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVT---GTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAI-FKIATQPTKPTLPEGVSDASRDFLRQVF-VEEKWRPTADILLN 583          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 148.288 bits (373), Expect = 1.750e-37
Identity = 92/260 (35.38%), Postives = 147/260 (56.54%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP-KSECGNT-KEFKLLINEMR--NQINHSRIIKVYGSFTK--EKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            + + LG+GAFG+VY C      ++ A K +P   +C  T KE   L  E++    + H RI++ YG      ++KL IF+EF  GG++++++   G L+ +   R+++QIL+GV +LH   I+HRDIK  NIL D++ NVKL DF  S+          G KS+T   GTP +++PE++N   Y   AD+WSV  T   M+T KPP+   +  +AI ++I T   +      +S   R+ ++ +   ++  RPTA  LL+
Sbjct:  359 QGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVT---GTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAI-FKIATQPTKPTLPEGVSDASRDFLRQVF-VEEKWRPTADILLN 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 148.288 bits (373), Expect = 1.750e-37
Identity = 92/260 (35.38%), Postives = 147/260 (56.54%), Query Frame = 1
Query:  994 KSEFLGQGAFGKVYKCISRKGDKKYAVKLIP-KSECGNT-KEFKLLINEMR--NQINHSRIIKVYGSFTK--EKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT--------KGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLH 1731
            + + LG+GAFG+VY C      ++ A K +P   +C  T KE   L  E++    + H RI++ YG      ++KL IF+EF  GG++++++   G L+ +   R+++QIL+GV +LH   I+HRDIK  NIL D++ NVKL DF  S+          G KS+T   GTP +++PE++N   Y   AD+WSV  T   M+T KPP+   +  +AI ++I T   +      +S   R+ ++ +   ++  RPTA  LL+
Sbjct:  359 QGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVT---GTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAI-FKIATQPTKPTLPEGVSDASRDFLRQVF-VEEKWRPTADILLN 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 142.895 bits (359), Expect = 1.277e-36
Identity = 88/255 (34.51%), Postives = 138/255 (54.12%), Query Frame = 1
Query:  982 KHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSR--TKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQI 1740
            ++  K E +G+G+FG+VYK I+ +  +  A+K+I   E  +  E       + +Q +   + K YGS+ K  KL I ME+  GG+  + + + G L    +    ++IL+G+E+LH    IHRDIK  N+LL    +VKLADF  +   T       TF GTP ++APE++    Y F ADIWS+G T   +  G+PP + +  P  +++ I  N     E    S   +E ++A +NKD   RPTA +LL ++ 
Sbjct:   18 EYFTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALD-LLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLH-PMRVLFLIPKNTPPTLE-GPYSKPFKEFVEACLNKDPRFRPTAKELLKHKF 269          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000016740.1 (SMESG000016740.1)

HSP 1 Score: 1115.14 bits (2883), Expect = 0.000e+0
Identity = 535/552 (96.92%), Postives = 542/552 (98.19%), Query Frame = 1
Query:   91 MDAMNDLGITDRELELFFLAVEKGSVVDFNKYFKDEFLERKLKNQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            MDAMNDLGITDRELELFFL VEKGSVVDFNKYFKDEFLERKLK QNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLK+NCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISS QDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKS+CGNTKEFKLLINEM+NQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTL NKISKE KLSRESVIRFSKQILEGVEHLHQM+IIHRDIKPGNILLD+NDNVKLADFDWSRTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGAT FNMITG+PPYNHIDIP  IMY+I T GFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH
Sbjct:    1 MDAMNDLGITDRELELFFLVVEKGSVVDFNKYFKDEFLERKLKKQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKKNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSAQDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSDCGNTKEFKLLINEMKNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLLNKISKESKLSRESVIRFSKQILEGVEHLHQMNIIHRDIKPGNILLDDNDNVKLADFDWSRTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATTFNMITGEPPYNHIDIPETIMYKIATIGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 552          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000016740.1 (SMESG000016740.1)

HSP 1 Score: 1108.21 bits (2865), Expect = 0.000e+0
Identity = 532/549 (96.90%), Postives = 539/549 (98.18%), Query Frame = 1
Query:  100 MNDLGITDRELELFFLAVEKGSVVDFNKYFKDEFLERKLKNQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 1746
            MNDLGITDRELELFFL VEKGSVVDFNKYFKDEFLERKLK QNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLK+NCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISS QDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKS+CGNTKEFKLLINEM+NQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTL NKISKE KLSRESVIRFSKQILEGVEHLHQM+IIHRDIKPGNILLD+NDNVKLADFDWSRTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGAT FNMITG+PPYNHIDIP  IMY+I T GFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH
Sbjct:    1 MNDLGITDRELELFFLVVEKGSVVDFNKYFKDEFLERKLKKQNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKKNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSAQDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSDCGNTKEFKLLINEMKNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLLNKISKESKLSRESVIRFSKQILEGVEHLHQMNIIHRDIKPGNILLDDNDNVKLADFDWSRTKGAKSLTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATTFNMITGEPPYNHIDIPETIMYKIATIGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIFH 549          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 431.024 bits (1107), Expect = 7.435e-144
Identity = 234/566 (41.34%), Postives = 345/566 (60.95%), Query Frame = 1
Query:   88 KMDAMNDLGITDRELELFFLAVEKGSVVDFNKYFKDEFLERKLKN-QNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEMA---QAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIV---NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPS-AIMYQIGT-NGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            + ++  ++ I + E +LF  A++ GS   F +YFK+EFLERK    +  IH AC  GH EIVKLLI   CDIEALD ++ RP+H AC       V  L++  C+I+  + DNW P+H+A   G +E+VK LI  K D+EAL + N RPIH AC  GH E +K+L++N CDIEA D+ +R   H  C +G+++ + LLIE NC++EA D  N RPIHHAC  GH   V+ L    CD+ A+    ++P+       N ++IK+L +        +++      M + C++ CDHK CP SLR K  DK   +G+GAFGK+YK         +A+K +  SE  + K  +  I +   +++H RI+K +G+   EK LC+FME+   G+L  +IS +G +  ++VIR+SKQILEG++ LH   IIHRDIKP NILLD  +N+KLADF   R+       +  + T  GT NF APE++   +D  Y  SADIWSVGAT  NMI+G+PPY+  + PS A+++++ T    ++P+   ++  ++  I+ M+N +  KR +A QLL  ++F
Sbjct:   58 RRESFRNIRIRNEEFKLFINAIKSGSAELFRRYFKEEFLERKDAGLRRPIHHACIAGHAEIVKLLIEHKCDIEALDWRNRRPIHLACYHGHSEAVKLLIEHKCDIEALDWDNWRPIHHACIAGHAEIVKLLIEHKCDIEALDWRNRRPIHLACYHGHSEAVKLLIENKCDIEALDEQKRRPIHLACYQGHSEAVKLLIEHNCDIEALDWWNQRPIHHACIQGHSEAVKLLIENKCDIDARDESGNSPMEFAMKSGNTEIIKILNEARLERQRQQQLERQISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKIYKLQGSGISSVFAIKRM-NSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYD--NYPSFAVIFKVMTLKKLDLPKPQLMTAQIKSFIEEMLNPNPKKRSSAAQLLKLKLF 620          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 427.943 bits (1099), Expect = 1.298e-142
Identity = 233/553 (42.13%), Postives = 338/553 (61.12%), Query Frame = 1
Query:  127 ELELFFLAVEKGSVVDFNKYFKDEFLERKLKN-QNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEMA---QAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIV---NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPS-AIMYQIGT-NGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            E +LF  A++ GS   F +YFK+EFLERK    +  IH AC  GH EIVKLLI   CDIEALD ++ RP+H AC       V  L++  C+I+  + DNW P+H+A   G +E+VK LI  K D+EAL + N RPIH AC  GH E +K+L++N CDIEA D+ +R   H  C +G+++ + LLIE NC++EA D  N RPIHHAC  GH   V+ L    CD+ A+    ++P+       N ++IK+L +        +++      M + C++ CDHK CP SLR K  DK   +G+GAFGK+YK         +A+K +  SE  + K  +  I +   +++H RI+K +G+   EK LC+FME+   G+L  +IS +G +  ++VIR+SKQILEG++ LH   IIHRDIKP NILLD  +N+KLADF   R+       +  + T  GT NF APE++   +D  Y  SADIWSVGAT  NMI+G+PPY+  + PS A+++++ T    ++P+   ++  ++  I+ M+N +  KR +A QLL  ++F
Sbjct:   76 EFKLFINAIKSGSAELFRRYFKEEFLERKDAGLRRPIHHACIAGHAEIVKLLIEHKCDIEALDWRNRRPIHLACYHGHSEAVKLLIEHKCDIEALDWDNWRPIHHACIAGHAEIVKLLIEHKCDIEALDWRNRRPIHLACYHGHSEAVKLLIENKCDIEALDEQKRRPIHLACYQGHSEAVKLLIEHNCDIEALDWWNQRPIHHACIQGHSEAVKLLIENKCDIDARDESGNSPMEFAMKSGNTEIIKILNEARLERQRQQQLERQISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKIYKLQGSGISSVFAIKRM-NSEGVDEKYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYD--NYPSFAVIFKVMTLKKLDLPKPQLMTAQIKSFIEEMLNPNPKKRSSAAQLLKLKLF 625          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 408.297 bits (1048), Expect = 9.690e-136
Identity = 232/572 (40.56%), Postives = 340/572 (59.44%), Query Frame = 1
Query:  121 DRELELFFLAVEKGSVVDFNKYFKDEFLERKLKN-QNAIHIACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQNCEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNACRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNCNLEACDIGNW--------------------RPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQDKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHIDKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMRNQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIRFSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRT-----KGAKSLTTFAGTPNFIAPEIV----NDIHYTFSADIWSVGATNFNMITGKPPYNHIDIPSAIMYQIG-TNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQIF 1743
            D E +LF  A++ GS V F +YFK+E+LERK  +  + IH AC  GH EIVKLLI  NCDIEALD+ + RP+H+AC +     V  L++  C+I+  +  N  P+HYA   G SE VK LI  K D+EA+   N RPIH+AC  GH E +K+L++N CDIEA D+   +    + +K + + +  ++   C L AC  G+                     RPIH AC +G+I +V+ L +  CD+ A+   N +P+      +N++L+++L+ E      +E+    M ++C ++C+H+ C  SLR K  DK   +G GAFG VYKC     D  +AVK I   + G  K  +  IN+   ++NH RIIK +G+   E  LCIFME+ +GG+L+++I ++  L+ E++IR+SKQILEG+E LH  +IIHRDIKP NIL+ N +N+K+ DF  SR+            T  GTPNF APE+         YT SADIWS+GAT  NMITG+PPY     P A++ +I  T   ++P+   +S +++E I+ M++ D ++R TA QLL  ++F
Sbjct:    2 DEEFKLFINAIKSGSAVLFRRYFKEEYLERKDADLWSPIHHACFAGHAEIVKLLIEHNCDIEALDKWNLRPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPME-IAVKSHNERIIHILNGPCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAE-----ELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIG-VKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSGGSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIKPDNILMSNGNNIKITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCH-PYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLF 565          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K191.803e-4034.50mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K192.507e-3834.50mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K192.575e-3834.50mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K192.575e-3834.50mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K23.495e-3734.67mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-11.953e-3833.73Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.183e-3833.73Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-12.234e-3833.73Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-18.164e-3833.73Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-11.470e-3534.13Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PhKgamma5.134e-3531.37gene:FBgn0011754 transcript:FBtr0343587[more]
PhKgamma1.201e-3431.37gene:FBgn0011754 transcript:FBtr0090002[more]
PhKgamma1.201e-3431.37gene:FBgn0011754 transcript:FBtr0343648[more]
PhKgamma7.736e-3431.37gene:FBgn0011754 transcript:FBtr0301501[more]
PhKgamma7.736e-3431.37gene:FBgn0011754 transcript:FBtr0301500[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k191.534e-4335.96mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k226.296e-3836.68mitogen-activated protein kinase kinase kinase 22 ... [more]
map3k27.293e-3835.98mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k29.737e-3835.98mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k32.015e-3734.62mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd81.593e-3834.88sterile alpha motif domain containing 8 [Source:Xe... [more]
samd81.710e-3834.88sterile alpha motif domain containing 8 [Source:Xe... [more]
MAP3K24.338e-3836.82mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K27.969e-3836.54mitogen-activated protein kinase kinase kinase 2 [... [more]
dennd1a2.480e-3734.48DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k197.275e-4134.22mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k199.478e-3934.88mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k191.739e-3834.22mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k191.968e-3834.22mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k23.278e-3735.85mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9FZ36|M3K2_ARATH1.165e-3935.77Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|F4HRJ4|M3K3A_ARATH2.572e-3834.63Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|P25323|MYLKA_DICDI3.451e-3834.66Myosin light chain kinase A OS=Dictyostelium disco... [more]
sp|O22042|M3K3_ARATH4.219e-3834.48Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|E9Q3S4|M3K19_MOUSE1.216e-3734.22Mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG28.750e-5934.78Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0R3RIB61.643e-4639.38Protein kinase domain-containing protein OS=Elaeop... [more]
A0A044RDS99.797e-4639.61Protein kinase domain-containing protein OS=Onchoc... [more]
A0A182GGY82.012e-4538.96ANK_REP_REGION domain-containing protein OS=Aedes ... [more]
A0A1I7VS832.765e-4538.22STE/STE11/MEKK2 protein kinase OS=Loa loa OX=7209 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k221.326e-3835.55mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k221.327e-3835.55mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k192.423e-3832.05mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k23.987e-3836.36mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k38.053e-3734.35mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k21.121e-3934.21mitogen-activated protein kinase kinase kinase 2 [... [more]
ENSPMAT00000000175.11.176e-3330.74pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
stk25a3.460e-3333.33serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
mylk37.829e-3231.25myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
MAP4K33.791e-3132.68mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC152.305e-3535.25Protein kinase of the Mitotic Exit Network; locali... [more]
RAD535.351e-3431.84DNA damage response protein kinase; required for c... [more]
CDC52.761e-3329.57Polo-like kinase; controls targeting and activatio... [more]
GIN43.691e-3330.14Protein kinase involved in bud growth and assembly... [more]
SSK221.356e-3232.10MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414102.802e-4637.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478212.047e-3832.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428453.088e-3533.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
OBSCURIN3.944e-3532.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336525.963e-3428.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k28.473e-3936.74mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k221.389e-3735.38mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k221.750e-3735.38mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k221.750e-3735.38mitogen-activated protein kinase kinase kinase 3 [... [more]
stk25b1.277e-3634.51serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016740.10.000e+096.92SMESG000016740.1[more]
SMESG000016740.10.000e+096.90SMESG000016740.1[more]
SMESG000017274.17.435e-14441.34SMESG000017274.1[more]
SMESG000017274.11.298e-14242.13SMESG000017274.1[more]
SMESG000017261.19.690e-13640.56SMESG000017261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009502 ID=SMED30009502|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1820bp
GATTCTCATTGGTCCGGATTTCATTATTGACATTTAAAAATAAGCCAATT
ATCAGGTGGAACTGCTATGACAACCATTGGACTATAGAAGATGGATGCAA
TGAATGATCTCGGAATAACCGACAGGGAGTTGGAATTATTTTTTCTAGCT
GTAGAAAAAGGATCCGTTGTAGACTTTAATAAGTATTTCAAAGATGAGTT
TCTAGAAAGAAAATTGAAAAATCAGAATGCTATTCATATTGCTTGTCAAA
AGGGCCATTTTGAAATTGTGAAATTGTTGATCAACAAGAATTGCGATATT
GAAGCACTTGATGAAAAAGACTGGCGACCTCTGCACCACGCTTGTAGGGA
GAATTGGTTAAGCATAGTTGATGAATTATTGAAGCAAAATTGTGAAATTG
ATCCAAAAAATATAGACAACTGGACCCCTTTGCATTATGCGGCCGGATAC
GGTTGTTCTGAGGTTGTTAAAAAATTAATAAATGCAAAAAGTGACTTGGA
AGCACTGACTTTTGATAATTGGCGTCCAATTCATAATGCCTGTCGTTTTG
GGCATCTTGAAGTAATAAAGGTTTTATTAGATAACAACTGCGATATTGAG
GCTCGGGATAAAGATCAACGTACCGCTACTCATTATGTCTGTATGAAAGG
ATATACTGATATTCTAGATTTACTGATCGAAAGAAACTGCAACCTCGAAG
CTTGTGATATTGGAAATTGGCGCCCAATTCATCATGCATGTCATAATGGA
CATATTGCAATTGTTGAAAAGCTTTTCCGAAAAGGTTGTGATGTTAAAGC
TAAGACTTCTGATAATCACACGCCAATAAGTTCGGTTCAGGACAAAAAAA
ATCAAAAATTAATCAAAATGTTGGAGAAAGAAATAGCTCATTTCGATATT
GTAGAGGAAATGGCCCAGGCAATGGATATCCAATGCGATGCATATTGTGA
TCACAAATTTTGTCCATACTCTCTTCGCTTAAAACATATCGATAAAAGCG
AGTTCCTTGGCCAAGGAGCATTTGGCAAGGTGTATAAGTGCATATCGAGA
AAAGGTGACAAAAAGTATGCAGTTAAACTTATTCCAAAATCAGAATGCGG
CAACACAAAAGAGTTCAAACTTTTAATAAACGAAATGAGAAACCAAATAA
ATCATTCTAGAATTATTAAAGTTTATGGCTCATTTACTAAAGAAAAAAAA
TTATGCATTTTCATGGAATTTGCAGCAGGAGGCACTCTGCAAAATAAAAT
CAGTAAAGAAGGCAAGCTATCAAGAGAAAGTGTCATTCGTTTCAGCAAAC
AAATTCTCGAAGGCGTCGAACATTTGCATCAAATGGATATAATTCACCGG
GATATCAAGCCGGGAAACATATTGCTGGATAATAATGACAATGTGAAGCT
TGCTGATTTTGATTGGAGTCGGACGAAAGGAGCAAAGAGTTTGACAACAT
TCGCTGGAACGCCGAACTTTATAGCTCCCGAGATCGTTAATGATATTCAT
TACACGTTTTCGGCGGATATTTGGTCTGTTGGTGCGACGAATTTTAATAT
GATTACAGGCAAGCCCCCATATAATCATATAGACATTCCGTCAGCAATCA
TGTATCAAATTGGCACAAATGGATTCGAAGTTCCTGAAGATGCCGATATT
TCATTTGATTTGAGGGAAATGATAAAGGCAATGATGAATAAAGACCAAAA
TAAGCGGCCTACAGCTACACAATTACTTCACAATCAGATTTTTCACTAAT
AATCTTGAAAATATTTCCCGATTTTTGTTTGACATGATCTTAATAAATTA
TATTTCAATTTTATTTCTGG
back to top

protein sequence of SMED30009502-orf-1

>SMED30009502-orf-1 ID=SMED30009502-orf-1|Name=SMED30009502-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=553bp
MDAMNDLGITDRELELFFLAVEKGSVVDFNKYFKDEFLERKLKNQNAIHI
ACQKGHFEIVKLLINKNCDIEALDEKDWRPLHHACRENWLSIVDELLKQN
CEIDPKNIDNWTPLHYAAGYGCSEVVKKLINAKSDLEALTFDNWRPIHNA
CRFGHLEVIKVLLDNNCDIEARDKDQRTATHYVCMKGYTDILDLLIERNC
NLEACDIGNWRPIHHACHNGHIAIVEKLFRKGCDVKAKTSDNHTPISSVQ
DKKNQKLIKMLEKEIAHFDIVEEMAQAMDIQCDAYCDHKFCPYSLRLKHI
DKSEFLGQGAFGKVYKCISRKGDKKYAVKLIPKSECGNTKEFKLLINEMR
NQINHSRIIKVYGSFTKEKKLCIFMEFAAGGTLQNKISKEGKLSRESVIR
FSKQILEGVEHLHQMDIIHRDIKPGNILLDNNDNVKLADFDWSRTKGAKS
LTTFAGTPNFIAPEIVNDIHYTFSADIWSVGATNFNMITGKPPYNHIDIP
SAIMYQIGTNGFEVPEDADISFDLREMIKAMMNKDQNKRPTATQLLHNQI
FH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR000719Prot_kinase_dom
IPR020683Ankyrin_rpt-contain_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation