DNA polymerase alpha subunit B

Overview
NameDNA polymerase alpha subunit B
Smed IDSMED30009491
Length (bp)1697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA polymerase alpha subunit B (SMED30009491) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA polymerase alpha subunit B (SMED30009491) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA polymerase alpha subunit B (SMED30009491) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA polymerase alpha subunit B (SMED30009491) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009491

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009491h1SMcG0009511 SmedASXL_009063SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30009491h1SMcG0009511 SMED_06617_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009491h1SMcG0009511 SMED_06617_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009491h1SMcG0009511 SmWIOct06_017686GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009491h1SMcG0009511 SMED_16054_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009491h1SMcG0009511 SMED_16054_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA polymerase alpha subunit B vs. Ensembl Human
Match: POLA2 (DNA polymerase alpha 2, accessory subunit [Source:HGNC Symbol;Acc:HGNC:30073])

HSP 1 Score: 113.62 bits (283), Expect = 5.916e-26
Identity = 88/316 (27.85%), Postives = 145/316 (45.89%), Query Frame = 1
Query:  745 QNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI-NVREISGDLQ---IVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP-RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNISKPKTE 1638
            ++ SG ++P     + +   YS F G+ VI++G N T      + +   +   PLP     E   D +   +++ CG      +   DPL  L+  I  +  DV I  GP +D      EN   L     E + K C+           +HL+ VPS+ +     V+PQ  FS S  L   +   + F   P  +SI    FG+++ D+L HL  +EIS +  T  R  R+ +HIL + ++YPL PP  ++ ++   +         P   LIIPS+L  F++++ G  C+NP     G    ++ RL + +P  +
Sbjct:  277 EHSSGAQIPVD---LSELKEYSLFPGQVVIMEGINTTGRKLVATKL---YEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENC--LLTSPFEDIFKQCLRTIIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFSYS-DLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTP-DVLIIPSELRYFVKDVLGCVCVNPGRLTKGQVGGTFARLYLRRPAAD 582          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Human
Match: AP000944.5 (novel protein, POLA2-CDC42EP2 readthrough)

HSP 1 Score: 97.8265 bits (242), Expect = 8.982e-21
Identity = 80/284 (28.17%), Postives = 130/284 (45.77%), Query Frame = 1
Query:  745 QNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI-NVREISGDLQ---IVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP-RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIEN 1557
            ++ SG ++P     + +   YS F G+ VI++G N T      + +   +   PLP     E   D +   +++ CG      +   DPL  L+  I  +  DV I  GP +D      EN   L     E + K C+           +HL+ VPS+ +     V+PQ  FS S  L   +   + F   P  +SI    FG+++ D+L HL  +EIS +  T  R  R+ +HIL + ++YPL PP  ++ ++   +          P  LIIPS+L  F+++
Sbjct:  277 EHSSGAQIPVD---LSELKEYSLFPGQVVIMEGINTTGRKLVATKL---YEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENC--LLTSPFEDIFKQCLRTIIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFSYS-DLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVT-PDVLIIPSELRYFVKD 550          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Human
Match: POLA2 (DNA polymerase alpha 2, accessory subunit [Source:HGNC Symbol;Acc:HGNC:30073])

HSP 1 Score: 87.0409 bits (214), Expect = 1.562e-18
Identity = 63/212 (29.72%), Postives = 99/212 (46.70%), Query Frame = 1
Query:  946 IVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP-RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIE 1554
            +++ CG      +   DPL  L+  I  +  DV I  GP +D      EN   L     E + K C+           +HL+ VPS+ +     V+PQ  FS S  L   +   + F   P  +SI    FG+++ D+L HL  +EIS +  T  R  R+ +HIL + ++YPL PP  ++ ++   +          P  LIIPS+L  F++
Sbjct:   12 VLVACGPYTTSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENC--LLTSPFEDIFKQCLRTIIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFSYS-DLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVT-PDVLIIPSELRYFVK 219          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Celegans
Match: div-1 (DNA polymerase alpha subunit B [Source:UniProtKB/Swiss-Prot;Acc:Q21625])

HSP 1 Score: 95.1301 bits (235), Expect = 2.529e-20
Identity = 94/387 (24.29%), Postives = 166/387 (42.89%), Query Frame = 1
Query:  472 IHGKDVCESQLQMYNESLNDSSTKL--NFSDMVAVGNKYF---DEIYTCGRLTLDHTQTGMYDAEIFNSLQFDDEYHGTESVYNDFEKLTPKNIAIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRND------TADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELC---VFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP---RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACIN 1581
            ++G D     ++   + + D + ++  +F ++V  GN      D +YT G++  D T+      E   +L  +DE  GT  +  DF K+T                        +  + F G+ + ++G N T     V  +   F    LP+N  E     +I   CG      N   + L  L+ ++ A   D+L+  GP VD+ +      T +   D L  + L  + +  V   T +II P  + + +LC   VFP + F  + +L      LI F  +P I  I   E  +++++ ++ LS  E  ++ +     R+ RL  H+L +   YPL P   E+  ++   ++ C  G+  PH +  P+KL    + +NG   IN
Sbjct:  189 LYGGDKSSMVIEAKAQRMADIAHRIQKSFEEIVDWGNPSIPSVDVVYTYGQVIHDETKDNEKFGEHSVALMINDE-DGT-MIRMDFSKMT------------------------EDITLFPGQIIAVRGTNETGEELQVDKI---FQPAALPVNPVETDTTKEIWFACGPYTATDNCGYEHLCELLDKVVAEKPDILMLAGPFVDKKNTFLNKPTFNITYDNLLEDLLLKVKETLVGTKTQVIIQP--NASRDLCVPPVFPSAPFQQNRKLDKIKKELI-FVADPCIFRISGVEVAMTSSEPIQALSNTEFHRSANQENIDRVARLSSHLLTQQCMYPLEP--TEVPASMGDLLDVCCIGST-PHIVFAPTKLAPSAKCVNGSVFIN 540          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Fly
Match: DNApol-alpha73 (gene:FBgn0005696 transcript:FBtr0114543)

HSP 1 Score: 102.449 bits (254), Expect = 1.612e-22
Identity = 76/281 (27.05%), Postives = 131/281 (46.62%), Query Frame = 1
Query:  769 PCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRN--------DTADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPG 1587
            P  +L   +    S F G+ V+ KG  P    F V  +     +K  P    +I  +LQ V+  G   + ++   +PL  L++ +K +  DVL+ TGP +D +        +T D   +K+    +E      +  +T +++V S  +A  L V+P     P A    + +  ++  P+P++V +  +  G+++ D++ HL + E + N    R+ R   H+  + +FYPL PP  E     SQ   K +     P+ LI+PS    FI  +N    INPG
Sbjct:  305 PTLTLNFSRVKSASIFPGQVVLAKGFIPRGKTFMVEEI--HTERKLTPATPLQIDRELQFVVASGPFTDSTDLFYEPLHDLLKYLKDHRPDVLVLTGPFLDADHKMVGELAETFDTFFEKMIGGIME-----SIGSHTAVLVVTSQKDAMALSVYPT---PPPALRRTYPN--LYMLPDPSLVDLDGFTLGVTSTDVVDHLLSHEFAVNAGE-RMHRAINHLFHQGSFYPLYPPADEDMAYDSQLALKYAQLKQLPNVLILPSDQRHFIRLVNDCLVINPG 572          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Zebrafish
Match: pola2 (polymerase (DNA directed), alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-778])

HSP 1 Score: 118.242 bits (295), Expect = 1.403e-27
Identity = 84/312 (26.92%), Postives = 148/312 (47.44%), Query Frame = 1
Query:  739 AIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSV-----LPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVD--------LNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNI 1620
            A Q   G ++P     + +   +S F G+ V+++G NP+      + +     LP +    +   + E+   + ++I CG      +   DPL  L+  I  +  DV I  GP VD      E +     E  E + K C+D            L+ VPS  +     ++PQ  F+ +  +   ++  +  AP+P  + IG   FG+++ DIL H+  +EIS    T R  R+ +H+L + ++YPL PP  E++++  ++ ++ S  +  P  L+ PS+L  FI+++ G  C+NP     G    +Y RL I
Sbjct:  274 AGQEQGGRQVPVD---LSELKEFSLFPGQVVVMEGMNPSGEKLVATKLYEGIPLPFYCPSEVKQEMDEVCEPVMVMIACGPYTPSESLTYDPLLDLITIINKDRPDVCILFGPFVDSKHEQIEKNQ--VTETFETIFKRCMDSIVEGTKGTACKLVFVPSQRDVHHHYIYPQPPFNLT--ISKEDTARVTLAPDPCTLLIGNVTFGLTSTDILFHMGAEEISSGTGTERFSRIMKHMLTQRSYYPLYPPAEEVNMDYDKF-QQFSQMSLTPDILVAPSELRYFIKDVIGCVCVNPGRLTKGQIGGTYGRLLI 577          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Xenopus
Match: tnfaip1 (TNF alpha induced protein 1 [Source:Xenbase;Acc:XB-GENE-943703])

HSP 1 Score: 114.775 bits (286), Expect = 2.516e-26
Identity = 91/316 (28.80%), Postives = 148/316 (46.84%), Query Frame = 1
Query:  718 KLTPKNIAIQ----NYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDL-----QIVIT-CGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCF-----NSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP-RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            KL  K++ ++    + +G ++P     + +   YS F G+ VI++G N T   F     +P    + +P+   + S +      Q+VIT CG          D LK L+  +  +  D+ I  GP +D      EN         E + K C+ +          HL+ VPS+ +     V+PQ  FS      CF     +   +HF  +P  +S+     GI++ D+L H+  +EIS +   P R  R+  HIL + ++YPL PP+ EI+V+   +    S+   P  P   I+PS+L  FI+++ G  CINPG
Sbjct:  263 KLNSKSVILEGDREHSAGMQVPVD---LSELKEYSLFPGQVVIMEGTNSTGRRF-----VPTKLYEGVPLPFHQPSKEFEECPQQMVITACGPFTTSDTITYDALKDLIDVLNRDCPDICILLGPFLDAKHEQIENLQLTV--TFEDVFKRCLKMIIEGTRLSGCHLVFVPSLRDVHHDPVYPQPPFS------CFEPAKEDKDRVHFVADPCTLSVNGVILGITSTDLLFHMGAEEISSSVGAPDRFSRILRHILTQRSYYPLYPPNEEINVDYEAFY---SYAPMPVTPDIFIVPSELRYFIKDVTGCICINPG 559          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Xenopus
Match: tnfaip1 (TNF alpha induced protein 1 [Source:Xenbase;Acc:XB-GENE-943703])

HSP 1 Score: 105.145 bits (261), Expect = 4.155e-23
Identity = 87/308 (28.25%), Postives = 146/308 (47.40%), Query Frame = 1
Query:  718 KLTPKNIAIQ----NYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDL-----QIVIT-CGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCF-----NSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP-RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            KL  K++ ++    + +G ++P     + +   YS F G+ VI++G N T   F     +P    + +P+   + S +      Q+VIT CG          D LK L+  +  +  D+ I    +        E+  K C   L+++ +       HL+ VPS+ +     V+PQ  FS      CF     +   +HF  +P  +S+     GI++ D+L H+  +EIS +   P R  R+  HIL + ++YPL PP+ EI+V+   +    S+   P  P   I+PS+L  FI+++ G  CINPG
Sbjct:  350 KLNSKSVILEGDREHSAGMQVPVD---LSELKEYSLFPGQVVIMEGTNSTGRRF-----VPTKLYEGVPLPFHQPSKEFEECPQQMVITACGPFTTSDTITYDALKDLIDVLNRDCPDICILNLQLT----VTFEDVFKRC---LKMIIEGTRLSGCHLVFVPSLRDVHHDPVYPQPPFS------CFEPAKEDKDRVHFVADPCTLSVNGVILGITSTDLLFHMGAEEISSSVGAPDRFSRILRHILTQRSYYPLYPPNEEINVDYEAFY---SYAPMPVTPDIFIVPSELRYFIKDVTGCICINPG 633          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Xenopus
Match: tnfaip1 (TNF alpha induced protein 1 [Source:Xenbase;Acc:XB-GENE-943703])

HSP 1 Score: 103.605 bits (257), Expect = 9.944e-23
Identity = 73/232 (31.47%), Postives = 111/232 (47.84%), Query Frame = 1
Query:  943 QIVIT-CGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCF-----NSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP-RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            Q+VIT CG          D LK L+  +  +  D+ I  GP +D      EN         E + K C+ +          HL+ VPS+ +     V+PQ  FS      CF     +   +HF  +P  +S+     GI++ D+L H+  +EIS +   P R  R+  HIL + ++YPL PP+ EI+V+   +    S+   P  P   I+PS+L  FI+++ G  CINPG
Sbjct:  330 QMVITACGPFTTSDTITYDALKDLIDVLNRDCPDICILLGPFLDAKHEQIENLQLTV--TFEDVFKRCLKMIIEGTRLSGCHLVFVPSLRDVHHDPVYPQPPFS------CFEPAKEDKDRVHFVADPCTLSVNGVILGITSTDLLFHMGAEEISSSVGAPDRFSRILRHILTQRSYYPLYPPNEEINVDYEAFY---SYAPMPVTPDIFIVPSELRYFIKDVTGCICINPG 550          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Xenopus
Match: tnfaip1 (TNF alpha induced protein 1 [Source:Xenbase;Acc:XB-GENE-943703])

HSP 1 Score: 98.9821 bits (245), Expect = 2.031e-21
Identity = 85/315 (26.98%), Postives = 142/315 (45.08%), Query Frame = 1
Query:  718 KLTPKNIAIQ----NYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPL--PINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCF-----NSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISK----NCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            KL  K++ ++    + +G ++P     + +   YS F G+ VI++G N T   F ++S+        L  P+ + E    + ++  CG          D LK L+  +  +  D+ I  GP +D      EN         E + K C+ +          HL+ VPS+ +     V+PQ  FS      CF     +   +HF  +P  +S+     GI++ D+L H+  +EIS      C +  I+    H     ++YPL PP+ EI+V+   +    S+   P  P   I+PS+L  FI+++ G  CINPG
Sbjct:  159 KLNSKSVILEGDREHSAGMQVPVD---LSELKEYSLFPGQVVIMEGTNSTGRRFHLNSLHILLVPNALFCPVIITECPQQM-VITACGPFTTSDTITYDALKDLIDVLNRDCPDICILLGPFLDAKHEQIENLQLTV--TFEDVFKRCLKMIIEGTRLSGCHLVFVPSLRDVHHDPVYPQPPFS------CFEPAKEDKDRVHFVADPCTLSVNGVILGITSTDLLFHMGAEEISSVQQAQCFSLLIKMFMSH-----SYYPLYPPNEEINVDYEAFY---SYAPMPVTPDIFIVPSELRYFIKDVTGCICINPG 453          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Xenopus
Match: tnfaip1 (TNF alpha induced protein 1 [Source:Xenbase;Acc:XB-GENE-943703])

HSP 1 Score: 96.6709 bits (239), Expect = 1.098e-20
Identity = 86/315 (27.30%), Postives = 140/315 (44.44%), Query Frame = 1
Query:  718 KLTPKNIAIQN----YSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQ--IVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCF-----NSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISK----NCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            KL  K++ ++      +G ++P     + +   YS F G+ VI++G N T   F V + L    ++     V +I    Q  ++  CG          D LK L+  +  +  D+ I  GP +D      EN         E + K C+ +          HL+ VPS+ +     V+PQ  FS      CF     +   +HF  +P  +S+     GI++ D+L H+  +EIS      C +  I+    H     ++YPL PP+ EI+V+   +    S+   P  P   I+PS+L  FI+++ G  CINPG
Sbjct:  167 KLNSKSVILEGDREHSAGMQVPVD---LSELKEYSLFPGQVVIMEGTNSTGRRF-VPTKLYEVRRE-----VEQICSHFQFMVITACGPFTTSDTITYDALKDLIDVLNRDCPDICILLGPFLDAKHEQIENLQLTV--TFEDVFKRCLKMIIEGTRLSGCHLVFVPSLRDVHHDPVYPQPPFS------CFEPAKEDKDRVHFVADPCTLSVNGVILGITSTDLLFHMGAEEISSVQQAQCFSLLIKMFMSH-----SYYPLYPPNEEINVDYEAFY---SYAPMPVTPDIFIVPSELRYFIKDVTGCICINPG 456          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Mouse
Match: Pola2 (polymerase (DNA directed), alpha 2 [Source:MGI Symbol;Acc:MGI:99690])

HSP 1 Score: 109.768 bits (273), Expect = 9.150e-25
Identity = 77/274 (28.10%), Postives = 131/274 (47.81%), Query Frame = 1
Query:  805 YSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI----NVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENS------DKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEI-SKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            YS F G+ VI++G N T      + +   +   PLP          S    +V+ CG      +   DPL  L+  I  +  DV I  GP +D      EN       + +  + L  + +      +HL+ VPS+ +     V+PQ  F+ S +L   +   + F   P  +SI    FG+++ D+L H+  +EI S + ++ R  R+ +HIL + ++YPL PPH ++ ++   +    ++   P  P   I+PS+L  F+++I G  C+NPG
Sbjct:  294 YSLFPGQVVIMEGFNTTGRRLTATKL---YEGVPLPFYQPTEEEGASEQTMVVVACGPYTTSDSITYDPLLDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTSPFEDVFKQCLRTVIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFTFS-ELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHIGAEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPPHEDMAIDYENFY---TYAQLPVTPDVFIVPSELRYFVKDIFGCVCVNPG 560          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Mouse
Match: Pola2 (polymerase (DNA directed), alpha 2 [Source:MGI Symbol;Acc:MGI:99690])

HSP 1 Score: 94.3597 bits (233), Expect = 3.293e-20
Identity = 71/263 (27.00%), Postives = 123/263 (46.77%), Query Frame = 1
Query:  805 YSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI----NVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENS------DKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEI-SKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIE 1554
            YS F G+ VI++G N T      + +   +   PLP          S    +V+ CG      +   DPL  L+  I  +  DV I  GP +D      EN       + +  + L  + +      +HL+ VPS+ +     V+PQ  F+ S +L   +   + F   P  +SI    FG+++ D+L H+  +EI S + ++ R  R+ +HIL + ++YPL PPH ++ ++   +    ++   P  P   I+PS+L  F++
Sbjct:  133 YSLFPGQVVIMEGFNTTGRRLTATKL---YEGVPLPFYQPTEEEGASEQTMVVVACGPYTTSDSITYDPLLDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTSPFEDVFKQCLRTVIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFTFS-ELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHIGAEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPPHEDMAIDYENFY---TYAQLPVTPDVFIVPSELRYFVK 388          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Mouse
Match: Pola2 (polymerase (DNA directed), alpha 2 [Source:MGI Symbol;Acc:MGI:99690])

HSP 1 Score: 94.7449 bits (234), Expect = 4.636e-20
Identity = 71/264 (26.89%), Postives = 123/264 (46.59%), Query Frame = 1
Query:  805 YSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI----NVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENS------DKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEI-SKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIEN 1557
            YS F G+ VI++G N T      + +   +   PLP          S    +V+ CG      +   DPL  L+  I  +  DV I  GP +D      EN       + +  + L  + +      +HL+ VPS+ +     V+PQ  F+ S +L   +   + F   P  +SI    FG+++ D+L H+  +EI S + ++ R  R+ +HIL + ++YPL PPH ++ ++   +    ++   P  P   I+PS+L  F++ 
Sbjct:  294 YSLFPGQVVIMEGFNTTGRRLTATKL---YEGVPLPFYQPTEEEGASEQTMVVVACGPYTTSDSITYDPLLDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTSPFEDVFKQCLRTVIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFTFS-ELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHIGAEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPPHEDMAIDYENFY---TYAQLPVTPDVFIVPSELRYFVKG 550          
BLAST of DNA polymerase alpha subunit B vs. UniProt/SwissProt
Match: sp|O89043|DPOA2_RAT (DNA polymerase alpha subunit B OS=Rattus norvegicus OX=10116 GN=Pola2 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 9.740e-26
Identity = 82/294 (27.89%), Postives = 144/294 (48.98%), Query Frame = 1
Query:  745 QNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI-NVREISGDLQ---IVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENS------DKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEI-SKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            ++ SG ++P     + +   YS F G+ VI++G N T      + +   +   PLP     E  GD +   +++ CG      +   DPL  L+  I  +  DV I  GP +D      EN       + +  + L  + +      +HL+ VPS+ +     V+PQ  F+ S +LP  +   + F   P  +SI    FG+++ D+L H+  +EI S + ++ R  R+ +HIL + ++YPL PPH ++ ++   +    ++   P  P   I+PS+L  F+++I G  C+NPG
Sbjct:  277 EHSSGAQIPVD---VSELKDYSLFPGQVVIMEGFNTTGRRLTATKL---YEGVPLPFYQPTEEEGDFEQTMVLVACGPYTTSDSITYDPLLDLISTINHDRPDVCILFGPFLDAKHEQVENCKLTSPFEDIFKQCLRTVIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFTFS-ELPREDKKRVQFVSEPCNLSINGVMFGLTSTDLLFHIGAEEICSSSGTSDRFSRILKHILTQRSYYPLYPPHEDMAIDYENFY---TYAQLPVTPDVFIVPSELRYFVKDIFGCVCMNPG 560          
BLAST of DNA polymerase alpha subunit B vs. UniProt/SwissProt
Match: sp|Q14181|DPOA2_HUMAN (DNA polymerase alpha subunit B OS=Homo sapiens OX=9606 GN=POLA2 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 2.841e-25
Identity = 88/316 (27.85%), Postives = 145/316 (45.89%), Query Frame = 1
Query:  745 QNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI-NVREISGDLQ---IVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL--------NTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP-RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNISKPKTE 1638
            ++ SG ++P     + +   YS F G+ VI++G N T      + +   +   PLP     E   D +   +++ CG      +   DPL  L+  I  +  DV I  GP +D      EN   L     E + K C+           +HL+ VPS+ +     V+PQ  FS S  L   +   + F   P  +SI    FG+++ D+L HL  +EIS +  T  R  R+ +HIL + ++YPL PP  ++ ++   +         P   LIIPS+L  F++++ G  C+NP     G    ++ RL + +P  +
Sbjct:  277 EHSSGAQIPVD---LSELKEYSLFPGQVVIMEGINTTGRKLVATKL---YEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENC--LLTSPFEDIFKQCLRTIIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFSYS-DLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTP-DVLIIPSELRYFVKDVLGCVCVNPGRLTKGQVGGTFARLYLRRPAAD 582          
BLAST of DNA polymerase alpha subunit B vs. UniProt/SwissProt
Match: sp|P33611|DPOA2_MOUSE (DNA polymerase alpha subunit B OS=Mus musculus OX=10090 GN=Pola2 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 6.401e-24
Identity = 77/274 (28.10%), Postives = 131/274 (47.81%), Query Frame = 1
Query:  805 YSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI----NVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENS------DKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEI-SKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            YS F G+ VI++G N T      + +   +   PLP          S    +V+ CG      +   DPL  L+  I  +  DV I  GP +D      EN       + +  + L  + +      +HL+ VPS+ +     V+PQ  F+ S +L   +   + F   P  +SI    FG+++ D+L H+  +EI S + ++ R  R+ +HIL + ++YPL PPH ++ ++   +    ++   P  P   I+PS+L  F+++I G  C+NPG
Sbjct:  294 YSLFPGQVVIMEGFNTTGRRLTATKL---YEGVPLPFYQPTEEEGASEQTMVVVACGPYTTSDSITYDPLLDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTSPFEDVFKQCLRTVIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFTFS-ELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHIGAEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPPHEDMAIDYENFY---TYAQLPVTPDVFIVPSELRYFVKDIFGCVCVNPG 560          
BLAST of DNA polymerase alpha subunit B vs. UniProt/SwissProt
Match: sp|Q9VB62|DPOA2_DROME (DNA polymerase alpha subunit B OS=Drosophila melanogaster OX=7227 GN=DNApol-alpha73 PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 1.616e-21
Identity = 76/281 (27.05%), Postives = 131/281 (46.62%), Query Frame = 1
Query:  769 PCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRN--------DTADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPG 1587
            P  +L   +    S F G+ V+ KG  P    F V  +     +K  P    +I  +LQ V+  G   + ++   +PL  L++ +K +  DVL+ TGP +D +        +T D   +K+    +E      +  +T +++V S  +A  L V+P     P A    + +  ++  P+P++V +  +  G+++ D++ HL + E + N    R+ R   H+  + +FYPL PP  E     SQ   K +     P+ LI+PS    FI  +N    INPG
Sbjct:  305 PTLTLNFSRVKSASIFPGQVVLAKGFIPRGKTFMVEEI--HTERKLTPATPLQIDRELQFVVASGPFTDSTDLFYEPLHDLLKYLKDHRPDVLVLTGPFLDADHKMVGELAETFDTFFEKMIGGIME-----SIGSHTAVLVVTSQKDAMALSVYPT---PPPALRRTYPN--LYMLPDPSLVDLDGFTLGVTSTDVVDHLLSHEFAVNAGE-RMHRAINHLFHQGSFYPLYPPADEDMAYDSQLALKYAQLKQLPNVLILPSDQRHFIRLVNDCLVINPG 572          
BLAST of DNA polymerase alpha subunit B vs. UniProt/SwissProt
Match: sp|Q21625|DPOA2_CAEEL (DNA polymerase alpha subunit B OS=Caenorhabditis elegans OX=6239 GN=div-1 PE=3 SV=3)

HSP 1 Score: 95.1301 bits (235), Expect = 3.217e-19
Identity = 94/387 (24.29%), Postives = 166/387 (42.89%), Query Frame = 1
Query:  472 IHGKDVCESQLQMYNESLNDSSTKL--NFSDMVAVGNKYF---DEIYTCGRLTLDHTQTGMYDAEIFNSLQFDDEYHGTESVYNDFEKLTPKNIAIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRND------TADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELC---VFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP---RIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACIN 1581
            ++G D     ++   + + D + ++  +F ++V  GN      D +YT G++  D T+      E   +L  +DE  GT  +  DF K+T                        +  + F G+ + ++G N T     V  +   F    LP+N  E     +I   CG      N   + L  L+ ++ A   D+L+  GP VD+ +      T +   D L  + L  + +  V   T +II P  + + +LC   VFP + F  + +L      LI F  +P I  I   E  +++++ ++ LS  E  ++ +     R+ RL  H+L +   YPL P   E+  ++   ++ C  G+  PH +  P+KL    + +NG   IN
Sbjct:  189 LYGGDKSSMVIEAKAQRMADIAHRIQKSFEEIVDWGNPSIPSVDVVYTYGQVIHDETKDNEKFGEHSVALMINDE-DGT-MIRMDFSKMT------------------------EDITLFPGQIIAVRGTNETGEELQVDKI---FQPAALPVNPVETDTTKEIWFACGPYTATDNCGYEHLCELLDKVVAEKPDILMLAGPFVDKKNTFLNKPTFNITYDNLLEDLLLKVKETLVGTKTQVIIQP--NASRDLCVPPVFPSAPFQQNRKLDKIKKELI-FVADPCIFRISGVEVAMTSSEPIQALSNTEFHRSANQENIDRVARLSSHLLTQQCMYPLEP--TEVPASMGDLLDVCCIGST-PHIVFAPTKLAPSAKCVNGSVFIN 540          
BLAST of DNA polymerase alpha subunit B vs. TrEMBL
Match: A0A094ZPV9 (DNA polymerase alpha subunit B OS=Schistosoma haematobium OX=6185 GN=MS3_03324 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.540e-43
Identity = 105/276 (38.04%), Postives = 154/276 (55.80%), Query Frame = 1
Query:  802 CYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDP--LKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWE-----RLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPS--AQLPCFNSHL--IHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCS-TPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPGYA 1593
            CYS + G+ ++I+G NPT     V  +      KP  IN  +  G+L I++ CG    +SNSH DP  L  L+R +K +   VLI  GP VD      ++  +  +E     R+  ++++C  L+  LIIV S  E     V+P      S   + P  +S    + FAP+P +  IG Y FG+++ DIL+ LS +EIS  CS + RI RLC HILA ++FYP++PP   + ++   W +   F    PHCLI+PSKL  F++N++GV CINPGY 
Sbjct:  252 CYSVYSGQPLLIRGVNPTGHSLGVMEIFQIPISKPPFINPDKCLGNLHIMVACGPYT-LSNSH-DPTGLFNLLRSVKQSKPHVLILLGPFVDSEHPGIQSYSETTYEELFQSRVNSVSEWCSHLSIRLIIVSSWRELHHDPVYPTPPIDKSWIEKTPHLSSSYEKVQFAPDPCLFQIGEYVFGLTSVDILKDLSCEEISAGCSGSDRITRLCRHILASSSFYPVHPPDDGLPLDYPLWSQYAQFSVT-PHCLILPSKLRQFVKNVDGVLCINPGYV 524          
BLAST of DNA polymerase alpha subunit B vs. TrEMBL
Match: G4V9P8 (DNA polymerase alpha subunit B OS=Schistosoma mansoni OX=6183 GN=Smp_067260 PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 6.802e-43
Identity = 105/274 (38.32%), Postives = 154/274 (56.20%), Query Frame = 1
Query:  802 CYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDP--LKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWE-----RLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPS--AQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCS-TPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPGYA 1593
            CYS + G+ ++I+G NPT        +      KP  IN  + SG+L I++ CG    +SNSH DP  L  L+R +K     VLI  GP VD      ++  +  +E     R+  ++++C  L+  LII+ S  E     V+P      S   + P     +IHFAP+P +  IG Y FG+++ DIL+ LS +EIS  CS + RI RLC HILA ++FYP++PP   + ++   W +   F +  PHCLI+PSKL  F++N++GV CINPGY 
Sbjct:  296 CYSIYSGQPLLIRGVNPTGHSLGAMEIFQIPISKPPFINPDKCSGNLHIMVACGPYT-LSNSH-DPTGLFNLLRCVKQCKPHVLILLGPFVDSEHPGIQSYSETTYEELFQSRVNSVSEWCSHLSIRLIIISSWRELHHDPVYPTPPIDKSWIEKTPHL---VIHFAPDPCLFQIGEYVFGLTSVDILKDLSCEEISAGCSGSDRITRLCRHILASSSFYPVHPPDDGLPLDYPLWSQYAQF-SVTPHCLILPSKLRQFVKNVDGVLCINPGYV 563          
BLAST of DNA polymerase alpha subunit B vs. TrEMBL
Match: A0A4Z2DAJ4 (DNA polymerase alpha subunit B isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_002839 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.402e-42
Identity = 115/341 (33.72%), Postives = 173/341 (50.73%), Query Frame = 1
Query:  631 TGMYDAEIFNSLQFDDEYHGTESVYNDFEKLTPKNIAI-----QNYSGFEMPCQSLVID---QTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDP--LKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWE-----RLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAF--SPSAQLPCFNSHL--IHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCS-TPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPGYA 1593
            T      I  S +         SV     +L P N+A+        SG E     L +       CYS + G+ ++I+G NPT     V  +      KP  IN+ + S +L I++ CG    +SNSH DP  L  L+R +K +   VLI  GP VD      ++  +  +E     R+  ++++C  L+  LIIV S  E     V+P      S + + P   S    + FAP+P ++ I  Y FGI+T D+L+ LS +EIS  CS + RI RLC HI+A ++FYP++PP  ++ ++   W +   F    PHCLI+PSKL  F ++++GV CINPG+ 
Sbjct:  177 TAKLSVPIKGSTELSKVSENNRSVAETKIRLHPSNVALVGLRRAERSGSETDAVHLDLGFSRDLSCYSVYSGQPLLIRGVNPTGCSLGVMEIFQIPISKPPAINLDKCSANLHIMVACGPYT-LSNSH-DPTGLFNLLRSVKQSKPHVLILLGPFVDSEHPGIQSYSETTYEELFQSRVNSVSEWCSHLSIKLIIVSSWREVHHDPVYPTPPIDKSWTEKTPDLLSSYTNVQFAPDPCLIQIEEYVFGITTVDVLKDLSCEEISAGCSGSDRITRLCRHIIASSSFYPVHPPDDDLPLDYPLWSQYAQFSVT-PHCLILPSKLRQFTKDVDGVLCINPGFV 514          
BLAST of DNA polymerase alpha subunit B vs. TrEMBL
Match: A0A4Z2DAJ8 (DNA polymerase alpha subunit B OS=Schistosoma japonicum OX=6182 GN=EWB00_002839 PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.859e-42
Identity = 115/341 (33.72%), Postives = 173/341 (50.73%), Query Frame = 1
Query:  631 TGMYDAEIFNSLQFDDEYHGTESVYNDFEKLTPKNIAI-----QNYSGFEMPCQSLVID---QTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDP--LKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWE-----RLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAF--SPSAQLPCFNSHL--IHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCS-TPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPGYA 1593
            T      I  S +         SV     +L P N+A+        SG E     L +       CYS + G+ ++I+G NPT     V  +      KP  IN+ + S +L I++ CG    +SNSH DP  L  L+R +K +   VLI  GP VD      ++  +  +E     R+  ++++C  L+  LIIV S  E     V+P      S + + P   S    + FAP+P ++ I  Y FGI+T D+L+ LS +EIS  CS + RI RLC HI+A ++FYP++PP  ++ ++   W +   F    PHCLI+PSKL  F ++++GV CINPG+ 
Sbjct:  280 TAKLSVPIKGSTELSKVSENNRSVAETKIRLHPSNVALVGLRRAERSGSETDAVHLDLGFSRDLSCYSVYSGQPLLIRGVNPTGCSLGVMEIFQIPISKPPAINLDKCSANLHIMVACGPYT-LSNSH-DPTGLFNLLRSVKQSKPHVLILLGPFVDSEHPGIQSYSETTYEELFQSRVNSVSEWCSHLSIKLIIVSSWREVHHDPVYPTPPIDKSWTEKTPDLLSSYTNVQFAPDPCLIQIEEYVFGITTVDVLKDLSCEEISAGCSGSDRITRLCRHIIASSSFYPVHPPDDDLPLDYPLWSQYAQFSVT-PHCLILPSKLRQFTKDVDGVLCINPGFV 617          
BLAST of DNA polymerase alpha subunit B vs. TrEMBL
Match: A0A3Q0KH66 (DNA polymerase alpha subunit B OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.023e-42
Identity = 105/276 (38.04%), Postives = 153/276 (55.43%), Query Frame = 1
Query:  802 CYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDP--LKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWE-----RLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPS--AQLPCFNSHL--IHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCS-TPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPGYA 1593
            CYS + G+ ++I+G NPT        +      KP  IN  + SG+L I++ CG    +SNSH DP  L  L+R +K     VLI  GP VD      ++  +  +E     R+  ++++C  L+  LII+ S  E     V+P      S   + P   S    +HFAP+P +  IG Y FG+++ DIL+ LS +EIS  CS + RI RLC HILA ++FYP++PP   + ++   W +   F    PHCLI+PSKL  F++N++GV CINPGY 
Sbjct:  346 CYSIYSGQPLLIRGVNPTGHSLGAMEIFQIPISKPPFINPDKCSGNLHIMVACGPYT-LSNSH-DPTGLFNLLRCVKQCKPHVLILLGPFVDSEHPGIQSYSETTYEELFQSRVNSVSEWCSHLSIRLIIISSWRELHHDPVYPTPPIDKSWIEKTPHLLSSYEKVHFAPDPCLFQIGEYVFGLTSVDILKDLSCEEISAGCSGSDRITRLCRHILASSSFYPVHPPDDGLPLDYPLWSQYAQFSVT-PHCLILPSKLRQFVKNVDGVLCINPGYV 618          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Cavefish
Match: pola2 (polymerase (DNA directed), alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-778])

HSP 1 Score: 119.013 bits (297), Expect = 6.069e-28
Identity = 78/292 (26.71%), Postives = 142/292 (48.63%), Query Frame = 1
Query:  739 AIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSV-----LPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVD-RNDTADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSH-LIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            A Q +   ++P     + +   YS F G+ V+++G + +      S +     LP ++   L   + E S  + +++ CG      +   DPL  L+  I  +  DV I  GP VD +++  DE  + +  + ++ +          L+++PS  +     ++PQ  F+    LP       +  AP P  + IG    G+++ DIL H+  +EIS    + R  R+ +H+L + +FYPL PP  E++++  ++ +   +G  P  P  LI PS+L  FI+++ G  C+NPG
Sbjct:  275 ASQEHGARQVPVD---LSELKDYSLFPGQVVVMEGMSTSGSRLVASKLYEGVPLPFYSTSELKQEMNEGSEPVMVMVACGPYTPSDSLAYDPLIDLINIINKDRPDVCILLGPFVDSKHEAGDETFETIFHKCVDSVVDGTRGTGCKLVLIPSQRDVHHHYIYPQPPFT----LPDLKKDDRVTLAPEPCTLLIGGVTLGLTSTDILFHMGAEEISSATGSDRFSRIMKHMLTQRSFYPLYPPAEEVNMDYERFQQ---YGLLPLTPDVLIAPSELRYFIKDVIGCVCVNPG 556          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Cavefish
Match: pola2 (polymerase (DNA directed), alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-778])

HSP 1 Score: 112.464 bits (280), Expect = 7.352e-26
Identity = 82/306 (26.80%), Postives = 143/306 (46.73%), Query Frame = 1
Query:  739 AIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSV-----LPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVD-RNDTADENSDKLCW----ERLELLAKFCVD--------LNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNS---HLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINPG 1587
            A Q +   ++P     + +   YS F G+ V+++G + +      S +     LP ++   L   + E S  + +++ CG      +   DPL  L+  I  +  DV I  GP VD +++  +  S    +    E  E +   CVD            L+++PS  +     ++PQ  F+    LP         +  AP P  + IG    G+++ DIL H+  +EIS    + R  R+ +H+L + +FYPL PP  E++++  ++ +   +G  P  P  LI PS+L  FI+++ G  C+NPG
Sbjct:  256 ASQEHGARQVPVD---LSELKDYSLFPGQVVVMEGMSTSGSRLVASKLYEGVPLPFYSTSELKQEMNEGSEPVMVMVACGPYTPSDSLAYDPLIDLINIINKDRPDVCILLGPFVDSKHEQIEVFSFHFFYMAGDETFETIFHKCVDSVVDGTRGTGCKLVLIPSQRDVHHHYIYPQPPFT----LPDLKKDDVQRVTLAPEPCTLLIGGVTLGLTSTDILFHMGAEEISSATGSDRFSRIMKHMLTQRSFYPLYPPAEEVNMDYERFQQ---YGLLPLTPDVLIAPSELRYFIKDVIGCVCVNPG 551          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Sea Lamprey
Match: pola2 (polymerase (DNA directed), alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-778])

HSP 1 Score: 63.1586 bits (152), Expect = 7.595e-11
Identity = 59/232 (25.43%), Postives = 100/232 (43.10%), Query Frame = 1
Query:  718 KLTPKNIAIQN----YSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVRE------IS-GDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRND------TADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEI 1362
            KL  K++ +Q      +G   P   L + Q   +S F G+  ++ G NPT   F  S +   +   PLP    E      IS G + +++ CG  +   + + +PL  L+  I      V +  GP VD            E   +L    + LL +      + L+IVPS+ +    C++PQ  F+    L       + F   P  +++     G+++ DIL H+S++EI
Sbjct:  266 KLNAKSVLLQGDLDISAGLATP---LDLSQIPEFSLFPGQVAMLDGLNPTGKKFVASKL---YEAVPLPFYCPEPEEEENISDGSVTMLVACGPFSTSDSINYEPLCDLITVINRERPQVCLLMGPFVDAKHEHVEKCQLKETFAELFANTIRLLVERTQSSGSRLVIVPSLRDVHHCCIYPQPPFTRPDFLKDLQVRRVTFVSEPCTLNVNGVVVGVTSTDILFHMSSEEI 491          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005163.1 (pep scaffold:Pmarinus_7.0:GL481723:27885:30077:-1 gene:ENSPMAG00000004699.1 transcript:ENSPMAT00000005163.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 7.867e-6
Identity = 24/73 (32.88%), Postives = 36/73 (49.32%), Query Frame = 1
Query: 1423 NFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNISK 1626
            ++YPL PP  E++VN         F   P   LIIPS L  F++   G  CINP     G+   ++ R+ + +
Sbjct:    5 SYYPLYPPAEEMNVNYETAQVHARFPVTP-DVLIIPSDLRYFVKTACGCVCINPGRLTKGHVGGTFARIALGR 76          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Yeast
Match: POL12 (B subunit of DNA polymerase alpha-primase complex; required for initiation of DNA replication during mitotic and premeiotic DNA synthesis; also functions in telomere capping and length regulation [Source:SGD;Acc:S000000131])

HSP 1 Score: 68.9366 bits (167), Expect = 1.073e-12
Identity = 88/354 (24.86%), Postives = 147/354 (41.53%), Query Frame = 1
Query:  781 LVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPR-FTKKPLPIN--VREISGDLQ-----IVITCGLLANISNSHVDPLKRLMREI--KANPCDVLIFTGPVVD---------------RNDTADENSDKLCWERLELLAKFCVDLNTHL--IIVPSIDEA-TELCVFPQSAFSPSA-QLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTP---RIRRLCEHILAENNFYPLNPP------HPE------------------------IDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPGY------AKSSYCRLNISKPKTE 1638
            L + Q +  SFFLG+ V  KG+N     F V+S+LP  +   P+  +  ++E   +L+     +++TCG      N  ++ L+  +  I  +  P  VLI  GP +D               +  T  +  D+L    L+L       ++ H+  +++PS  +A +    +PQ++    A QLP  N   +    NP+   I    FG S  D  + L  +E+ K  +T    R+ R+ EHIL +  +YP+ P        P+                         D+++S        G   P  +IIPS+L  F   +  V  INPG        + SY ++ +  P  E
Sbjct:  332 LDLSQVNELSFFLGQIVAFKGKNANGDYFTVNSILPLPYPNSPVSTSQELQEFQANLEGSSLKVIVTCGPYFANDNFSLELLQEFIDSINNEVKP-HVLIMFGPFIDITHPLIASGKLPNFPQFKTQPKTLDELF---LKLFTPILKTISPHIQTVLIPSTKDAISNHAAYPQASLIRKALQLPKRNFKCM---ANPSSFQINEIYFGCSNVDTFKDL--KEVIKGGTTSSRYRLDRVSEHILQQRRYYPIFPGSIRTRIKPKDVSTKKETNDMESKEEKVYEHISGADLDVSYLGLTEFVGGFSPDIMIIPSELQHFARVVQNVVVINPGRFIRATGNRGSYAQITVQCPDLE 676          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Nematostella
Match: EDO41269 (DNA polymerase alpha subunit B [Source:UniProtKB/TrEMBL;Acc:A7S4W9])

HSP 1 Score: 113.62 bits (283), Expect = 1.474e-26
Identity = 82/292 (28.08%), Postives = 137/292 (46.92%), Query Frame = 1
Query:  805 YSFFLGENVIIKGQNPTDLGFFVSSV-----LPRFTKKPLPINVREISGD---LQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVD------RNDTADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEIS-KNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNI 1620
            ++ F G+ V  +G N T     V+ +     LP +    L  N   +S       +V+  G      +   +PL  L+R ++ N  D+LI  GP VD       N   DE  + L   +++L+ +      T ++  PS  +     VFPQ  F         +   IHF  +P  + +G    G+++ D+L +L ++E +    S+ R+ RL +HIL +++FYPLNPP+ E++V+  +     +   C P  L++PS L  F +NI G  C+NP     G    +Y R+ I
Sbjct:  296 FALFPGQVVAARGINSTGSKLVVNQLYEGVKLPFYAS--LDRNGENLSNSKDPFVVVVAAGPYTTSDSLMYEPLADLIRMVQKNKPDLLILLGPFVDSKHEKIENVDLDETFESLFKRQVDLITQATERQGTTVVFAPSQRDVHHDFVFPQPPFRKDTH--AMDHKNIHFVSDPCTLLVGNVTIGLTSTDVLLNLGSEETACPPGSSDRLGRLVKHILHQHSFYPLNPPNEEVNVDYERLSHHGTL-PCSPDLLVLPSDLRYFTKNILGSLCVNPGRLAKGQVGGTYARILI 582          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Medaka
Match: pola2 (DNA polymerase alpha 2, accessory subunit [Source:NCBI gene;Acc:101160173])

HSP 1 Score: 124.02 bits (310), Expect = 1.523e-29
Identity = 90/330 (27.27%), Postives = 154/330 (46.67%), Query Frame = 1
Query:  718 KLTPKNIAIQNYSGFEMPCQSLVIDQTDC--YSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI-------NVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVD--------LNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFN---SHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNISK 1626
            KL  +++ ++  +G E   Q + +D ++   YS F G+ V+++G N T      S +   +   PLP           E++  L +++ CG      +   DPL  L+  I  +  DV +  GP VD      E       E  E +   C++        +  HL+ VPS  +     ++PQ  F+    LP  +   S  I   P+P  + I    FG+++ DIL H+  +EIS    + R  R+ +H+L + ++YPL PP  E++++  ++    SF   P  P  LI+PS+L  FI+++ G  C+NP     G    +Y RL + +
Sbjct:  267 KLNAQSVLLE--AGPEHGGQQVAVDLSELKEYSLFPGQVVVMEGMNTTGKKLVASKI---YEGVPLPFYSSDIKTEADEVAEPLNVLVACGPYTPSDSLTFDPLLDLISVITRDRPDVCLMLGPFVDSRHEQIEKGQ--VTETFEGIFSRCIESIVDGTRSVGCHLVFVPSQRDVHHPLIYPQPPFT----LPHLSKNQSQRITLVPDPCTLLIDGVTFGLTSTDILFHMGAEEISNGSGSDRFSRILKHMLVQRSYYPLYPPAEEVNMDYEKFQ---SFAQIPLIPDVLIVPSELRYFIKDVLGCVCLNPGRLTKGQVGGTYGRLLLQR 582          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Medaka
Match: pola2 (DNA polymerase alpha 2, accessory subunit [Source:NCBI gene;Acc:101160173])

HSP 1 Score: 124.02 bits (310), Expect = 1.523e-29
Identity = 90/330 (27.27%), Postives = 154/330 (46.67%), Query Frame = 1
Query:  718 KLTPKNIAIQNYSGFEMPCQSLVIDQTDC--YSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI-------NVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVD--------LNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFN---SHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNISK 1626
            KL  +++ ++  +G E   Q + +D ++   YS F G+ V+++G N T      S +   +   PLP           E++  L +++ CG      +   DPL  L+  I  +  DV +  GP VD      E       E  E +   C++        +  HL+ VPS  +     ++PQ  F+    LP  +   S  I   P+P  + I    FG+++ DIL H+  +EIS    + R  R+ +H+L + ++YPL PP  E++++  ++    SF   P  P  LI+PS+L  FI+++ G  C+NP     G    +Y RL + +
Sbjct:  267 KLNAQSVLLE--AGPEHGGQQVAVDLSELKEYSLFPGQVVVMEGMNTTGKKLVASKI---YEGVPLPFYSSDIKTEADEVAEPLNVLVACGPYTPSDSLTFDPLLDLISVITRDRPDVCLMLGPFVDSRHEQIEKGQ--VTETFEGIFSRCIESIVDGTRSVGCHLVFVPSQRDVHHPLIYPQPPFT----LPHLSKNQSQRITLVPDPCTLLIDGVTFGLTSTDILFHMGAEEISNGSGSDRFSRILKHMLVQRSYYPLYPPAEEVNMDYEKFQ---SFAQIPLIPDVLIVPSELRYFIKDVLGCVCLNPGRLTKGQVGGTYGRLLLQR 582          
BLAST of DNA polymerase alpha subunit B vs. Ensembl Medaka
Match: pola2 (DNA polymerase alpha 2, accessory subunit [Source:NCBI gene;Acc:101160173])

HSP 1 Score: 103.99 bits (258), Expect = 4.633e-23
Identity = 87/330 (26.36%), Postives = 145/330 (43.94%), Query Frame = 1
Query:  718 KLTPKNIAIQNYSGFEMPCQSLVIDQTDC--YSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPI-------NVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVD--------LNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFN---SHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCP--PHCLIIPSKLNSFIENINGVACINP-----GYAKSSYCRLNISK 1626
            KL  +++ ++  +G E   Q + +D ++   YS F G+ V+++G N T      S +   +   PLP           E++  L +++ CG      +   DPL  L+  I  +  DV +  GP VD      E       E  E +   C++        +  HL+ VPS  +     ++PQ  F+    LP  +   S  I   P+P  + I    FG+++ DIL H+  +EIS                   N+YPL PP  E++++  ++    SF   P  P  LI+PS+L  FI+++ G  C+NP     G    +Y RL + +
Sbjct:  267 KLNAQSVLLE--AGPEHGGQQVAVDLSELKEYSLFPGQVVVMEGMNTTGKKLVASKI---YEGVPLPFYSSDIKTEADEVAEPLNVLVACGPYTPSDSLTFDPLLDLISVITRDRPDVCLMLGPFVDSRHEQIEKGQ--VTETFEGIFSRCIESIVDGTRSVGCHLVFVPSQRDVHHPLIYPQPPFT----LPHLSKNQSQRITLVPDPCTLLIDGVTFGLTSTDILFHMGAEEIS-------------------NYYPLYPPAEEVNMDYEKFQ---SFAQIPLIPDVLIVPSELRYFIKDVLGCVCLNPGRLTKGQVGGTYGRLLLQR 563          
BLAST of DNA polymerase alpha subunit B vs. Planmine SMEST
Match: SMESG000051238.1 (SMESG000051238.1)

HSP 1 Score: 1095.88 bits (2833), Expect = 0.000e+0
Identity = 531/536 (99.07%), Postives = 534/536 (99.63%), Query Frame = 1
Query:   31 MEDNVQSILHQFDKEVEDEYLLDKIESIRAFKNVTHSEIAHSLLAFMARENCKSTLNFDIINLFEKEINIKSNTLSSRNKPDKKIIHTDTSFFGEYINDENVNILFETPKSLLPIREKNCFNINLHTENFRPTLMFQKNTDIYQAEDIHGKDVCESQLQMYNESLNDSSTKLNFSDMVAVGNKYFDEIYTCGRLTLDHTQTGMYDAEIFNSLQFDDEYHGTESVYNDFEKLTPKNIAIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIPSKLNSFIENINGVACINPGYAKSSYCRLNISKPKTE 1638
            MEDNVQSILHQFDKEVEDEYLLDKIESIRAFKNVTHSEIAHSLLAFMARENCKSTLNFDIINLFEKEINIKSNTLSSRNKPDKKIIHTDTSFFGEYINDENVNILFETPKSLLPIREKNCFNINLHTENFRPTLMFQKNTDIYQAEDIHGKDVCESQLQMYNESLND+STKLNFSDMVAVGNKYFDEIYTCGRLTLDHTQTGMYDAEIFNSLQFDDEYHG ESVYNDFEKLTPKNIAIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDL+THLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQW+EKCSFGT PPHCLIIPSKLNSFIENINGVACINPGYAKSSYCRLNISKPKTE
Sbjct:    1 MEDNVQSILHQFDKEVEDEYLLDKIESIRAFKNVTHSEIAHSLLAFMARENCKSTLNFDIINLFEKEINIKSNTLSSRNKPDKKIIHTDTSFFGEYINDENVNILFETPKSLLPIREKNCFNINLHTENFRPTLMFQKNTDIYQAEDIHGKDVCESQLQMYNESLNDNSTKLNFSDMVAVGNKYFDEIYTCGRLTLDHTQTGMYDAEIFNSLQFDDEYHGAESVYNDFEKLTPKNIAIQNYSGFEMPCQSLVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREISGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRNDTADENSDKLCWERLELLAKFCVDLDTHLIIVPSIDEATELCVFPQSAFSPSAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCSTPRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWVEKCSFGTSPPHCLIIPSKLNSFIENINGVACINPGYAKSSYCRLNISKPKTE 536          
The following BLAST results are available for this feature:
BLAST of DNA polymerase alpha subunit B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
POLA25.916e-2627.85DNA polymerase alpha 2, accessory subunit [Source:... [more]
AP000944.58.982e-2128.17novel protein, POLA2-CDC42EP2 readthrough[more]
POLA21.562e-1829.72DNA polymerase alpha 2, accessory subunit [Source:... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
div-12.529e-2024.29DNA polymerase alpha subunit B [Source:UniProtKB/... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNApol-alpha731.612e-2227.05gene:FBgn0005696 transcript:FBtr0114543[more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pola21.403e-2726.92polymerase (DNA directed), alpha 2 [Source:ZFIN;Ac... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfaip12.516e-2628.80TNF alpha induced protein 1 [Source:Xenbase;Acc:XB... [more]
tnfaip14.155e-2328.25TNF alpha induced protein 1 [Source:Xenbase;Acc:XB... [more]
tnfaip19.944e-2331.47TNF alpha induced protein 1 [Source:Xenbase;Acc:XB... [more]
tnfaip12.031e-2126.98TNF alpha induced protein 1 [Source:Xenbase;Acc:XB... [more]
tnfaip11.098e-2027.30TNF alpha induced protein 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pola29.150e-2528.10polymerase (DNA directed), alpha 2 [Source:MGI Sym... [more]
Pola23.293e-2027.00polymerase (DNA directed), alpha 2 [Source:MGI Sym... [more]
Pola24.636e-2026.89polymerase (DNA directed), alpha 2 [Source:MGI Sym... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O89043|DPOA2_RAT9.740e-2627.89DNA polymerase alpha subunit B OS=Rattus norvegicu... [more]
sp|Q14181|DPOA2_HUMAN2.841e-2527.85DNA polymerase alpha subunit B OS=Homo sapiens OX=... [more]
sp|P33611|DPOA2_MOUSE6.401e-2428.10DNA polymerase alpha subunit B OS=Mus musculus OX=... [more]
sp|Q9VB62|DPOA2_DROME1.616e-2127.05DNA polymerase alpha subunit B OS=Drosophila melan... [more]
sp|Q21625|DPOA2_CAEEL3.217e-1924.29DNA polymerase alpha subunit B OS=Caenorhabditis e... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZPV94.540e-4338.04DNA polymerase alpha subunit B OS=Schistosoma haem... [more]
G4V9P86.802e-4338.32DNA polymerase alpha subunit B OS=Schistosoma mans... [more]
A0A4Z2DAJ41.402e-4233.72DNA polymerase alpha subunit B isoform 2 OS=Schist... [more]
A0A4Z2DAJ82.859e-4233.72DNA polymerase alpha subunit B OS=Schistosoma japo... [more]
A0A3Q0KH664.023e-4238.04DNA polymerase alpha subunit B OS=Schistosoma mans... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pola26.069e-2826.71polymerase (DNA directed), alpha 2 [Source:ZFIN;Ac... [more]
pola27.352e-2626.80polymerase (DNA directed), alpha 2 [Source:ZFIN;Ac... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pola27.595e-1125.43polymerase (DNA directed), alpha 2 [Source:ZFIN;Ac... [more]
ENSPMAT00000005163.17.867e-632.88pep scaffold:Pmarinus_7.0:GL481723:27885:30077:-1 ... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
POL121.073e-1224.86B subunit of DNA polymerase alpha-primase complex;... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO412691.474e-2628.08DNA polymerase alpha subunit B [Source:UniProtKB/... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pola21.523e-2927.27DNA polymerase alpha 2, accessory subunit [Source:... [more]
pola21.523e-2927.27DNA polymerase alpha 2, accessory subunit [Source:... [more]
pola24.633e-2326.36DNA polymerase alpha 2, accessory subunit [Source:... [more]
back to top
BLAST of DNA polymerase alpha subunit B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051238.10.000e+099.07SMESG000051238.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009491 ID=SMED30009491|Name=DNA polymerase alpha subunit B|organism=Schmidtea mediterranea sexual|type=transcript|length=1697bp
ATACATTACGTTAATTTAAATTAATTGCAAATGGAAGATAATGTACAATC
CATTTTACATCAATTTGACAAGGAAGTAGAAGATGAATATTTATTGGATA
AAATCGAGAGTATAAGGGCATTTAAGAATGTTACACATTCTGAAATTGCT
CATTCCTTGCTAGCATTTATGGCACGTGAAAATTGCAAATCTACATTGAA
TTTTGATATAATTAATCTTTTTGAGAAGGAAATTAATATTAAATCTAATA
CACTATCAAGTCGAAATAAACCTGATAAAAAAATAATACATACTGACACA
AGTTTTTTCGGGGAATATATTAATGATGAAAATGTAAATATTTTGTTCGA
AACTCCTAAAAGTTTACTACCAATTCGAGAAAAGAATTGCTTCAACATCA
ATTTACATACAGAAAATTTTAGACCTACGTTGATGTTTCAAAAAAATACT
GATATTTATCAAGCCGAAGACATTCACGGTAAAGATGTATGTGAATCCCA
ATTACAAATGTACAATGAATCATTAAACGATAGTTCCACTAAGTTAAACT
TTTCCGATATGGTGGCCGTTGGAAATAAATATTTCGATGAAATTTACACA
TGCGGTAGATTGACTTTGGACCATACACAAACTGGAATGTACGATGCAGA
GATTTTCAACTCGTTACAATTTGATGATGAATATCACGGTACCGAATCGG
TTTATAATGATTTTGAGAAATTGACCCCGAAAAATATCGCCATTCAAAAC
TATTCCGGGTTTGAAATGCCCTGCCAATCGCTCGTGATCGATCAAACCGA
TTGTTATTCGTTCTTTCTCGGGGAGAATGTCATTATTAAGGGCCAAAATC
CGACAGATTTGGGATTTTTCGTTTCATCTGTTCTTCCGAGATTCACCAAA
AAGCCGCTACCGATAAATGTTCGAGAGATTTCAGGAGATTTGCAAATCGT
CATAACGTGCGGATTGTTAGCTAACATATCGAATAGCCACGTTGATCCGC
TGAAGCGACTGATGCGAGAAATTAAAGCCAATCCTTGCGACGTTTTGATA
TTTACTGGCCCTGTAGTAGACAGAAATGACACTGCAGATGAGAATAGCGA
TAAATTGTGTTGGGAGAGATTAGAATTACTGGCGAAATTCTGCGTAGATT
TGAATACGCATTTGATTATTGTACCTTCGATTGATGAAGCCACTGAGTTG
TGTGTGTTTCCACAGTCAGCATTCTCTCCCTCAGCGCAATTGCCATGTTT
CAATAGCCACTTAATTCATTTTGCACCAAATCCTGCTATTGTTAGCATTG
GACCTTACGAATTCGGTATTTCCACTGCCGACATATTGCGGCATTTGAGC
ACTCAGGAGATAAGCAAGAATTGTTCCACGCCACGAATAAGAAGGCTATG
TGAACATATACTGGCGGAAAATAATTTCTACCCGTTGAACCCGCCCCATC
CAGAAATTGATGTCAATTTGTCACAGTGGATGGAAAAATGCTCTTTTGGC
ACTTGTCCACCACATTGCTTGATTATTCCATCCAAATTGAATAGCTTTAT
AGAAAATATCAACGGAGTGGCTTGCATTAACCCCGGATACGCTAAATCAA
GTTATTGCAGATTGAACATATCCAAACCCAAAACAGAATCGATCGATAGC
ATTATAGATATATCTCAATGTAGCTTTTCAATTTTAAAATAAACATA
back to top

protein sequence of SMED30009491-orf-1

>SMED30009491-orf-1 ID=SMED30009491-orf-1|Name=SMED30009491-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=554bp
MEDNVQSILHQFDKEVEDEYLLDKIESIRAFKNVTHSEIAHSLLAFMARE
NCKSTLNFDIINLFEKEINIKSNTLSSRNKPDKKIIHTDTSFFGEYINDE
NVNILFETPKSLLPIREKNCFNINLHTENFRPTLMFQKNTDIYQAEDIHG
KDVCESQLQMYNESLNDSSTKLNFSDMVAVGNKYFDEIYTCGRLTLDHTQ
TGMYDAEIFNSLQFDDEYHGTESVYNDFEKLTPKNIAIQNYSGFEMPCQS
LVIDQTDCYSFFLGENVIIKGQNPTDLGFFVSSVLPRFTKKPLPINVREI
SGDLQIVITCGLLANISNSHVDPLKRLMREIKANPCDVLIFTGPVVDRND
TADENSDKLCWERLELLAKFCVDLNTHLIIVPSIDEATELCVFPQSAFSP
SAQLPCFNSHLIHFAPNPAIVSIGPYEFGISTADILRHLSTQEISKNCST
PRIRRLCEHILAENNFYPLNPPHPEIDVNLSQWMEKCSFGTCPPHCLIIP
SKLNSFIENINGVACINPGYAKSSYCRLNISKPKTESIDSIIDISQCSFS
ILK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR016722DNA_pol_alpha_bsu
IPR007185DNA_pol_a/d/e_bsu
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003887DNA-directed DNA polymerase activity
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0071897DNA biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.60.21.60coord: 294..450
e-value: 1.7E-15
score: 58.7
IPR007185DNA polymerase alpha/delta/epsilon, subunit BPFAMPF04042DNA_pol_E_Bcoord: 306..507
e-value: 3.7E-21
score: 75.5
IPR016722DNA polymerase alpha, subunit BPANTHERPTHR23061DNA POLYMERASE 2 ALPHA 70 KDA SUBUNITcoord: 154..538