Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30009489
Length (bp)1945
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30009489) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30009489) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009489

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30009489SMESG000027520.1 dd_Smed_v4_12207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009489SMESG000027520.1 dd_Smed_v4_12207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009489SMESG000027520.1 dd_Smed_v4_12539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009489SMESG000027520.1 dd_Smed_v4_12539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30009489SMESG000027520.1 dd_Smed_v6_12207_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30009489SMESG000027520.1 dd_Smed_v6_12539_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009489SMESG000027520.1 OX_Smed_1.0.09597ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 482.256 bits (1240), Expect = 4.403e-163
Identity = 257/539 (47.68%), Postives = 338/539 (62.71%), Query Frame = 3
Query:  306 DSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNE------QNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            D Q   DW + + I  +  RVG GEQG    +T  + E+  Q    NG+N   SDKIS++RS+ D+R   C   +Y   LP  SIIIPFHNE WS+LLRTVHS+L+RSP +LV EI+LVDD S +E L + LE Y++  F  VRILRT KREGLIR R+LGA+ A G V+ F+DSHCE  +NWLPPLL  I  + KTI CP IDVI ++DF    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V   G  LARN KR+AEVWMD++ +YIYQ+  + Y  L  GD+  QKKLR +LNC SF WFM +IA+DL + YP   +P   + G+I++ +   LC D   G  G P R+  C     E      Q   FTW  +I+P      +  C D       +T++ CH M GNQ W Y ++   + H VS  C+D   +   + +N    S  L+Q+W+ E+ N+ +
Sbjct:   67 DGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMT--DAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPE-YRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYP-PVEPPAAAWGEIRN-VGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDK-TLYHPVSGSCMDCSESDHRIFMNTCNPS-SLTQQWLFEHTNSTV 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 477.248 bits (1227), Expect = 2.109e-161
Identity = 252/541 (46.58%), Postives = 342/541 (63.22%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT------DVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSR-KLSQKWILENMNAMI 1886
            +D   + DW ++++I +E  R G GE G    LT  +++ +      NG+N   S+ I++ RS+ D+R   CK   Y   LP  SIIIPFHNE W++LLRT+HSI++R+P  L+ EIILVDD S +E L +KLE+Y++  F+KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCEV +NWLPPLL  I  ++KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M DVPCSRVGH+YRK+ P+ V   G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GD++ QK+LRK L C  F WFM  +A+D+ + YP   +P   + G+I++ +  +LC D   G  G   R+  C         S+EQ   F W  +I+P      R  C D       +T++ CHGM GNQ W Y ++   + H VS  C+D   NP   +I + +C     +Q+WI E++N  +
Sbjct:   44 TDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSA--YRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYKVPS-GTSLARNLKRVAETWMDEFAEYIYQRRPE-YRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYP-PVEPPPAAWGEIRN-VAANLCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKD-RTLFHPVSNSCMD--CNPAEKKIFMARCDPLSETQQWIFEHINMTV 574          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 477.633 bits (1228), Expect = 2.551e-161
Identity = 252/541 (46.58%), Postives = 342/541 (63.22%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT------DVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSR-KLSQKWILENMNAMI 1886
            +D   + DW ++++I +E  R G GE G    LT  +++ +      NG+N   S+ I++ RS+ D+R   CK   Y   LP  SIIIPFHNE W++LLRT+HSI++R+P  L+ EIILVDD S +E L +KLE+Y++  F+KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCEV +NWLPPLL  I  ++KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M DVPCSRVGH+YRK+ P+ V   G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GD++ QK+LRK L C  F WFM  +A+D+ + YP   +P   + G+I++ +  +LC D   G  G   R+  C         S+EQ   F W  +I+P      R  C D       +T++ CHGM GNQ W Y ++   + H VS  C+D   NP   +I + +C     +Q+WI E++N  +
Sbjct:   61 TDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSA--YRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYKVPS-GTSLARNLKRVAETWMDEFAEYIYQRRPE-YRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYP-PVEPPPAAWGEIRN-VAANLCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKD-RTLFHPVSNSCMD--CNPAEKKIFMARCDPLSETQQWIFEHINMTV 591          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 388.267 bits (996), Expect = 3.231e-127
Identity = 206/510 (40.39%), Postives = 302/510 (59.22%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R+  CK   Y + LP  S++I FHNE WSTLLRTV+S+++RSP  L+ E+ILVDD S ++FL   LE YV      V+I+R  +R GLIRARL GA  + G V+ F+D+HCE  + WL PLL  I++  KT+ CP IDVIS + F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G+ + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+ L C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +   I NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ W Y+     + HV S +C+D     + +   +Q CS   SQ+W+L NM 
Sbjct:   56 GPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVV-KVDYGDVSVRKTLRENLKCKPFSWYLENI-------YPDSQIPRRYYSLGEIRN-VETNQCLD-NMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 375.555 bits (963), Expect = 4.351e-124
Identity = 198/415 (47.71%), Postives = 263/415 (63.37%), Query Frame = 3
Query:  681 EFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT------DVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSR-KLSQKWILENMNAMI 1886
            E L +KLE+Y++  F+KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCEV +NWLPPLL  I  ++KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M DVPCSRVGH+YRK+ P+ V   G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GD++ QK+LRK L C  F WFM  +A+D+ + YP   +P   + G+I++ +  +LC D   G  G   R+  C         S+EQ   F W  +I+P      R  C D       +T++ CHGM GNQ W Y ++   + H VS  C+D   NP   +I + +C     +Q+WI E++N  +
Sbjct:    1 EHLKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYKVPS-GTSLARNLKRVAETWMDEFAEYIYQRRPE-YRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYP-PVEPPPAAWGEIRN-VAANLCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKD-RTLFHPVSNSCMD--CNPAEKKIFMARCDPLSETQQWIFEHINMTV 407          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 490.73 bits (1262), Expect = 1.248e-166
Identity = 253/532 (47.56%), Postives = 346/532 (65.04%), Query Frame = 3
Query:  318 KIDWANHDTIDEENARVGPGEQGIGVYLTANEN--EKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK--VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT----DVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEE--LTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMN 1877
            KI W +    ++E  R GPGE G  V L  ++   ++A  L + NGYNA  SD IS++RSIKD+R  +CK + Y   LP  S+I PFH EH STLLR+V+S+++RSP +L+KEIILVDD S K  L + LE ++ ++     V++LRT KREGLIR R LGA +A G +LIF+D+H E   NWLPPLL PI + Y+T+ CPF+DVI    + +RPQDEG RG+FDW F+YKRLP   KD   P KPF +P+MAGG FAIS  WF ELGGYD GLD+WGGEQYELSFKVW C G+MVD PCSRV H+YR K+ PF   G+G++++RN+KR+AEVWMDD+K+ +Y KH+    + D GDL   K +R+ L C SFDWFMK+IA+D  + YP   +P+  ++G+I++ +  + C D         F +  CT    D   EQ+L  T   +I+P+ R IC D     ++  + +F CH M GNQ + Y     QI H +S +C+    N +   ++++KC S    QKW  + ++
Sbjct:   79 KIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLY-KHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAV-EPKASAEGEIRN-VGTNFCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGF-LHMKKCDSSSDLQKWAWQTVD 606          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 491.5 bits (1264), Expect = 9.966e-166
Identity = 253/532 (47.56%), Postives = 346/532 (65.04%), Query Frame = 3
Query:  318 KIDWANHDTIDEENARVGPGEQGIGVYLTANEN--EKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK--VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT----DVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEE--LTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMN 1877
            KI W +    ++E  R GPGE G  V L  ++   ++A  L + NGYNA  SD IS++RSIKD+R  +CK + Y   LP  S+I PFH EH STLLR+V+S+++RSP +L+KEIILVDD S K  L + LE ++ ++     V++LRT KREGLIR R LGA +A G +LIF+D+H E   NWLPPLL PI + Y+T+ CPF+DVI    + +RPQDEG RG+FDW F+YKRLP   KD   P KPF +P+MAGG FAIS  WF ELGGYD GLD+WGGEQYELSFKVW C G+MVD PCSRV H+YR K+ PF   G+G++++RN+KR+AEVWMDD+K+ +Y KH+    + D GDL   K +R+ L C SFDWFMK+IA+D  + YP   +P+  ++G+I++ +  + C D         F +  CT    D   EQ+L  T   +I+P+ R IC D     ++  + +F CH M GNQ + Y     QI H +S +C+    N +   ++++KC S    QKW  + ++
Sbjct:  160 KIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLY-KHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAV-EPKASAEGEIRN-VGTNFCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGF-LHMKKCDSSSDLQKWAWQTVD 687          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 369.777 bits (948), Expect = 1.337e-119
Identity = 212/509 (41.65%), Postives = 291/509 (57.17%), Query Frame = 3
Query:  336 HDTIDEENARVGPGEQGIGVY-----LTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDE--GGRGAFDWN--FDYKRLP-RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQP-ENLSQGKIK-SEINPHLCFDFNLGN--PGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEI 1820
            +D I ++      GE G  V      L+  E  K  + M  N +N  ASD ISVHR++      +CK  KY+  LP  S+II FHNE WS LLRTVHS+L R+PD L++E++LVDD S  +     LE+Y+S+   KV+ILR  KREGLIRARL GA  A G VL ++DSHCE    W+ PLL  I+    T+ CP IDVI  N F            G FDW   F++  +P R  K+   P  P  +P MAGGLF+I K +F +LG YD G D+WGGE  ELSFK+WMCGG +  VPCS VGHV+RK +P+      N L RN  R+AEVW+DD+K Y Y++        D GD++ +KKLR+ L C SF W++  I       YP    P E++++G+++ S + P  C D  +G      P     C      Q    + + EI+  + + C+DY   G ++ +F CHGM GNQ+W YN ++ ++ H VS+KC+    +   LE+
Sbjct:  100 NDPIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYKTYYYERINNQLG--DFGDISSRKKLREDLGCKSFKWYLDNI-------YPELFVPGESVAKGEVRNSAVQPARCLDCMVGRHEKNRPVGTYQCHGQGGNQYWMLSKDGEIR--RDESCVDY--AGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEM 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 369.777 bits (948), Expect = 1.337e-119
Identity = 212/509 (41.65%), Postives = 291/509 (57.17%), Query Frame = 3
Query:  336 HDTIDEENARVGPGEQGIGVY-----LTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDE--GGRGAFDWN--FDYKRLP-RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQP-ENLSQGKIK-SEINPHLCFDFNLGN--PGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEI 1820
            +D I ++      GE G  V      L+  E  K  + M  N +N  ASD ISVHR++      +CK  KY+  LP  S+II FHNE WS LLRTVHS+L R+PD L++E++LVDD S  +     LE+Y+S+   KV+ILR  KREGLIRARL GA  A G VL ++DSHCE    W+ PLL  I+    T+ CP IDVI  N F            G FDW   F++  +P R  K+   P  P  +P MAGGLF+I K +F +LG YD G D+WGGE  ELSFK+WMCGG +  VPCS VGHV+RK +P+      N L RN  R+AEVW+DD+K Y Y++        D GD++ +KKLR+ L C SF W++  I       YP    P E++++G+++ S + P  C D  +G      P     C      Q    + + EI+  + + C+DY   G ++ +F CHGM GNQ+W YN ++ ++ H VS+KC+    +   LE+
Sbjct:  100 NDPIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYKTYYYERINNQLG--DFGDISSRKKLREDLGCKSFKWYLDNI-------YPELFVPGESVAKGEVRNSAVQPARCLDCMVGRHEKNRPVGTYQCHGQGGNQYWMLSKDGEIR--RDESCVDY--AGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEM 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 369.777 bits (948), Expect = 1.337e-119
Identity = 212/509 (41.65%), Postives = 291/509 (57.17%), Query Frame = 3
Query:  336 HDTIDEENARVGPGEQGIGVY-----LTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDE--GGRGAFDWN--FDYKRLP-RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQP-ENLSQGKIK-SEINPHLCFDFNLGN--PGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEI 1820
            +D I ++      GE G  V      L+  E  K  + M  N +N  ASD ISVHR++      +CK  KY+  LP  S+II FHNE WS LLRTVHS+L R+PD L++E++LVDD S  +     LE+Y+S+   KV+ILR  KREGLIRARL GA  A G VL ++DSHCE    W+ PLL  I+    T+ CP IDVI  N F            G FDW   F++  +P R  K+   P  P  +P MAGGLF+I K +F +LG YD G D+WGGE  ELSFK+WMCGG +  VPCS VGHV+RK +P+      N L RN  R+AEVW+DD+K Y Y++        D GD++ +KKLR+ L C SF W++  I       YP    P E++++G+++ S + P  C D  +G      P     C      Q    + + EI+  + + C+DY   G ++ +F CHGM GNQ+W YN ++ ++ H VS+KC+    +   LE+
Sbjct:  100 NDPIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYKTYYYERINNQLG--DFGDISSRKKLREDLGCKSFKWYLDNI-------YPELFVPGESVAKGEVRNSAVQPARCLDCMVGRHEKNRPVGTYQCHGQGGNQYWMLSKDGEIR--RDESCVDY--AGSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEM 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072973)

HSP 1 Score: 465.692 bits (1197), Expect = 3.586e-156
Identity = 247/550 (44.91%), Postives = 353/550 (64.18%), Query Frame = 3
Query:  297 VSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLT-ANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTD-VSNEQNLAF---TWEMEIKPQKRDICLDYP--RKGEELTMFSCHGMGGNQKWIYNQNSHQIVH-VVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMNAMIANHLWKEIKL 1916
              +D+ +K DW ++  ++++  RVG GE G    L   ++ +  K++   NG+NAL SD ISV+RS+ D+R   C+  +Y   LP  S+II F+NE+ S L+R+VHS+++RSP +L+KEIILVDD+S +E+LG++LE Y++EHF  VR++R  +R GLI AR  GA  A   VLIF+DSH E   NWLPPLL+PI  + +T  CPFIDVI + +F  R QDEG RGAFDW F YKRLP L +D  HP  PF +PIMAGGLFAIS+ +F ELGGYD GLD+WGGEQYELSFK+WMCGG+M D PCSR+GH+YR   N       G+YL +N+KR+AEVWMD++K Y+Y     +Y S+DPGDLTEQK +R  LNC SF WFM+++A+DL++ YP    P + + G +++  N +LC D       +   +  C D +   Q   F   +W+ +++ +++  CLD         + ++ CH  GGNQ W Y+    Q+ H    ++C++    P S E+   KC +    Q+W   + N    ++  +++ L
Sbjct:  118 APADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYP-PVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELL--PFSQEVVANKCDTDNRFQQWNFGSFNKTALDNYSQDLVL 664          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0333442)

HSP 1 Score: 465.692 bits (1197), Expect = 3.586e-156
Identity = 247/550 (44.91%), Postives = 353/550 (64.18%), Query Frame = 3
Query:  297 VSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLT-ANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTD-VSNEQNLAF---TWEMEIKPQKRDICLDYP--RKGEELTMFSCHGMGGNQKWIYNQNSHQIVH-VVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMNAMIANHLWKEIKL 1916
              +D+ +K DW ++  ++++  RVG GE G    L   ++ +  K++   NG+NAL SD ISV+RS+ D+R   C+  +Y   LP  S+II F+NE+ S L+R+VHS+++RSP +L+KEIILVDD+S +E+LG++LE Y++EHF  VR++R  +R GLI AR  GA  A   VLIF+DSH E   NWLPPLL+PI  + +T  CPFIDVI + +F  R QDEG RGAFDW F YKRLP L +D  HP  PF +PIMAGGLFAIS+ +F ELGGYD GLD+WGGEQYELSFK+WMCGG+M D PCSR+GH+YR   N       G+YL +N+KR+AEVWMD++K Y+Y     +Y S+DPGDLTEQK +R  LNC SF WFM+++A+DL++ YP    P + + G +++  N +LC D       +   +  C D +   Q   F   +W+ +++ +++  CLD         + ++ CH  GGNQ W Y+    Q+ H    ++C++    P S E+   KC +    Q+W   + N    ++  +++ L
Sbjct:  118 APADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYP-PVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELL--PFSQEVVANKCDTDNRFQQWNFGSFNKTALDNYSQDLVL 664          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072972)

HSP 1 Score: 465.692 bits (1197), Expect = 3.586e-156
Identity = 247/550 (44.91%), Postives = 353/550 (64.18%), Query Frame = 3
Query:  297 VSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLT-ANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTD-VSNEQNLAF---TWEMEIKPQKRDICLDYP--RKGEELTMFSCHGMGGNQKWIYNQNSHQIVH-VVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMNAMIANHLWKEIKL 1916
              +D+ +K DW ++  ++++  RVG GE G    L   ++ +  K++   NG+NAL SD ISV+RS+ D+R   C+  +Y   LP  S+II F+NE+ S L+R+VHS+++RSP +L+KEIILVDD+S +E+LG++LE Y++EHF  VR++R  +R GLI AR  GA  A   VLIF+DSH E   NWLPPLL+PI  + +T  CPFIDVI + +F  R QDEG RGAFDW F YKRLP L +D  HP  PF +PIMAGGLFAIS+ +F ELGGYD GLD+WGGEQYELSFK+WMCGG+M D PCSR+GH+YR   N       G+YL +N+KR+AEVWMD++K Y+Y     +Y S+DPGDLTEQK +R  LNC SF WFM+++A+DL++ YP    P + + G +++  N +LC D       +   +  C D +   Q   F   +W+ +++ +++  CLD         + ++ CH  GGNQ W Y+    Q+ H    ++C++    P S E+   KC +    Q+W   + N    ++  +++ L
Sbjct:  118 APADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYP-PVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELL--PFSQEVVANKCDTDNRFQQWNFGSFNKTALDNYSQDLVL 664          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0333248)

HSP 1 Score: 426.402 bits (1095), Expect = 3.460e-141
Identity = 221/502 (44.02%), Postives = 319/502 (63.55%), Query Frame = 3
Query:  324 DWANHDTIDEENARVGPGEQGIGVYL-TANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK-VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFS-LRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLG-NPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKR-----DICLDYPRKGEELT--MFSCHGMGGNQKWIYNQNSHQIVHVV-SKKCID 1790
            DW ++  ++ +  R G GE G+ V +   +E +  K+  E NG+N L SD+ISV+RS+ DLR+  CK  KY   LP  S+I  F NEH++TLLR+++S+++R+P +L+K+I+LVDD S  + L + L+ YV +HF   V I+R  +R+GLI AR+ GA  A G V++F DSH EV  NWLPPL++PI  + K  +CP +D IS+ DFS      +G RG FDW   YK+LP L +D      P+ +P+M GGLFAI+  +F +LGGYD  LD+WGGEQYELSFK+WMCGG ++DVPCSRV H++R    P       N++A+NHKR+AEVWMD++KQY+Y++  K Y +LD GDLT Q+ +R+ L C SF WFM ++A D L K+P   +P + + G I++  NP  C D N+G +  +   + +C D          WE+ I    R      +CLD        T  M+SCH  GGNQ W Y++ + ++VH   +K+C++
Sbjct:  103 DWHDYAAMEADRKRSGFGEHGVAVKIENPDEKQLEKEHYEMNGFNGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFP-PVEPPSYAAGIIQNVANPVYCLD-NMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMKGFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVHGENNKRCLE 602          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0114524)

HSP 1 Score: 426.402 bits (1095), Expect = 3.460e-141
Identity = 221/502 (44.02%), Postives = 319/502 (63.55%), Query Frame = 3
Query:  324 DWANHDTIDEENARVGPGEQGIGVYL-TANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK-VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFS-LRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLG-NPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKR-----DICLDYPRKGEELT--MFSCHGMGGNQKWIYNQNSHQIVHVV-SKKCID 1790
            DW ++  ++ +  R G GE G+ V +   +E +  K+  E NG+N L SD+ISV+RS+ DLR+  CK  KY   LP  S+I  F NEH++TLLR+++S+++R+P +L+K+I+LVDD S  + L + L+ YV +HF   V I+R  +R+GLI AR+ GA  A G V++F DSH EV  NWLPPL++PI  + K  +CP +D IS+ DFS      +G RG FDW   YK+LP L +D      P+ +P+M GGLFAI+  +F +LGGYD  LD+WGGEQYELSFK+WMCGG ++DVPCSRV H++R    P       N++A+NHKR+AEVWMD++KQY+Y++  K Y +LD GDLT Q+ +R+ L C SF WFM ++A D L K+P   +P + + G I++  NP  C D N+G +  +   + +C D          WE+ I    R      +CLD        T  M+SCH  GGNQ W Y++ + ++VH   +K+C++
Sbjct:  103 DWHDYAAMEADRKRSGFGEHGVAVKIENPDEKQLEKEHYEMNGFNGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFP-PVEPPSYAAGIIQNVANPVYCLD-NMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMKGFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVHGENNKRCLE 602          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 473.396 bits (1217), Expect = 5.648e-160
Identity = 254/543 (46.78%), Postives = 340/543 (62.62%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDV------SNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKL-SQKWILENMNAMIAN 1892
            +D   + DW ++++I ++  RVG GE G    L   E+E    + + NG+N   S+ I++ RS+ D+R   CK   Y   LP  SIIIPFHNE WS+LLRT+HSI +R+PD L+ EIILVDD S +E L   L +Y+S  F KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCE  INWLPPLL  I  + KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +     P  P+ +P+MAGGLFA+++ WF ELGGYD GL++WGGEQ+E+SFKVWMCGG M DVPCSRVGH+YRK+ P+ V   G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GDLT QK+LRK L C  F W+M  +A+DL + YP   +P   + G+I++  +  LC D   G+ G   R+ NC         ++EQ   F W  +I+P      R  C D   +   +T++ CHGM GNQ W Y ++   + H+VS  C+D   +P    I + KC  K  +Q+WI + +NA + +
Sbjct:   60 TDGLRRRDWHDYESIRKDGQRVGKGEHGKPYPLV--EDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSR-FPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYKVPS-GTSLARNLKRVAETWMDEYTEYIYQRRPE-YRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYP-PVEPLPAAWGEIRNAAS-GLCVDSKHGSTGTELRLDNCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQNSPITLYDCHGMKGNQHWSYRKDK-SLYHLVSSGCMD--CSPNDKRIFMNKCDPKSETQQWIFQKVNATVLD 592          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 473.396 bits (1217), Expect = 5.648e-160
Identity = 254/543 (46.78%), Postives = 340/543 (62.62%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDV------SNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKL-SQKWILENMNAMIAN 1892
            +D   + DW ++++I ++  RVG GE G    L   E+E    + + NG+N   S+ I++ RS+ D+R   CK   Y   LP  SIIIPFHNE WS+LLRT+HSI +R+PD L+ EIILVDD S +E L   L +Y+S  F KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCE  INWLPPLL  I  + KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +     P  P+ +P+MAGGLFA+++ WF ELGGYD GL++WGGEQ+E+SFKVWMCGG M DVPCSRVGH+YRK+ P+ V   G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GDLT QK+LRK L C  F W+M  +A+DL + YP   +P   + G+I++  +  LC D   G+ G   R+ NC         ++EQ   F W  +I+P      R  C D   +   +T++ CHGM GNQ W Y ++   + H+VS  C+D   +P    I + KC  K  +Q+WI + +NA + +
Sbjct:   60 TDGLRRRDWHDYESIRKDGQRVGKGEHGKPYPLV--EDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSR-FPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYKVPS-GTSLARNLKRVAETWMDEYTEYIYQRRPE-YRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYP-PVEPLPAAWGEIRNAAS-GLCVDSKHGSTGTELRLDNCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQNSPITLYDCHGMKGNQHWSYRKDK-SLYHLVSSGCMD--CSPNDKRIFMNKCDPKSETQQWIFQKVNATVLD 592          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 392.504 bits (1007), Expect = 5.911e-129
Identity = 206/513 (40.16%), Postives = 303/513 (59.06%), Query Frame = 3
Query:  360 ARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            A   PGE G  V +   E +K K+L + N +N +ASD I+++RS+ D+R++ CK   Y + LP  SI+I FHNE WSTLLRTVHS ++RSP +L+ EI+LVDD S ++FL EKLE YV+     VRILR  +R GLIRARL GA    G V+ F+D+HCE    WL PL+  I++  + + CP IDVIS   F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P++   G G  + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR++L C  F W+++ +       YP  + P    S G+I++ +  + C D N+G    +     NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ + Y+     ++HV S +C+D     + +   ++ CS + SQ+WIL NM 
Sbjct:   53 AHEAPGEMGKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVV-RVDYGDVSSRKALRESLKCKPFSWYLENV-------YPDSQIPRRYYSLGEIRN-VETNQCVD-NMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTD--DLCLDASRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLKDCSGRRSQQWILRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 383.645 bits (984), Expect = 1.372e-125
Identity = 198/509 (38.90%), Postives = 301/509 (59.14%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            GPGE G  V +  ++ EK K++ + N +N +AS+ I+++RS+ D+R+  CK   Y + LP  S++I FHNE W+TLLRTVHS++ RSP  L++EI+LVDD S ++FL  +LE YV +    VR++R  +R GLIRARL GA+ + G V+ F+D+HCE    WL PLL  I+   KT+ CP IDVIS + F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G  + +N++R+AEVWMD++K + Y     V + +D GD++ +  LR+ L C  F W+++ +       YP  + P +  S G+I++ +  + C D       +   I NC  +   Q  ++T   EI+    D+CLD  +    + M  CH + GNQ W Y+     +VHV S +C+D     +S   +++ CS   SQ+W+L N+ 
Sbjct:   55 GPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGV-TKVDYGDISTRTSLRQRLQCKPFSWYLENV-------YPDSQIPRHYYSLGEIRN-VETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTD--DLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARSQQWLLRNVT 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 383.645 bits (984), Expect = 1.372e-125
Identity = 198/509 (38.90%), Postives = 301/509 (59.14%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            GPGE G  V +  ++ EK K++ + N +N +AS+ I+++RS+ D+R+  CK   Y + LP  S++I FHNE W+TLLRTVHS++ RSP  L++EI+LVDD S ++FL  +LE YV +    VR++R  +R GLIRARL GA+ + G V+ F+D+HCE    WL PLL  I+   KT+ CP IDVIS + F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G  + +N++R+AEVWMD++K + Y     V + +D GD++ +  LR+ L C  F W+++ +       YP  + P +  S G+I++ +  + C D       +   I NC  +   Q  ++T   EI+    D+CLD  +    + M  CH + GNQ W Y+     +VHV S +C+D     +S   +++ CS   SQ+W+L N+ 
Sbjct:   55 GPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGV-TKVDYGDISTRTSLRQRLQCKPFSWYLENV-------YPDSQIPRHYYSLGEIRN-VETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTD--DLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARSQQWLLRNVT 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 485.337 bits (1248), Expect = 2.148e-164
Identity = 254/541 (46.95%), Postives = 347/541 (64.14%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT------DVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSR-KLSQKWILENMNAMI 1886
            +D   + DW ++++I +E  R G GE G    LT  E E+   +   NG+N   S+KI++ RS+ D+R   CK   Y   LP  SIIIPFHNE W++LLRT+HS+++R+PD L++E+ILVDD S +E L EKLE+Y++ ++ KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCEV +NWLPPLL  I  ++KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +     P +PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYELSFKVWMCGG+M DVPCSRVGH+YRK+ P+  V  G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GD++ QK+LRK L C  F W+M ++A+D+ + YP   +P   S G+I++ +  +LC D   G  G   R+  C         S+EQ   F W  +I+P      R  C D       +T++ CHGM GNQ+W Y ++   + H V+  CID   NP   ++ + +C     +Q+WI E++N  I
Sbjct:   60 TDGLRRKDWHDYESIQKEALRSGKGEHGKPYPLT--EEEQDDTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPTGTSLARNLKRVAETWMDEYAEYIYQRRPE-YRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYP-PVEPPPASWGEIRN-VASNLCIDSKHGATGTELRLDTCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDSISHSSPVTLYDCHGMKGNQQWSYRKDK-TLFHPVTNSCID--CNPAEKKLFMNRCDPLSETQQWIFEHVNMTI 590          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 464.922 bits (1195), Expect = 2.066e-156
Identity = 250/552 (45.29%), Postives = 344/552 (62.32%), Query Frame = 3
Query:  270 KETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSN------EQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCS-RKLSQKWILENMNAMI 1886
            K   +++NE   +   K DW N++ I +E+ ++G GEQG    +T  + +   Q    NG+N   SDKIS++RS+ D+R + CK   Y + LP  S+IIPFHNE WS+LLRTVHS+L+RSP +L+ EI+LVDD S K  L  +LE+Y++ +F KV+I+RT KREGLIR R+LGA  A+G VL F+DSHCE  +NWLPPLL P+  +YKT+ CP IDVI  ++F    Q  +  RGAFDW   YKR+P   +     P  PF +P+MAGGLFAI++ WF +LGGYD GL++WGGEQYE+SFKVWMCGG+MVD PCSRVGH+YRK+ P+ V   G  LARN KR+AEVWMD++ +YIYQ+    Y  L  GD+  QK+LR+ L C  F WFM +IA+DL + YP  + P   + G+I++ +   +C        G   R+  C    N       Q     W  +I+P         C D   +   +T+F CHGM GNQ W Y ++   + H  S  C+D   N    +I + KC+    +Q+W  E++N+ I
Sbjct:   55 KPRDEKVNEKVPE---KKDWHNYEQIRKESEQIGNGEQGKPFPMT--DADHVDQAYRENGFNIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMA-NFPKVKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPD-YRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPP-AAWGEIRN-VRMDMCVGVKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTLFDCHGMKGNQLWKYRRDK-TVYHPTSNSCMD--CNEGEYKIFMNKCNPSSPTQQWTFEHINSTI 593          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 464.922 bits (1195), Expect = 2.066e-156
Identity = 250/552 (45.29%), Postives = 344/552 (62.32%), Query Frame = 3
Query:  270 KETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSN------EQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCS-RKLSQKWILENMNAMI 1886
            K   +++NE   +   K DW N++ I +E+ ++G GEQG    +T  + +   Q    NG+N   SDKIS++RS+ D+R + CK   Y + LP  S+IIPFHNE WS+LLRTVHS+L+RSP +L+ EI+LVDD S K  L  +LE+Y++ +F KV+I+RT KREGLIR R+LGA  A+G VL F+DSHCE  +NWLPPLL P+  +YKT+ CP IDVI  ++F    Q  +  RGAFDW   YKR+P   +     P  PF +P+MAGGLFAI++ WF +LGGYD GL++WGGEQYE+SFKVWMCGG+MVD PCSRVGH+YRK+ P+ V   G  LARN KR+AEVWMD++ +YIYQ+    Y  L  GD+  QK+LR+ L C  F WFM +IA+DL + YP  + P   + G+I++ +   +C        G   R+  C    N       Q     W  +I+P         C D   +   +T+F CHGM GNQ W Y ++   + H  S  C+D   N    +I + KC+    +Q+W  E++N+ I
Sbjct:   55 KPRDEKVNEKVPE---KKDWHNYEQIRKESEQIGNGEQGKPFPMT--DADHVDQAYRENGFNIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMA-NFPKVKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPD-YRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPP-AAWGEIRN-VRMDMCVGVKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTLFDCHGMKGNQLWKYRRDK-TVYHPTSNSCMD--CNEGEYKIFMNKCNPSSPTQQWTFEHINSTI 593          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 462.996 bits (1190), Expect = 3.095e-156
Identity = 246/535 (45.98%), Postives = 334/535 (62.43%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSR-KLSQKWILENMNAMI 1886
            +D   + DW ++++I +E  R G GE G    LT  E E+   +   NG+N   S+KI++ RS+ D+R   CK   Y   LP  SIIIPFHNE W++LLRT+HS+++R+PD L++E+ILVDD S +E L EKLE+Y++ ++ KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCEV +NWLPPLL  I  ++KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +     P +PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYELSFKVWMCGG+M DVPCSRVGH+YRK+ P+  V  G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GD++ QK+LRK L C  F W+M ++A+D+ + YP   +P   S G++K                       NC          F W  +I+P      R  C D       +T++ CHGM GNQ+W Y ++   + H V+  CID   NP   ++ + +C     +Q+WI E++N  I
Sbjct:   60 TDGLRRKDWHDYESIQKEALRSGKGEHGKPYPLT--EEEQDDTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPTGTSLARNLKRVAETWMDEYAEYIYQRRPE-YRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYP-PVEPPPASWGEVK----------------------INCL-------FTFGWREDIRPGEPLHTRKFCFDSISHSSPVTLYDCHGMKGNQQWSYRKDK-TLFHPVTNSCID--CNPAEKKLFMNRCDPLSETQQWIFEHVNMTI 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 444.121 bits (1141), Expect = 5.093e-149
Identity = 232/487 (47.64%), Postives = 309/487 (63.45%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQ 1745
            +D   + DW ++++I +E  R G GE G    LT  E E+   +   NG+N   S+KI++ RS+ D+R   CK   Y   LP  SIIIPFHNE W++LLRT+HS+++R+PD L++E+ILVDD S +E L EKLE+Y++ ++ KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCEV +NWLPPLL  I  ++KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +     P +PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYELSFKVWMCGG+M DVPCSRVGH+YRK+ P+  V  G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GD++ QK+LRK L C  F W+M ++A+D+ + YP   +P   S G++K                       NC          F W  +I+P      R  C D       +T++ CHGM GNQ+W Y +
Sbjct:   60 TDGLRRKDWHDYESIQKEALRSGKGEHGKPYPLT--EEEQDDTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPTGTSLARNLKRVAETWMDEYAEYIYQRRPE-YRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYP-PVEPPPASWGEVK----------------------INCL-------FTFGWREDIRPGEPLHTRKFCFDSISHSSPVTLYDCHGMKGNQQWSYRK 511          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:MGI Symbol;Acc:MGI:1890480])

HSP 1 Score: 484.567 bits (1246), Expect = 3.079e-164
Identity = 257/533 (48.22%), Postives = 336/533 (63.04%), Query Frame = 3
Query:  324 DWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNE------QNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            DW N + I  +  RVG GEQG    +T  + E+  Q    NG+N   SDKIS++RS+ D+R   C    Y   LP  SIIIPFHNE WS+LLRTVHS+L+RSP +LV EI+LVDD S +E L + LE Y++  F  VRILRT KREGLIR R+LGA+ A G V+ F+DSHCE  +NWLPPLL  I  + KTI CP IDVI ++DF    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V   G  LARN KR+AEVWMD++ +YIYQ+  + Y  L  GD+  QKKLR +LNC SF WFM +IA+DL + YP   +P   + G+I++ +   LC D  LG  G P R+  C     E      Q   FTW  +I+P      +  C D       +T++ CH M GNQ W Y ++   + H VS  C+D   +   + +N    S  L+Q+W+ E+ N+ +
Sbjct:   73 DWHNKEAIRRDAQRVGYGEQGKPYPMT--DAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPE-YRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYP-PVEPPAAAWGEIRN-VGTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDK-TLYHPVSGSCMDCSESDHRVFMNTCNPS-SLTQQWLFEHTNSTV 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galntl6 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6 [Source:MGI Symbol;Acc:MGI:1913581])

HSP 1 Score: 479.559 bits (1233), Expect = 2.417e-162
Identity = 254/541 (46.95%), Postives = 341/541 (63.03%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT------DVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCS-RKLSQKWILENMNAMI 1886
            +D   + DW ++++I  +  R G GE G    LT  E ++       NG+N   S+ I++ RS+ D+R   CK   Y   LP  SIIIPFHNE W++LLRT+HSI++R+P+ L+ EIILVDD S +E L +KLE Y++  F+KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCEV +NWLPPLL  I  ++KTI CP IDVI +N F    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M DVPCSRVGH+YRK+ P+ V   G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GD++ QK+LRK L C  F WFM  +A+D+ + YP   +P   + G+I+S +  +LC D   G  G   R+  C         S+EQ   F W  +I+P      R  CLD       +T++ CHGM GNQ W Y ++   + H VS  C+D   NP   +I + +C     +Q+WI E++N  +
Sbjct:   61 TDGLRRKDWHDYESIQRDALRSGKGEHGKPYPLT--EEDRDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDDFSDREHLKDKLEDYMAR-FSKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYKVPS-GTSLARNLKRVAETWMDEFAEYIYQRRPE-YRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYP-PVEPLPAAWGEIRS-VAANLCVDSKHGATGTELRLDVCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISHSSPVTLYDCHGMKGNQLWGYRED-RTLFHPVSNSCMD--CNPSEKKIFMARCDPLSETQQWIFEHINMTV 591          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 387.497 bits (994), Expect = 5.300e-127
Identity = 205/510 (40.20%), Postives = 301/510 (59.02%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R+  CK   Y + LP  S++I FHNE WSTLLRTV+S+++RSP  L+ E+ILVDD S ++FL   LE YV      V+I+R  +R GLIRARL GA  + G V+ F+D+HCE  + WL PLL  I++  KT+ CP IDVIS + F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G+ + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+ L C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +   I NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ W Y+     + H  S +C+D     + +   +Q CS   SQ+W+L NM 
Sbjct:   56 GPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVV-KVDYGDVSVRKTLRENLKCKPFSWYLENI-------YPDSQIPRRYYSLGEIRN-VETNQCLD-NMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 387.497 bits (994), Expect = 5.300e-127
Identity = 205/510 (40.20%), Postives = 301/510 (59.02%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R+  CK   Y + LP  S++I FHNE WSTLLRTV+S+++RSP  L+ E+ILVDD S ++FL   LE YV      V+I+R  +R GLIRARL GA  + G V+ F+D+HCE  + WL PLL  I++  KT+ CP IDVIS + F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G+ + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+ L C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +   I NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ W Y+     + H  S +C+D     + +   +Q CS   SQ+W+L NM 
Sbjct:   56 GPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVV-KVDYGDVSVRKTLRENLKCKPFSWYLENI-------YPDSQIPRRYYSLGEIRN-VETNQCLD-NMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 387.497 bits (994), Expect = 5.300e-127
Identity = 205/510 (40.20%), Postives = 301/510 (59.02%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R+  CK   Y + LP  S++I FHNE WSTLLRTV+S+++RSP  L+ E+ILVDD S ++FL   LE YV      V+I+R  +R GLIRARL GA  + G V+ F+D+HCE  + WL PLL  I++  KT+ CP IDVIS + F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G+ + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+ L C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +   I NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ W Y+     + H  S +C+D     + +   +Q CS   SQ+W+L NM 
Sbjct:   56 GPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVV-KVDYGDVSVRKTLRENLKCKPFSWYLENI-------YPDSQIPRRYYSLGEIRN-VETNQCLD-NMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|A8Y236|GLT10_CAEBR (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis briggsae OX=6238 GN=gly-10 PE=3 SV=2)

HSP 1 Score: 494.967 bits (1273), Expect = 4.845e-167
Identity = 261/533 (48.97%), Postives = 349/533 (65.48%), Query Frame = 3
Query:  318 KIDWANHDTIDEENARVGPGEQGIGVYLTAN-ENEK-AKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK--VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT----DVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEE--LTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKC--SRKLSQKWILENMN 1877
            KI W +    +++ AR GPGE G  V L  + E EK A  L + NGYNA  SD IS++RSIKD+R  +CK + Y   LP  S+I PFH EH STLLR+V+S+++RSP +L+KEIILVDD S K  L + LE ++ ++     V+ILRT KREGLIR R LGA EA G +LIF+D+H E   NWLPPLL PI D Y+T+ CPF+DVI    + +RPQDEG RG+FDW F+YKRLP   KD  +P KPF +P+MAGG FAIS  WF ELGGYD GLD+WGGEQYELSFKVW C GKMVD PCSRV H+YR K+ PF   G+G++++RN+KR+AEVWMD++K+ +Y KH+    + D GDL   K +R+ L C SFDWFMK+IA+D  + YP   +P+  ++G+I+  +  +LC D         F +  C     D   EQ+L  T   +I+P+ R IC D     ++  + +F CH M GNQ + Y     QI H VS +C+    N +   ++++KC  S KL Q+W  + ++
Sbjct:   86 KIKWEDEVAYEKDKAREGPGEWGKPVKLPDDKETEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKKMTYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKILRTKKREGLIRGRQLGAQEATGEILIFLDAHSECNYNWLPPLLDPIADDYRTVVCPFVDVIDCETYEIRPQDEGARGSFDWAFNYKRLPLTKKDRENPTKPFDSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGKMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDEYKETLY-KHRPGIGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAI-EPKASAEGEIR-HVASNLCIDTQFKEQNQRFGLRKCASEDKDGGGEQDLRLTRWHDIRPKGRKICFDVSTSVDKAPIILFDCHSMKGNQLFKYRMPQKQIYHPVSGQCLTADENGKGF-LHMKKCDSSSKL-QQWAWQTID 613          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|O45947|GLT10_CAEEL (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis elegans OX=6239 GN=gly-10 PE=1 SV=3)

HSP 1 Score: 490.73 bits (1262), Expect = 1.291e-164
Identity = 253/532 (47.56%), Postives = 346/532 (65.04%), Query Frame = 3
Query:  318 KIDWANHDTIDEENARVGPGEQGIGVYLTANEN--EKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK--VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYR-KFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT----DVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEE--LTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMN 1877
            KI W +    ++E  R GPGE G  V L  ++   ++A  L + NGYNA  SD IS++RSIKD+R  +CK + Y   LP  S+I PFH EH STLLR+V+S+++RSP +L+KEIILVDD S K  L + LE ++ ++     V++LRT KREGLIR R LGA +A G +LIF+D+H E   NWLPPLL PI + Y+T+ CPF+DVI    + +RPQDEG RG+FDW F+YKRLP   KD   P KPF +P+MAGG FAIS  WF ELGGYD GLD+WGGEQYELSFKVW C G+MVD PCSRV H+YR K+ PF   G+G++++RN+KR+AEVWMDD+K+ +Y KH+    + D GDL   K +R+ L C SFDWFMK+IA+D  + YP   +P+  ++G+I++ +  + C D         F +  CT    D   EQ+L  T   +I+P+ R IC D     ++  + +F CH M GNQ + Y     QI H +S +C+    N +   ++++KC S    QKW  + ++
Sbjct:  141 KIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLY-KHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAV-EPKASAEGEIRN-VGTNFCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGF-LHMKKCDSSSDLQKWAWQTVD 668          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q6P9S7|GLT10_MOUSE (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Mus musculus OX=10090 GN=Galnt10 PE=2 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 2.154e-163
Identity = 257/533 (48.22%), Postives = 336/533 (63.04%), Query Frame = 3
Query:  324 DWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNE------QNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            DW N + I  +  RVG GEQG    +T  + E+  Q    NG+N   SDKIS++RS+ D+R   C    Y   LP  SIIIPFHNE WS+LLRTVHS+L+RSP +LV EI+LVDD S +E L + LE Y++  F  VRILRT KREGLIR R+LGA+ A G V+ F+DSHCE  +NWLPPLL  I  + KTI CP IDVI ++DF    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V   G  LARN KR+AEVWMD++ +YIYQ+  + Y  L  GD+  QKKLR +LNC SF WFM +IA+DL + YP   +P   + G+I++ +   LC D  LG  G P R+  C     E      Q   FTW  +I+P      +  C D       +T++ CH M GNQ W Y ++   + H VS  C+D   +   + +N    S  L+Q+W+ E+ N+ +
Sbjct:   73 DWHNKEAIRRDAQRVGYGEQGKPYPMT--DAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPE-YRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYP-PVEPPAAAWGEIRN-VGTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDK-TLYHPVSGSCMDCSESDHRVFMNTCNPS-SLTQQWLFEHTNSTV 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q925R7|GLT10_RAT (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Rattus norvegicus OX=10116 GN=Galnt10 PE=2 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.857e-162
Identity = 256/533 (48.03%), Postives = 335/533 (62.85%), Query Frame = 3
Query:  324 DWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNE------QNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            DW N + I  +  RVG GEQG    +T  + E+  Q    NG+N   SDKIS++RS+ D+R   C    Y   LP  SIIIPFHNE WS+LLRTVHS+L+RSP +LV EI+LVDD S +E L + LE Y++  F  VRILRT KREGLIR R+LGA+ A G V+ F+DSHCE  +NWLPPLL  I  + KTI CP IDVI ++DF    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V   G  LARN KR+AEVWMD++ +YIYQ+  + Y  L  GD+  QKKLR +LNC SF WFM +IA+DL + YP   +P   + G+I++ +   LC D   G  G P R+  C     E      Q   FTW  +I+P      +  C D       +T++ CH M GNQ W Y ++   + H VS  C+D   +   + +N    S  L+Q+W+ E+ N+ +
Sbjct:   73 DWHNKEAIRRDAQRVGNGEQGKPYPMT--DAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPE-YRHLSAGDVVAQKKLRGSLNCKSFKWFMTKIAWDLPKFYP-PVEPPAAAWGEIRN-VGTGLCTDTKHGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDK-TLYHPVSGSCMDCSESDHRIFMNTCNPS-SLTQQWLFEHTNSTV 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q86SR1|GLT10_HUMAN (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Homo sapiens OX=9606 GN=GALNT10 PE=1 SV=2)

HSP 1 Score: 482.256 bits (1240), Expect = 2.115e-162
Identity = 257/539 (47.68%), Postives = 338/539 (62.71%), Query Frame = 3
Query:  306 DSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLPRLSK-DNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNE------QNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            D Q   DW + + I  +  RVG GEQG    +T  + E+  Q    NG+N   SDKIS++RS+ D+R   C   +Y   LP  SIIIPFHNE WS+LLRTVHS+L+RSP +LV EI+LVDD S +E L + LE Y++  F  VRILRT KREGLIR R+LGA+ A G V+ F+DSHCE  +NWLPPLL  I  + KTI CP IDVI ++DF    Q  +  RGAFDW   YKR+P   +   A P  PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V   G  LARN KR+AEVWMD++ +YIYQ+  + Y  L  GD+  QKKLR +LNC SF WFM +IA+DL + YP   +P   + G+I++ +   LC D   G  G P R+  C     E      Q   FTW  +I+P      +  C D       +T++ CH M GNQ W Y ++   + H VS  C+D   +   + +N    S  L+Q+W+ E+ N+ +
Sbjct:   67 DGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMT--DAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPE-YRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYP-PVEPPAAAWGEIRN-VGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDK-TLYHPVSGSCMDCSESDHRIFMNTCNPS-SLTQQWLFEHTNSTV 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A433U8J1 (Polypeptide N-acetylgalactosaminyltransferase OS=Elysia chlorotica OX=188477 GN=EGW08_002089 PE=3 SV=1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 284/538 (52.79%), Postives = 376/538 (69.89%), Query Frame = 3
Query:  270 KETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDV---SNEQNLAFTWEMEIKPQKRDICLDYPRKGEE--LTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILE 1868
            +E  D+I   +   + KIDW +++ I  E  R GPGEQG    +TA+E +  ++L  TNG+NALASDKIS+ RS+KD+R + CK  KY  +LP  S IIPFHNEH STLLR+VHSIL+R+P  LVKE+IL DD STK+   + L+ YV+++F  VR++R  +REGLIR RLLGA  A G VL+F+DSH E  IN+LPPLL+PI D+Y+T+ CPFIDVI Y +F+ R QDEG RGAFDW   YKRLP   +D A P KPF NPIMAGGLFAIS+ WF ELGGYD GLD+WGGEQYELSFKVW CGG MVD PCSR+GH+YR+F PF   G+G+++ RN+KR+AEVWMD++  YIY++    Y ++D GDLTEQK +R+ LNC  F WFMK++AYDL++ YP   +P+ L+ G+I+   N  +C D       D   +  C+       EQ   F+W  +++P++R+IC D  R   +  + +FSCHGMGGNQ++ YN ++HQI H +S +C+D   N E+ EI +  C    SQ W+ E
Sbjct:   63 REIFDDILVKTRPKEEKIDWHDYNAIAAEKIREGPGEQGTAYLMTADEEKAKQELYRTNGFNALASDKISLERSLKDIRHSDCKRQKYFKYLPTTSFIIPFHNEHLSTLLRSVHSILNRAPPSLVKEVILADDCSTKDECKQPLDDYVAQNFKNVRVVRAAQREGLIRTRLLGARNATGEVLVFLDSHIECNINFLPPLLEPIADNYRTVVCPFIDVIDYENFAYRAQDEGARGAFDWEMYYKRLPLPPEDLAEPSKPFKNPIMAGGLFAISRDWFWELGGYDPGLDIWGGEQYELSFKVWQCGGTMVDAPCSRIGHIYRRFAPFPNPGVGDFVGRNYKRVAEVWMDEFADYIYRRRPH-YRNIDAGDLTEQKAIREKLNCKPFSWFMKEVAYDLVKFYP-PVEPKPLATGEIRRN-NTDMCVDTGFKGANDRIDLHKCSKSLGGGAEQQFEFSWHKDLRPRRRNICFDVSRSSPKSPVVLFSCHGMGGNQRFKYNLDTHQIYHPISGQCLD--SNLETEEIYMNPCKPIPSQVWLFE 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A2C9JLV6 (Polypeptide N-acetylgalactosaminyltransferase OS=Biomphalaria glabrata OX=6526 GN=106059417 PE=3 SV=1)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 289/559 (51.70%), Postives = 385/559 (68.87%), Query Frame = 3
Query:  249 QNILSDWKETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVS---NEQNLAFTWEMEIKPQKRDICLDY----PRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKL-SQKWILE--NMNAMIANH 1895
            +N+    ++  +EI E +   + KIDW +H TI+EE  R GPGEQG    L+  +  +   L  +NG+NAL SDKIS+ RSIKD+R   CK  +Y  FLP AS I+PFHNEH STLLR+V+SI++R+P +LVKEIIL DD+S K+   + L+ YV EHFT V+I+R  KREGLIR RLLGA  A G VLIF+DSH E  IN+LPPLL+PI  +Y+T+ CPFIDVI Y +F  R QDEG RGAFDW F YKRLP L +D   P +PF NP+MAGGLFAISK WF ELGGYD GLD+WGGEQYELSFK+W CGG MVD PCSR+GH+YRKF PF+  G+G++L RN+KR+AEVWMD++ +YIY  H+  Y SLD GDLT QK +R+ LNC  F WFM+++A+DL++ YP   +P  +++G I++ +   LC D    + GD F +  C D +    EQ    TW  +I+PQ R +C D     PR    + +FSCHGM GNQ++ YN +++QI H +S  C+D   +  + E+ +  C   + +Q+W  E  N++A+ A++
Sbjct:   43 KNVKPSLEKVFEEILEKTRPVEEKIDWHDHKTIEEELKRQGPGEQGSAFKLSPEDELQKNLLYRSNGFNALVSDKISLQRSIKDIRHPHCKSKQYVKFLPTASFILPFHNEHLSTLLRSVYSIINRAPKELVKEIILTDDHSNKDECKKPLDDYVKEHFTNVKIVRAEKREGLIRTRLLGARHATGEVLIFLDSHIECNINFLPPLLEPIAQNYRTVVCPFIDVIDYENFEYRAQDEGARGAFDWEFYYKRLPLLEEDKKKPSEPFANPVMAGGLFAISKEWFWELGGYDPGLDIWGGEQYELSFKIWQCGGTMVDAPCSRIGHIYRKFAPFSNPGVGDFLGRNYKRVAEVWMDEYAEYIYS-HRPHYRSLDAGDLTSQKAIRQKLNCKPFKWFMEEVAFDLVKFYP-PVEPPAMAKGTIRN-MAIDLCIDTKFKSQGDTFSVETCADSTARAKEQQFELTWHKDIRPQGRLLCFDVSESKPRTS--VILFSCHGMQGNQRFKYNVDTNQIFHPISGLCMD--TDSTTKEVYMNPCDMTIKTQEWQFEKPNLDALKADN 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: V4ALX2 (Polypeptide N-acetylgalactosaminyltransferase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_239085 PE=3 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 280/527 (53.13%), Postives = 368/527 (69.83%), Query Frame = 3
Query:  318 KIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTD----VSNEQNLAFTWEMEIKPQKRDICLDYPRKGEE--LTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMN 1877
            +IDW ++  I EE  R G GEQG  V LTA E +K   L + NG+NA ASDKIS+ R++KD+R  +CK  KY N LP ASII+PFHNEHWSTLLRT  S++ RSP  L++E+ILVDD S+KE   ++L+ YV+EH+TKVRI+R  KREGLIR RLLGA  A G VLIF+DSHCEV INWLPPLL PI    KT+ CPFIDVI Y  F+ R QDEG RGAFDW F YKRLP L +D  HP  PF +P+MAGGLFAI + WF  LGGYD GLD+WGGEQYELSFK+W CGG MVD PCSR+GHVYRKF PF   G+G+++ RN+KR+AEVWMD++ +Y+Y K +  Y +LD GDLTEQK +R  L+C SF WFM ++A+DL++ YP   +P  ++ G+++++ N   C D       + F++ +C         EQ   F+W  +I+P+ R +C D      +  + +++CHGMGGNQ++ YN  ++QI H VS +C+D   + E+LE+ +  C +   +QKW  E +N
Sbjct:   24 EIDWHDYKAIAEEQQRTGLGEQGSAVILTAEEEKKKGDLYKVNGFNAYASDKISLQRALKDIRHEQCKNKKYLNKLPTASIIVPFHNEHWSTLLRTAQSVIDRSPPHLLQEVILVDDFSSKEHCKQQLDDYVAEHYTKVRIVRAEKREGLIRTRLLGARAAKGDVLIFLDSHCEVNINWLPPLLDPIARDQKTVVCPFIDVIDYETFAYRAQDEGARGAFDWEFFYKRLPLLPEDKKHPADPFKSPVMAGGLFAIHQEWFWMLGGYDPGLDIWGGEQYELSFKIWQCGGMMVDSPCSRIGHVYRKFAPFPNPGVGDFIGRNYKRVAEVWMDEYAEYLY-KRRPHYKTLDAGDLTEQKAIRDKLHCKSFKWFMTEVAFDLVKVYP-PIEPTPMASGEVRNQAN-EKCIDTRFKGQNERFQLESCIKDGQGAGGEQQFEFSWHKDIRPKSRAVCFDAAHSAPKSPVILYNCHGMGGNQRFKYNLQTNQIFHPVSGQCLD--CDKENLEVFMNPCDADSETQKWKWEKIN 545          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1I8GGZ3 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011947g5 PE=3 SV=1)

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 279/534 (52.25%), Postives = 360/534 (67.42%), Query Frame = 3
Query:  279 SDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT----DVSNEQNLAFTWEMEIKPQKRDICLDYPRKG--EELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKC-SRKLSQKW 1859
            + + ++ + D    IDW ++  I+ E AR GPGEQG GV+L A+EN+ A  L   NG+NAL SDK+S+ RS+ D+R + C+  +Y   LP ASIIIPFH EHWSTLLRTV S +HR+P  LVKE+ILVDD S K FLG+ LE+YVS HFT VR+LR  KREGLIR R+ GA  A G VLIF+DSHCE  INWLPPLL PI ++YKT+ CPFIDVI +N F+ R QDEG RGAFDW F YKRLP L +D  HP KPF +P+MAGGLFAIS  WF ELGGYD GLD+WGGEQYELSFK+W CGG+MVD  CSR+GHVYRK+ PF   G+G+++ RN++R+AEVWMD++ +YIY +    Y S+  GDLT Q+++R+ L+C  F WFM  +A+DL  +YP   +P + + G+I+S  +  LC D         F ++ C      +S EQN  FT+  +I P  R  C D  +      + ++ CH   GNQ W  N N+ Q+ HV S+ C+D    P  LEI +  C S   +Q W
Sbjct:   58 AGDASDRTEDPNELIDWHDYKAIEAERARQGPGEQGKGVHLDASENKAADDLFRVNGFNALVSDKMSLFRSLADIRHSACQGERYRRGLPTASIIIPFHEEHWSTLLRTVVSCIHRAPRHLVKEVILVDDFSKKSFLGDPLEKYVSAHFTNVRVLRNAKREGLIRTRIFGARNATGDVLIFLDSHCECNINWLPPLLHPIANNYKTVVCPFIDVIDFNTFAYRAQDEGARGAFDWEFYYKRLPLLPEDLKHPSKPFDSPVMAGGLFAISTKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGRMVDTGCSRIGHVYRKYAPFPNPGVGDFIGRNYRRVAEVWMDEYAEYIYNRRPH-YKSIPAGDLTSQREIRERLHCKPFKWFMTNVAFDLPLRYP-PVEPPSAASGEIRSAADASLCIDTRFKGGMQSFGLAKCIKGGGGLSGEQNFIFTFRKDIHPADRAFCFDVSQHAVKAPVILYQCHYQKGNQHWKINPNTGQLYHVASRLCLD--SEPARLEIFMNSCNSATQTQLW 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1W0WCD2 (Polypeptide N-acetylgalactosaminyltransferase OS=Hypsibius dujardini OX=232323 GN=BV898_12951 PE=3 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 275/534 (51.50%), Postives = 371/534 (69.48%), Query Frame = 3
Query:  318 KIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNC----TDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEE--LTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKC-SRKLSQKWILENMNAMIANHL 1898
            KIDW N+D I  E+ R GPGE G  V +   EN +  +L +TNG+NALASDKI++ R++KD+R   CK  +Y   LP  S+I+PFHNEHW+TLLRT  S+L RSP  L+KEIILVDD STK+FL  KL+ Y+ EH  KVR++R  KREGLIRARLLGA  A G+VLIF+DSH E  +NWLPPLL+PI ++Y+T +CPFID+I Y  F  R QDEG RGAFDW   YKRLP L  D  +P +PF +P+MAGGLFAIS+ +F ELGGYD GLDVWGGEQYELSFK+W CGG MVDVPCSR+GH+YRKF PF+  G+G+++ RN+KR+AEVWMD++ +++Y K    Y +++ G+L++Q+KLR  L C SF WFM ++A+DL+++YP   +P N + G+I++ I  + C D       + F +  C    T+ + EQ+   TW  +I+P+ R +C D      +  + +++CH   GNQ+W Y   + Q+ H VS KC D   +PE  EI +  C S KLSQ+W+ E+ N+ +   L
Sbjct:   58 KIDWHNYDLIARESERTGPGEHGKSVIIPTEENNEKDELYKTNGFNALASDKIALDRAVKDIRHEGCKKKRYFENLPTVSVIVPFHNEHWTTLLRTAMSVLVRSPPALIKEIILVDDFSTKDFLKGKLDDYIKEHMQKVRVIRAPKREGLIRARLLGAQAATGSVLIFLDSHSEPNVNWLPPLLEPIAENYRTTTCPFIDIIDYETFEYRAQDEGARGAFDWELYYKRLPLLPADIKNPTEPFKSPVMAGGLFAISRKFFWELGGYDEGLDVWGGEQYELSFKIWQCGGMMVDVPCSRIGHIYRKFAPFSNPGVGDFVGRNYKRVAEVWMDEYAEFLYNKRPH-YRNIETGNLSKQRKLRDTLKCKSFKWFMTEVAFDLMDRYP-PVEPPNYAWGEIRN-IASNQCMDTRFKGQNERFLLEPCIKDNTENNGEQSFELTWHKDIRPKNRAVCFDVSTSDNKSPIVLYNCHNSQGNQQWRYTVETKQLFHPVSGKCAD--CDPERREIFVSDCDSSKLSQQWLFEHFNSTLLAKL 586          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: si:ch211-15e22.3 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:103040570])

HSP 1 Score: 476.863 bits (1226), Expect = 2.144e-161
Identity = 253/543 (46.59%), Postives = 341/543 (62.80%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLP-RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDV------SNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCS-RKLSQKWILENMNAMIAN 1892
            +D   + DW ++++I  +  RVG GE G    L   E+E    + + NG+N   S+ I++ RS+ D+R   CK   Y   LP  SIIIPFHNE WS+LLRT+HSI++R+PD L+ EIILVDD S ++ LG +LE Y+S  F KVRI+RT KREGLIR RLLGA+ A G VL F+DSHCE  INWLPPLL  I  + +TI CP IDVI +N F    Q  +  RGAFDW   YKR+P  L    + P  P+ +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG M DVPCSRVGH+YRK+ P+ V   G  LARN KR+AE WMD++ +YIYQ+  + Y  L  GDLT QK+LRK L C  F W+M  +A+DL + YP   +P   + G+I++  +  LC D   G+ G   R+  C         ++EQ   F W  +I+P      R  C D   +   +T++ CHGM GNQ W Y ++   + H+VS  C+D   +P    I + KC+ +  +Q+W+ + +N  I +
Sbjct:   60 TDGLRRRDWHDNESIRRDELRVGKGEHGKPYPLA--EDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTIHSIVNRTPDHLIAEIILVDDYSDRDHLGARLEDYMSR-FPKVRIVRTKKREGLIRTRLLGASVAKGEVLTFLDSHCETNINWLPPLLDQIAQNPRTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPLELQGSDPSNPYESPVMAGGLFAVRRQWFWELGGYDTGLEIWGGEQYEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYKVPS-GTSLARNLKRVAETWMDEFAEYIYQRRPE-YRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYP-PVEPLPAAWGEIRNAAS-GLCVDSKHGSTGTELRLDTCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQSSPVTLYDCHGMRGNQHWSYRKDK-SLYHLVSSGCMD--CSPADKRIFMNKCNPQSETQQWLFQRVNTTILD 592          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 461.07 bits (1185), Expect = 1.953e-156
Identity = 240/512 (46.88%), Postives = 323/512 (63.09%), Query Frame = 3
Query:  408 NENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLP---RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNC------TDVSNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKL-SQKWILENMNAMIANHL 1898
             + ++  Q    NG+N   S++IS++RS+ D+R   CK   Y   LP  SIIIPFHNE WS+LLRTVHSIL+RSP +L+ EIILVDD S +E L   LE Y+     KVRILRT KREGLIR RLLGA  A G V+ F+DSHCE  +NWLPPLL  I  + K I CP IDVI +++F    Q  +  RGAFDW   YKR+P    L KD+  P +PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V G G  LARN KR+AEVWMD++ +YIYQ+  + Y  L  GD+T QK+LR  LNC +F WFM  +A+DL + YP   +P   + G++++ +   LC +    + G P R+  C      T  S+ Q   F W  +I+       + +C D       +T++ CHGM GNQ W Y ++   + H +S  CID  +NP    + +  C   + +Q+W+ E  N+ + +  
Sbjct:    2 TDADRVDQAYRENGFNIYVSNRISLNRSLPDIRHPNCKLKLYSERLPNTSIIIPFHNEGWSSLLRTVHSILNRSPPELIAEIILVDDFSDREHLKASLEDYMVR-MPKVRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANVNWLPPLLDRIAQNRKAIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAELQKDD--PSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPG-GVSLARNLKRVAEVWMDEYAEYIYQRRPE-YRHLSAGDVTTQKELRARLNCKNFKWFMTDVAWDLPKHYP-PVEPPAAAWGELRN-VGSGLCMESKHFSSGTPLRMEVCVKGRGETAWSHGQVFTFGWREDIRVGDPLHTKKVCFDAISHNSPVTLYDCHGMKGNQLWRYRKDK-TLYHPISNSCID--HNPNEKRVFMNSCDASIATQQWVFERTNSTVLDQF 503          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 394.43 bits (1012), Expect = 8.490e-130
Identity = 208/513 (40.55%), Postives = 304/513 (59.26%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R++ CK   Y + LP  SI+I FHNE WSTLLRTVHS+++RSP  L+ EI+LVDD S ++FL +KLE YV      VRILR  +R GLIRARL GA    G V+ F+D+HCE  + WL PLL  I++  K + CP IDVIS   F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P++   G G  + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+AL C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +     NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ + Y+     ++HV S +C+D     + +   ++ C+   SQ+W+L NM   I
Sbjct:   56 GPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVV-RVDYGDVSARKALREALQCKPFSWYLENI-------YPDSQIPRRYFSLGEIRN-VETNQCVD-NMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNMTLSI 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 385.956 bits (990), Expect = 1.610e-126
Identity = 199/509 (39.10%), Postives = 303/509 (59.53%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMN 1877
            GPGE G  V +   ++EK K++ + N +N +AS+ I+++RS+ D+R+  CK   Y + LP  S++I FHNE W+TLLRTVHS+++RSP  L++E++LVDD S ++FL  KLEQYV +    VRI+R  +R GLIRARL GA+ + G V+ F+D+HCE  + WL PLL  I+   KT+ CP IDVIS + F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G  + +N++R+AEVWMD++K + Y     V + +D GD+  +  LR+ L C  F W+++ +       YP  + P +  S G+I++ +  + C D       +   I NC  +   Q  ++T   EI+    D+CLD  +    + M  CH + GNQ W Y+     +VHV S +C+D     +S   +++ C+   SQ+W+L N+ 
Sbjct:   55 GPGEMGKPVVIPKEQHEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVPVRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGV-TKVDYGDIATRASLRQKLQCKPFSWYLENV-------YPDSQIPRHYYSLGEIRN-VETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTD--DLCLDVSKLNGPVMMLKCHHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDCTGSRSQQWLLRNVT 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 383.645 bits (984), Expect = 2.018e-125
Identity = 205/518 (39.58%), Postives = 300/518 (57.92%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCI------DYRYNPESLEINIQKCSRKLSQKWILENMNAM 1883
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R++ CK   Y + LP  SI+I FHNE WSTLLRTVHS+++RSP  L+ EI+LVDD S ++FL +KLE YV      VRILR  +R GLIRARL GA    G V+ F+D+HCE  + WL PLL  I++  K + CP IDVIS   F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P++   G G  + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+AL C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +     NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ + Y+      +H++++ C+      D  Y P      ++ C     Q W+L N   +
Sbjct:   56 GPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVV-RVDYGDVSARKALREALQCKPFSWYLENI-------YPDSQIPRRYFSLGEIRN-VETNQCVD-NMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAEKGTFMHIITQSCLTISRLEDGTYGP-----TVEYCDDSPLQTWVLRNYTRL 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 342.043 bits (876), Expect = 1.577e-111
Identity = 184/464 (39.66%), Postives = 268/464 (57.76%), Query Frame = 3
Query:  516 CKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIV--HVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNA 1880
            CK   Y + LP  S++I FHNE WSTLLRTVHSI+ RSP  +++EIILVDD S ++FL   LE+Y S+    V I+R   R GLIRARL GA  + G V+ F+D+HCE    WL PLL  I+   K + CP IDVIS   F      +   G F+W  NF +  +P+   D    ++  P  +P MAGGLFAI + +F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P+    G G  + +N++R+AEVWMD++K + Y     V + ++ GD++++K LR  L C  F WF++ +       YP  + P +  S G++++ +  + C D N+G    +   I NC  +   Q  ++T + E++    D+CLD  R    + M  CH M GNQ W Y+Q   +++  H  S +C+D     +     +++C    SQ+WIL NM  
Sbjct:    1 CKTKVYPDGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEYASKLPVPVHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEYLAGSDMTYGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDNFKDFFYIISPGV-TKVEYGDVSQRKALRDRLKCKPFSWFLENV-------YPNSQIPRHYYSLGEVRN-VETNQCLD-NMGRKENEKIGIFNCHSMGGNQVFSYTADKELRTD--DLCLDVSRMNGPVLMLKCHHMKGNQLWDYDQQMQKLIMRHTNSNQCLDKATEQDRQVPTMRECDGGRSQQWILRNMTV 452          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt12 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 [Source:ZFIN;Acc:ZDB-GENE-060503-704])

HSP 1 Score: 323.939 bits (829), Expect = 1.445e-103
Identity = 201/519 (38.73%), Postives = 288/519 (55.49%), Query Frame = 3
Query:  375 GEQGIGVYLTANENEKAKQLMETNGY--NALASDKISVHRSIKDLRINKCKWLKYD-NFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFS-LRPQDEGGRGAFDWN--FDYKRLP-RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDP-GDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQ--GKIKSEINPHLCFDFNLGN----PGDPFRISNCTDVSNEQNLAFTWEMEIKPQKR--DICLDYPRKGEELTMFSCHG----MGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEIN-IQKCSRKLSQKWILE 1868
            GE G  V L     EK K+    N +  N   SD+IS+HR + +     C+  KY+   LP  S++I F+NE WSTLLRTVHS+L  SPD L+ EIILVDD S +E L ++LEQY++    KVR++R  KREGL+RARLLGA  A G VL F+D HCE  + WL PLL+ I +    + CP IDVI +N F  +    E   G FDW   F +  +P    K    P     +P MAGGLFA+SK +F+ LG YD G++VWGGE  E SF++W CGG +   PCS VGHV+ K  P++       LA N  R AEVWMD +K+  Y  H+  ++ ++P GD+TE++ LR+ L C +F WF++ +       YP    PE+     G +K+    + CFD+N  +     G    +  C  +   Q   +T E EI+   R  + C       + LTM+ CH     +  NQK+ + ++   I H++++KC++    P S  +  ++ C     Q+W+ +
Sbjct:   28 GEMGKAVRLNLEGEEKRKEEESINKHQINIYVSDRISLHRQLPEKWNPLCREKKYNYRQLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDALLNEIILVDDYSDREHLRDRLEQYIAT-LRKVRLVRARKREGLVRARLLGAGVATGDVLTFLDCHCECHVGWLEPLLERIAEEESAVVCPVIDVIEWNTFEYMGNAGEPQIGGFDWRLVFTWHTVPGHEQKRRKSPIDVIRSPTMAGGLFAVSKKYFDYLGTYDTGMEVWGGENLEFSFRIWQCGGTLEVHPCSHVGHVFPKQAPYS---RSKALA-NSVRAAEVWMDGYKELYY--HRNPHARMEPFGDVTERRNLRERLQCKTFKWFLENV-------YPDIHVPEDRPGKFGMLKNRGLSNYCFDYNPPDENQVTGQRIILYGCHGMGQNQFFEYTSEQEIRYNTRQPEACAAVDNGMDYLTMYYCHSKNSPVTENQKFDFREDG-SIFHILTQKCLEAVEQPNSGPLPLLRTCDGNTRQRWLFK 531          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 308.531 bits (789), Expect = 6.473e-98
Identity = 171/504 (33.93%), Postives = 284/504 (56.35%), Query Frame = 3
Query:  405 ANENEKAKQL-METNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK-VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPE---KPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWK-QYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYP---------IQKQPENLSQGKIKS-EINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELT--MFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPE-SLEINIQKCSRKLSQKW 1859
            + E+++ + L  + + +N L S+++  HR+I D R  +C    Y   LP AS++I F+NE  S LLRTVHS+  R+P  L+ E++LVDD S    L E LE+ + E F K V+++R  KREGLIR R++GAN A G VL+F+DSHCEV + WL PLL  + ++  T+ CP ID+++ + F L       RG F+W   ++  P  S   + P+    P  +P MAGGLFA+ + +FN+LG YD G+D+WGGE  E+SF++WMCGG +  +PCSR+GH++RK  P+      + ++RN  R+A VW+D++K QY+  + +      + GD++E+K LR+ L C  F W+++ +  ++    P         + K+P+ + +G+++  +    L    +    G    +  C     EQ   +    E++     +CLD P      +  +  CHG GG+Q+W   +  +++  V   +C+  +   +    + ++ C+    Q+W
Sbjct:    5 SREDQETRDLGYQKHAFNLLISNRLDPHRTIPDTRHPRCATKSYPAQLPTASVVICFYNEAVSALLRTVHSVTERTPPALLHEVLLVDDFSDLVDLREGLEKELKEKFPKKVKLVRNEKREGLIRGRMVGANHATGDVLVFLDSHCEVNVAWLEPLLARVAENPSTVVCPIIDIVNPDTF-LYSASPLVRGGFNWGLHFRWDPVPSSLLSGPDGEMAPIKSPTMAGGLFAMDRKYFNKLGQYDGGMDIWGGENLEISFRIWMCGGSLEIIPCSRIGHIFRKRRPYGSPAGADTMSRNSLRLAHVWLDEYKEQYLALRPE--LREREYGDVSERKALRERLGCRPFRWYLQNVYPEIEVGRPQLPQAVLSKMHKRPKPVQRGRLRHLQTGKCLVAHNDPSEKGGLVVVRPCDSGDIEQVWVYNEGQELQ-LANLLCLDMPEMEPRASPRLMKCHGSGGSQQWTMGK-FNRLYQVSLGQCLQVKSMTDVKGRVVMEICNGSEQQQW 503          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 308.531 bits (789), Expect = 4.457e-97
Identity = 186/491 (37.88%), Postives = 260/491 (52.95%), Query Frame = 3
Query:  372 PGEQGIGVYLTA---------NENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYD-NFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDW--NFDYKRLPRLSKDN-AHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLS--QGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYR 1796
            P E+ +G +  A         +E +  ++ +E    N   SD+IS+HR I D R+ +CK  K+D   LP  S++I F+NE WSTLLRTVHS+L  SP  L++EIILVDD S + +L   LE Y+S    +VR++RT +REGL+RARLLGA  A G VL F+D HCE    W+ PLLQ I +    + CP ID I +N F    Q  E   G FDW   F +  +P   +   A   +P  +P MAGGLFA+SK +F+ +G YD G++VWGGE  ELSF+VW CGG +   PCS VGHV+ K  P+          +N  R AEVWMD +K++ Y ++         GDL+E+K LR+ L C SF+W++K I       YP    PE+     G I+++     C D+N  +       +N T                              G  L+++ CHG GGNQ + Y        +  ++ C + R
Sbjct:   72 PDERALGEWAKAARLNLPEGSSERKLEEESIERYALNIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYIST-LERVRLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFYMQTSEPAIGGFDWRLTFQWHGVPEHERSRRASRIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPYP----RPRFLQNTVRAAEVWMDSYKEHFYNRNPPGRKE-KYGDLSERKTLREKLGCKSFEWYLKNI-------YPDLHVPEDRPGFHGAIQNKGIQSECIDYNAPD-------NNPT------------------------------GAMLSLYPCHGQGGNQFFEYTTRKDLRFNSATELCAEVR 512          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008097.1 (pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1 gene:ENSPMAG00000007303.1 transcript:ENSPMAT00000008097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 288.886 bits (738), Expect = 5.359e-89
Identity = 178/489 (36.40%), Postives = 261/489 (53.37%), Query Frame = 3
Query:  399 LTANENEKAKQLMETNGYNALASDKISVHRSI-KDLRINKCKWLKYDNF--LPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSL-RPQDEG---GRGAFDW--NFDYKRLPR----LSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQK---VYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLE 1817
            L+  E    ++ ME + +N  ASDK+S+HR +  D R  +C   K+     +P  S+II FHNE WSTLLRTVHS+++ SP  L+KEIILVDD S  ++L   L++YV + F  V+++R  +R+GLI ARLLGA+ A G VL F+D+HCE    WL PLL  IR +  ++  P I  I  N F + +P        RG FDW   F ++ +P     L KD  +P +   +P  AGGLF+ISK +F  LG YD  +++WGGE  E+SF+VW CGG++  +PCS VGHV+R  +P       + + RN  R+AEVWMDD+K   Y+++ +   +  +   GD+T +K+LR  L C +F W++  +       YP    P          +++P++         G      NC D  + QN                       G+ L ++ CHGMGGNQ + Y+       +V  + C+        LE
Sbjct:  133 LSPEEKAIKEKGMEKHCFNVYASDKVSLHRDLGPDTRPPECIEQKFKRCPSMPSTSVIIVFHNEAWSTLLRTVHSVMYTSPSVLLKEIILVDDASVDDYLKGPLDEYVKQ-FGIVKVVRQQERKGLITARLLGASVAQGEVLTFLDAHCECFNGWLEPLLARIRQNETSVVSPDISTIDMNTFEVNKPSAYSPAHNRGNFDWGLTFGWEPIPSRERTLRKDQTYPIR---SPTFAGGLFSISKKYFEYLGTYDDQMEIWGGENIEMSFRVWQCGGQLEIIPCSIVGHVFRTKSPHTFPQGVSVITRNLVRLAEVWMDDYKDIFYRRNSQAAEIVKNKAYGDVTWRKRLRDKLQCKNFTWYLTNV-------YPEMFVP----------DLHPNIFGAIKNKAKG------NCLDTGSFQN---------------------EVGKPLILYPCHGMGGNQYFEYSSQKELRHNVAKEMCLHAAMGAMHLE 573          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO31035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ28])

HSP 1 Score: 365.925 bits (938), Expect = 1.570e-120
Identity = 191/466 (40.99%), Postives = 286/466 (61.37%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKR---LPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLD----YPRKGEELTMFSCHGMGGNQKWIYNQ 1745
            GPGE G  V   A +  K        G+N   SD+IS+ R+I D R   CK   Y   LP AS++I FHNE WSTL+RTVH++L RSP  +++EI++VDD S K+FL +KL+ Y ++   K++I+RT +R GLI+AR++GAN A G V+IF+D+HCE    WLPPLL+ I  + +T  CP ID I +  F  +P D   RG F+W FDYK     P        P +   +P+MAGGLFAI++ +F+ELG YD G+ +WGGEQYE+SFK+W CGG++ ++PCSRVGHVYR   P+        L  N +R+AEVWMD++K ++Y K  ++  S+D GD++++  LRK L C SF W+++ +A D + K  +    +  +QGK       ++C D ++G       +++C ++   Q   +T+  E++    + C D    +P  G ++  F CH M GNQ++++ +
Sbjct:    1 GPGENGEPVETKAEDESKKDAAYSEFGFNQFVSDQISLERTISDTRHQACKQRSYPINLPKASVVIVFHNEGWSTLMRTVHTVLLRSPPHMLQEIVMVDDFSNKDFLKQKLDDY-TKKLGKIKIVRTKERVGLIKARVIGANNAVGEVVIFLDAHCECNKGWLPPLLERIALNRRTAVCPTIDFIDHKTFQYKPMDPYIRGTFNWRFDYKERAVRPEEMAKRRDPTQEVKSPVMAGGLFAINREFFSELGQYDPGMFIWGGEQYEISFKLWQCGGQLENIPCSRVGHVYRHHVPYTYPKHDATLV-NFRRVAEVWMDEYKDWLYDKRPEI-KSVDYGDISDRIALRKRLKCKSFKWYLENVANDTV-KTKLCACFQVRNQGK-------NMCLD-SMGRKDGHVGLASCHNMGGNQAFQYTYIRELRTD--ETCFDVHESFP--GAKVHFFPCHEMKGNQEFLFTE 450          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO34355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN9])

HSP 1 Score: 349.747 bits (896), Expect = 1.546e-113
Identity = 194/514 (37.74%), Postives = 290/514 (56.42%), Query Frame = 3
Query:  387 IGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPE---KPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEK--------YPIQKQPENLS-QGKIKSEINPHLCFD--FNLGNPGDPFRISNCTDVSN-EQNLAFTWEM----EIKPQKRDICLDYP--RKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWIL 1865
            +G+   +++    ++    +G+N L S+++S+HR+IKD R   C+   Y   LP ASI+I F+NE W+ LLRT+HS+L R+P + + EIILVDD S    L  KL++Y+S    K+RI+R  KREGLIR R++GA  A G VL+F+DSHCEV INWL PLLQ I D  K ++CP IDVIS + F         RG F+W   +   P        PE   KP  +P MAGGLFA+ + +F +LG YD G+D+WG E  E+SF++WMCGG +  +PCSRVGH++R+F P+     G+ ++RN  R+AEVW+D +K+Y YQ    +      GD++++ KLRK+L C SF+W++K I  +L           YPI ++P+ +  +GK+   I     FD  + L +PG P        +   E   +  W +    E+K +   +CL+    +    L +  CH  GG Q+W +      + H  +  C+    +       +Q C   + Q+W  
Sbjct:    2 LGIVKNSDDIRTREEGYSAHGFNLLISNRLSLHRTIKDTRHELCRGKTYPKNLPVASIVICFYNEAWTILLRTIHSVLDRTPHQFLHEIILVDDFSNMLELKSKLDRYLST-MPKIRIVRNNKREGLIRGRIIGAEAATGQVLVFLDSHCEVNINWLQPLLQHIHDDQKAVACPVIDVISSDTFEYS-SSPMVRGGFNWGLHFTWEPIPPSLLVKPEDYVKPIRSPTMAGGLFAVDREYFTQLGKYDSGMDIWGAENLEISFRIWMCGGSLDILPCSRVGHLFRRFRPYGSDSKGDTMSRNSMRLAEVWLDGYKKYFYQIRHDLEGK-KFGDISQRIKLRKSLQCKSFEWYLKNIYPELKPPGQPGGGAFYPIDRRPQVVIWKGKVIC-IQLQTSFDDGYCLDSPGHPSEKKASAVIHQCESTKSRFWSLNEDGELKIESL-LCLEASGYQSKLGLRLMKCHAQGGGQQWKFLNKKSVLYHPATGLCLGVNESRTYSTPGMQICDYSIHQQWTF 510          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 344.354 bits (882), Expect = 1.398e-111
Identity = 201/508 (39.57%), Postives = 289/508 (56.89%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLK--YDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDE-GGRGAFDWN--FDYKRLPRLSKDNAHPEKPFY-NPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKF-NPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPG-DPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPR--KGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKW 1859
            G G+ G    L     E A    + + +N + SD+IS+ R +KD+R  KCK     Y   LP  S+II FHNE  S LLRTVHS+L+ SP +L+ +IILVDD S  + L + L  ++S    KV+++R   R+GL+ ARL GA EA G VL F+DSHCE    WL PLL  I +  + + CP I+VI+ +DF  +  D    RG F W+  F +K +P   K     E  +  +P MAGGLFAI K +F +LG YD  +++WGGE  E+SF++WMCGG++  VPCSRVGHV+RK+ +P+    G    LARN  R+AEVWMD++K + Y+K  +   ++D GD++++  LRK L C SF W++  I  D+  K P +     L   +I+++    LC D  LG        +  C  +   Q    T   EI     D CLD P    G  + M +CHG+ GNQ+W +N+    IVHV ++ C+D   + + + +N   C    +Q+W
Sbjct:    1 GLGDLGEAATLPTRFKEHAAHAFDNHSFNVMLSDRISLDRRLKDVRGPKCKRKHKLYPRALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHIS-MLNKVKLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRYQASDVIHERGGFTWDLFFTWKAIPEAEKKRRKDETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTTLARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKLPPKSY---LYSHQIRNK-ESSLCLD-TLGEKNIKRVGLYTCHGMGGNQFFTLTKSNEILFND-DKCLDSPNGDPGSYVEMITCHGLKGNQEWKHNKRMGTIVHVWTENCLDISQDGQFIIVN--PCDGSSTQRW 499          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 331.257 bits (848), Expect = 1.823e-106
Identity = 193/516 (37.40%), Postives = 300/516 (58.14%), Query Frame = 3
Query:  375 GEQGIGVYLTANENEK-AKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNF---LPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLR-PQDEGGRGAFDWN--FDYKRLP----RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKF-NPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPE--NLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRK--GEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILEN 1871
            G  G   +L + EN+K A++    + +N L SDKIS+ R++ D+R  +CK  K++ +   LP  S+II FH E  S LLRTVHS+++R+P +L+ E+I+VDD S    LG+ L+ +V++ FTKV++LR  KREGL+RARL GAN A G VL F+DSHCE    W  PLL  I    + + CP I+VI+ + F+ +   +   RG F W+  F +K +P    +L  D++    P   P MAGGLF+I + +F ++G YD  +D+WGGE  ELSF+VWMCGG++  V CSRVGHV+RK+ +P+    G+   L +N  R+AEVWMD++K   Y K  +  +S D GD++++ +LRK L C SF W++  I       YP  + PE    ++G++++  + + C D     P    R+   T      N    +       + + C D  +   G  + +  CHGM GNQ+W +++    ++H  +++C+D R +P      +  C  + SQ+W+  +
Sbjct:    8 GGGGKPAFLESEENKKLAEKYFANHSFNWLLSDKISLDRTLDDVRSERCK-AKHNTYPAKLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHVAQ-FTKVKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTFAYQGSTNADQRGGFSWDLFFKWKGIPPEEQKLRNDDS---DPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVERTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNS-DYGDISKRLELRKRLKCKSFKWYINNI-------YPDVQMPELDPPARGEVRNP-SSNQCLDSLGAKPEHNARVGIYTCHGQGGNQVSKYMPRELIFEEENCFDVSKTHPGAPVELMKCHGMRGNQEWKHDREKGTLMHFTTQQCLD-RGSPSDQYAVMNPCDGRESQRWVFSH 508          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV8])

HSP 1 Score: 313.153 bits (801), Expect = 5.279e-101
Identity = 185/452 (40.93%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  408 NENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNS---TKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFS-LRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK-PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLL--EKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRK---GEELTMFSCHGMGGNQ 1727
            +E E  K+      +N LAS K+++ RSI D R   C  L Y   LP AS+II FHNE WSTLLRTVHS+L RSP  L++EI+LVDD+S   T   LG KLE Y+S+ FTKV+++R  KREGLIRARL+GA +A G VL+F+DSHCE  + WL PLL  I ++   +  P I+VI    F          RG F+W   F ++ +P   +     +  P  +P MAGGLFAI K +F E+G YD  +  WGGE  E+SF++WMCGG +  +PCS+VGHV+R+  P+  +G G  + RN+ R+AEVWMDD+K+  Y    ++    D GD++ +K LR+ L C SF W++  +  +L   + YPI        +G+I+           NLG                                 + CLD   K   G E  M+ CHGMG NQ
Sbjct:    1 SEKEIEKERFRLYQFNELASSKVALDRSIPDNRPQSCLSLSYPTKLPTASVIIIFHNEAWSTLLRTVHSVLARSPPYLLREIVLVDDHSRLDTYGHLGSKLESYISQ-FTKVQLIRAPKREGLIRARLIGAKQAKGEVLVFLDSHCEANLGWLEPLLARIGENRSIVVTPDIEVIDLRTFGYTHEHGANNRGIFNWELTFKWRGIPEYERRRRKSDSDPIRSPTMAGGLFAIDKSYFYEIGSYDTEMSFWGGENVEISFRIWMCGGSLEIIPCSKVGHVFRESQPYK-IGEGA-IDRNNMRLAEVWMDDYKKIFYAMRPQLKGK-DYGDVSGRKALRERLMCKSFKWYLDNVISELAIPDLYPI-------GRGEIR-----------NLGT--------------------------------NTCLDTLAKNEAGGEPGMYMCHGMGNNQ 398          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101160340])

HSP 1 Score: 484.567 bits (1246), Expect = 2.377e-164
Identity = 256/559 (45.80%), Postives = 353/559 (63.15%), Query Frame = 3
Query:  252 NILSDWKETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLP---RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCT----DV--SNEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
             + S  +    ++ +V SD   +IDW ++  +  + AR G GEQG    +T  E ++  Q    NG+N   S++IS++RS+ D+R   C+   Y   LP  +IIIPFHNE WS+LLRTVHS+++RSP +LV EIILVDD S KE L   LE+Y+ + F KVRILRT KREGLIR RLLGA  A G V+ F+DSHCE  +NWLPPLL  I  + KTI CP IDVI +++F    Q  +  RGAFDW   YKR+P    +  D+  P +PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V G G  LA+N KR+AEVWMD++ +Y+YQ+  + Y  L  GD++ QK+LR  LNC +F WFM+++A+DL + YP   +P   + G+I+S +   +C +      G P R+ +C     DV  S+ Q L F W  +I+       R +C D       +T++ CHGM GNQ W Y ++   + H VS  CID   +   + +N    +  LSQ+W+ E  N  +
Sbjct:   47 GVFSTKQGLHQKVAQVGSDGVRRIDWHDYKAMRRDAARAGNGEQGKPFPVT--ETDRVDQAYRENGFNIYVSNRISLNRSLPDIRHENCRQKLYAEKLPNTTIIIPFHNEGWSSLLRTVHSVINRSPPRLVAEIILVDDFSDKEHLKVALEEYM-KRFPKVRILRTKKREGLIRTRLLGAGAAKGEVITFLDSHCEANVNWLPPLLDRIVQNRKTIVCPMIDVIDHDNFGYDTQAGDAMRGAFDWEMYYKRIPIPAEMRTDD--PTEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPG-GISLAKNLKRVAEVWMDEYAEYVYQRRPE-YRHLSAGDMSAQKELRSHLNCKNFRWFMEEVAWDLPKHYP-PVEPPAAAWGEIRS-VGSGMCMEIKHFVSGSPIRLESCVKGRGDVSWSHGQVLTFGWREDIRVGDPMHTRKVCFDAVSHHSPVTLYDCHGMKGNQLWRYRKDK-SLFHPVSNSCIDSSASERRVFMNTCDPT-SLSQQWLFERTNDTV 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101171188])

HSP 1 Score: 480.33 bits (1235), Expect = 1.073e-162
Identity = 258/553 (46.65%), Postives = 347/553 (62.75%), Query Frame = 3
Query:  288 INEVSSDSQI------KIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQ-DEGGRGAFDWNFDYKRLP---RLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNC----TDVS--NEQNLAFTWEMEIKP----QKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            +N +  DS +      K DW +++ I  +  R G GEQG    LT  + ++  Q    NG+N   SD+IS++RS+ D+R   CK   Y   LP  SIIIPFHNE WS+LLRTVHS+L+RSP +L+ EIILVDD S K+ L   LE+Y+     KVRILRT KREGLIR RLLGA  A G V+ F+DSHCE  INWLPPLL  I  + KTI CP IDVI +++F    Q  +  RGAFDW   YKR+P    L K++  P +PF +P+MAGGLFA+ + WF ELGGYD GL++WGGEQYE+SFKVWMCGG+M D+PCSRVGH+YRK+ P+ V G G  LARN KR+AEVWMD++ +Y+YQ+  + Y  L  GD+  QK+LR  LNC SF WFMK++A+DL + YP   +P   + G+++S  +  LC +      G P R+ +C     DVS  + Q   F W  +I+       + +C D       +T++ CHGM GNQ W Y ++   + H VS  C+D   +   + +N+   +   SQ+W+ E  NA +
Sbjct:   54 VNRMGRDSLVGLGGTRKKDWHDYEAIRRDATRSGNGEQGKAFPLT--DADRVDQAYRENGFNIFVSDRISLNRSVPDIRHPNCKQKLYAERLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPQLIAEIILVDDFSDKDHLKGALEEYMVR-LPKVRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANINWLPPLLDRIALNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAELQKND--PSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPG-GVSLARNLKRVAEVWMDEYAEYVYQRRPE-YRHLSAGDVAAQKELRSTLNCKSFKWFMKEVAWDLPKHYP-PVEPPAAAWGEVRSAAS-GLCLESKHFVSGTPIRLESCVKGRADVSWGHGQVFTFGWREDIRVGDPMHTKKVCFDAVSHHSPVTLYDCHGMRGNQLWRYRKDK-SLYHPVSNSCVDSNASERRVFMNVCNPA-SASQQWLFEKTNATV 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 391.349 bits (1004), Expect = 1.152e-128
Identity = 206/513 (40.16%), Postives = 302/513 (58.87%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R++ CK   Y + LP  SI+I FHNE WSTLLRTVHS++ RSP  L+ EI+LVDD S ++FL +KLE YV      V+ILR  +R GLIRARL GA    G V+ F+D+HCE    WL PLL  I++    + CP IDVIS   F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I K++F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P++   G G  + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+AL C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +     NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ + Y+     ++HV S +C+D     + +   ++ C+   SQ+W+L NM   +
Sbjct:   56 GPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVM-RVDYGDVSSRKALREALKCKPFAWYLENI-------YPDSQIPRRYYSLGEIRN-VETNQCVD-NMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNMTLSV 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 391.349 bits (1004), Expect = 1.152e-128
Identity = 206/513 (40.16%), Postives = 302/513 (58.87%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R++ CK   Y + LP  SI+I FHNE WSTLLRTVHS++ RSP  L+ EI+LVDD S ++FL +KLE YV      V+ILR  +R GLIRARL GA    G V+ F+D+HCE    WL PLL  I++    + CP IDVIS   F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I K++F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P++   G G  + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+AL C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +     NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ + Y+     ++HV S +C+D     + +   ++ C+   SQ+W+L NM   +
Sbjct:   56 GPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVM-RVDYGDVSSRKALREALKCKPFAWYLENI-------YPDSQIPRRYYSLGEIRN-VETNQCVD-NMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNMTLSV 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 391.349 bits (1004), Expect = 1.152e-128
Identity = 206/513 (40.16%), Postives = 302/513 (58.87%), Query Frame = 3
Query:  369 GPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDW--NFDYKRLPRLSKDNAHPEK--PFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVV-GLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPEN-LSQGKIKSEINPHLCFDFNLGNP-GDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMI 1886
            GPGE G  V +  ++ EK K+L + N +N +ASD I+++RS+ D+R++ CK   Y + LP  SI+I FHNE WSTLLRTVHS++ RSP  L+ EI+LVDD S ++FL +KLE YV      V+ILR  +R GLIRARL GA    G V+ F+D+HCE    WL PLL  I++    + CP IDVIS   F      +   G F+W  NF +  +P+   D    ++  P   P MAGGLF+I K++F E+G YD G+D+WGGE  E+SF++W CGG +  V CS VGHV+RK  P++   G G  + +N++R+AEVWMD++K + Y     V   +D GD++ +K LR+AL C  F W+++ I       YP  + P    S G+I++ +  + C D N+G    +     NC  +   Q  ++T + EI+    D+CLD  R    + M  CH M GNQ + Y+     ++HV S +C+D     + +   ++ C+   SQ+W+L NM   +
Sbjct:   56 GPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVM-RVDYGDVSSRKALREALKCKPFAWYLENI-------YPDSQIPRRYYSLGEIRN-VETNQCVD-NMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTD--DLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQWLLRNMTLSV 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000027520.1 (SMESG000027520.1)

HSP 1 Score: 1184.86 bits (3064), Expect = 0.000e+0
Identity = 593/594 (99.83%), Postives = 593/594 (99.83%), Query Frame = 3
Query:  135 MGFISGSVGIRSFSNKMXXXXXXXXXXXXXXXXXXXXXQNILSDWKETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENMNAMIANHLWKEIKL 1916
            MGFISGSVGIRSFSNKMLRIKLKKILLFFIVLLGIFLIQNILSDWKETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRK SQKWILENMNAMIANHLWKEIKL
Sbjct:    1 MGFISGSVGIRSFSNKMLRIKLKKILLFFIVLLGIFLIQNILSDWKETSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKSSQKWILENMNAMIANHLWKEIKL 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000070134.1 (SMESG000070134.1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 268/527 (50.85%), Postives = 364/527 (69.07%), Query Frame = 3
Query:  321 IDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYP-IQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSN----EQNLAFTWEMEIKPQKRDICLDYPRK--GEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLS-QKWILENMN 1877
            +DW N+  I+EE  R GPGEQG GV +   E E+ +++ + NGY+  ASDKIS+ RS++D+R   CK LKY   LP  S+IIPFH EHWS L+RTV S++ R+P  L+KE+ILVDD S K FL + LE ++ EH+   ++LRT  R+GLIR R+LGA EA G VLIF+DSH E  +NWLPPLL+PI  +YKT++CPFIDVI+Y+ F    QDEG RG FDWNFDYKR+PR   D +HP  PF +P+MAGGLFAIS+ WF ELGGYD GLD+WGGEQYE+SFK+W CGGKM+DVPCSR+GHVYRK++PF     GN+++RN KR+AEVWMD++K+Y+Y +   + +  DP +LT Q  +R+ L+C +F WFMK++A+DL+  YP I+  P    + K+ +  N  +C DF   + G    +S C  V++    EQN   +W+ EIKP+ RD+C+D      G  + +F CHG  GNQ + Y   S QI+ V S  C++   +P S  I +Q C+  ++ QKWI  ++N
Sbjct:   66 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDVPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNE-DPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLE--GDPASKHIALQTCNETITDQKWIWTSVN 589          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000077709.1 (SMESG000077709.1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 272/536 (50.75%), Postives = 367/536 (68.47%), Query Frame = 3
Query:  303 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK-VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPF-AVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEI----NPHLCFDFNLGNPGDPFRISNC----TDVSNEQNLAFTWEMEIKPQKRDICLDYPRK--GEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLSQKWILENM 1874
            +D + KIDW N+  I EE+ R G GE G  V L ++EN   + + + NG+N LASDK++++RS+KD+R   CK + Y   LP  SIIIPF+ EHWSTLLRT  S L R+P  LVKEIILVDD STKEFL +KL+QY+  +F   VR+LR  KREGLIR RL GA  A G VLIF+DSHCE  INWLPPLL PI   Y+T++CPFIDV+ ++ F  R QDEG RGAFDW F YKRLP L +D  +P +PF +P+MAGGLFAIS+ WF ELGGYD GLD+WGGEQYELSFK+W CGG+M+D PCSR+ HVYRK+ PF +VV +GN++ARN+KR+AEVWMD++++Y+Y++ Q  +   + GDLT Q  +R+ L C SF WFM +IA+DL + YP   +P N + G+++S++       LC D          R++ C    + ++ EQ    TW  +++ + RD CLD P+      + ++SCHG  GNQ W Y  +S Q+ HVV++KC+      +S+ ++   C+   +QKW LEN+
Sbjct:   52 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCEANINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRR-QPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYP-SVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDT--CTSSSNQKWYLENV 583          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 507.679 bits (1306), Expect = 5.700e-174
Identity = 254/544 (46.69%), Postives = 359/544 (65.99%), Query Frame = 3
Query:  276 TSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYN-ALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDV-----SNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLS-QKWILENMNAMI 1886
            +S +I    S ++ K++  NH   D+EN R             +N N   K++  T  +N +   +K+S++R+I +L+I KCKWL+++  LP  SIII F++  W TL++T   +L RSP +L+KEI+++DDN+    +  K+  YVS+HFT VR++   KREGLI+ARLLGA  A G VL+F+DSHC VG+ WLPPLL+PI+++YKT++CPFID I+  D SL  QDEG RGAFDWNF+Y RLPRL  +   PE PF NPIM G +FAI++ WF ELGGYD GL++WGGEQ+ELSFK+WMCGG+MV+VPCSR+  +++    F  +     + +N+KRIAE+WMD+WK++IYQ+H + YSS D GD+++QKKL++ LNC SFDWFM+ +AYD+L  YP     E L+   I  E +  +C D      GD   I  C  +     + EQ  +FT + EI+P +R++C DY    E L +  C  M  NQKW YN  SHQI ++ S+KCI  + N +SL + +  CS   + QKWI++  +AMI
Sbjct:   23 SSFQIQSALSKNEHKLE--NHGLSDQENIRN-----------LSNINLMMKRMHSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFID-INDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLN-CSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI--KVNSKSLLLLVNNCSLSSTMQKWIIQ--DAMI 547          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 479.945 bits (1234), Expect = 1.933e-163
Identity = 244/544 (44.85%), Postives = 346/544 (63.60%), Query Frame = 3
Query:  276 TSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYN-ALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDV-----SNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKLS-QKWILENMNAMI 1886
            +S +I    S ++ K++  NH   D+EN R             +N N   K++  T  +N +   +K+S++R+I +L+I KCKWL+++  LP  SIII F++  W TL++T   +L RSP +L+KEI+++DDN+    +  K+  YVS+HFT VR++   KREGLI+ARLLGA  A G VL+F+DSHC VG+ WLPPLL+PI+++YKT                   DEG RGAFDWNF+Y RLPRL  +   PE PF NPIM G +FAI++ WF ELGGYD GL++WGGEQ+ELSFK+WMCGG+MV+VPCSR+  +++    F  +     + +N+KRIAE+WMD+WK++IYQ+H + YSS D GD+++QKKL++ LNC SFDWFM+ +AYD+L  YP     E L+   I  E +  +C D      GD   I  C  +     + EQ  +FT + EI+P +R++C DY    E L +  C  M  NQKW YN  SHQI ++ S+KCI  + N +SL + +  CS   + QKWI++  +AMI
Sbjct:   23 SSFQIQSALSKNEHKLE--NHGLSDQENIRN-----------LSNINLMMKRMHSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKT-------------------DEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLN-CSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI--KVNSKSLLLLVNNCSLSSTMQKWIIQ--DAMI 529          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT104.403e-16347.68polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL62.109e-16146.58polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL62.551e-16146.58polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT133.231e-12740.39polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNTL64.351e-12447.71polypeptide N-acetylgalactosaminyltransferase like... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-101.248e-16647.56Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-109.966e-16647.56Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-51.337e-11941.65Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-51.337e-11941.65Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-51.337e-11941.65Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant63.586e-15644.91gene:FBgn0035375 transcript:FBtr0072973[more]
Pgant63.586e-15644.91gene:FBgn0035375 transcript:FBtr0333442[more]
Pgant63.586e-15644.91gene:FBgn0035375 transcript:FBtr0072972[more]
Pgant43.460e-14144.02gene:FBgn0051956 transcript:FBtr0333248[more]
Pgant43.460e-14144.02gene:FBgn0051956 transcript:FBtr0114524[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL65.648e-16046.78si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
GALNTL65.648e-16046.78si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
galnt135.911e-12940.16UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt11.372e-12538.90UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt11.372e-12538.90UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL62.148e-16446.95polypeptide N-acetylgalactosaminyltransferase like... [more]
galnt102.066e-15645.29polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt102.066e-15645.29polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL63.095e-15645.98polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL65.093e-14947.64polypeptide N-acetylgalactosaminyltransferase like... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galnt103.079e-16448.22polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
Galntl62.417e-16246.95UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
Galnt135.300e-12740.20polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
Galnt135.300e-12740.20polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
Galnt135.300e-12740.20polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8Y236|GLT10_CAEBR4.845e-16748.97Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|O45947|GLT10_CAEEL1.291e-16447.56Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|Q6P9S7|GLT10_MOUSE2.154e-16348.22Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
sp|Q925R7|GLT10_RAT1.857e-16248.03Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
sp|Q86SR1|GLT10_HUMAN2.115e-16247.68Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433U8J10.000e+052.79Polypeptide N-acetylgalactosaminyltransferase OS=E... [more]
A0A2C9JLV60.000e+051.70Polypeptide N-acetylgalactosaminyltransferase OS=B... [more]
V4ALX20.000e+053.13Polypeptide N-acetylgalactosaminyltransferase OS=L... [more]
A0A1I8GGZ30.000e+052.25Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A1W0WCD20.000e+051.50Polypeptide N-acetylgalactosaminyltransferase OS=H... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-15e22.32.144e-16146.59polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT101.953e-15646.88polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt138.490e-13040.55polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt11.610e-12639.10polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt132.018e-12539.58polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000477.11.577e-11139.66pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
galnt121.445e-10338.73UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt116.473e-9833.93UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
poc1bl4.457e-9737.88POC1 centriolar protein homolog B (Chlamydomonas),... [more]
ENSPMAT00000008097.15.359e-8936.40pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310351.570e-12040.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343551.546e-11337.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372661.398e-11139.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458291.823e-10637.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458305.279e-10140.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT102.377e-16445.80polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNT101.073e-16246.65polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt131.152e-12840.16polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt131.152e-12840.16polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt131.152e-12840.16polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027520.10.000e+099.83SMESG000027520.1[more]
SMESG000070134.10.000e+050.85SMESG000070134.1[more]
SMESG000077709.10.000e+050.75SMESG000077709.1[more]
SMESG000021519.15.700e-17446.69SMESG000021519.1[more]
SMESG000021519.11.933e-16344.85SMESG000021519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009489 ID=SMED30009489|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1945bp
CAATTTAAATTGAATATTCAAGATTAACTCAAATTTATTAAACGATTGTA
GAATTTCTGTGAAAGGATTAAGGCGAAATCTCGAACTCCTGGGAGCTAGT
CCAAGCTGTTACAATAGGATATATATCGTGACATATGGGATTCATTAGTG
GCAGTGTTGGAATCCGTTCATTTAGCAATAAAATGCTACGAATAAAATTG
AAAAAGATTTTACTGTTTTTCATTGTGCTCCTTGGAATATTTCTGATACA
AAATATTTTATCGGATTGGAAAGAAACGTCAGATGAAATAAATGAGGTCT
CCAGTGATTCTCAAATTAAAATAGACTGGGCAAACCATGATACAATAGAT
GAAGAAAACGCAAGAGTAGGCCCGGGAGAACAAGGAATAGGAGTGTATTT
GACTGCTAATGAAAATGAAAAGGCGAAACAGCTCATGGAAACTAACGGGT
ACAATGCGCTGGCATCAGACAAAATATCTGTCCACCGTTCTATTAAAGAT
CTGAGAATAAATAAATGCAAATGGCTGAAATATGATAATTTTCTCCCTCC
GGCGTCAATCATCATTCCATTTCACAATGAACATTGGTCAACTCTGCTGC
GAACTGTCCACTCAATACTGCACAGATCTCCCGACAAATTAGTGAAAGAG
ATCATTCTTGTCGATGACAATAGCACGAAAGAGTTTCTTGGCGAAAAGCT
TGAACAATATGTTTCAGAGCATTTTACAAAGGTTCGTATTTTGCGTACTG
GTAAAAGGGAAGGTTTAATCAGAGCCAGGTTATTAGGAGCGAATGAAGCA
AACGGTACTGTGCTGATATTCATCGATTCTCACTGTGAAGTAGGTATAAA
TTGGCTTCCCCCTCTACTTCAGCCAATTAGAGACCATTACAAGACGATTT
CATGTCCATTTATCGATGTAATTAGTTATAATGATTTCTCTTTACGTCCT
CAAGATGAAGGAGGCAGAGGAGCTTTTGATTGGAATTTTGATTATAAACG
ACTCCCTCGTTTATCGAAAGACAATGCTCACCCAGAAAAACCATTTTATA
ATCCAATTATGGCTGGAGGACTTTTTGCGATAAGTAAATTATGGTTCAAT
GAACTTGGCGGTTATGATTACGGGCTCGATGTTTGGGGAGGTGAACAATA
TGAGTTATCTTTCAAGGTGTGGATGTGTGGTGGTAAAATGGTTGATGTGC
CATGCTCTAGAGTTGGTCACGTGTACCGAAAGTTTAACCCTTTTGCAGTA
GTGGGTTTAGGAAACTATTTAGCTAGAAATCACAAACGGATAGCTGAAGT
GTGGATGGATGATTGGAAGCAATATATATATCAGAAACATCAAAAAGTAT
ATTCCTCATTGGATCCAGGAGATTTGACTGAGCAGAAAAAGTTGAGAAAG
GCATTAAATTGTACCTCTTTCGATTGGTTTATGAAACAGATTGCCTATGA
CCTTTTAGAAAAATATCCGATTCAAAAGCAACCAGAAAATTTATCACAAG
GGAAGATCAAATCAGAAATTAATCCTCACTTGTGTTTTGATTTCAATTTG
GGAAATCCCGGGGATCCATTTCGGATTTCCAATTGTACTGATGTCAGTAA
TGAGCAGAATTTGGCTTTTACGTGGGAGATGGAAATTAAGCCCCAGAAAA
GAGATATCTGCCTGGATTATCCAAGGAAAGGAGAAGAATTGACAATGTTT
AGTTGCCATGGAATGGGCGGAAATCAGAAATGGATATATAATCAGAATTC
TCATCAGATTGTCCACGTTGTCAGTAAGAAATGCATCGACTACCGCTATA
ATCCAGAAAGCCTTGAAATAAACATTCAAAAATGCTCCCGAAAATTGTCT
CAGAAATGGATCCTGGAAAATATGAATGCGATGATTGCAAATCATCTTTG
GAAAGAAATAAAATTGTAAATAGATGGAGATTCGATTGTCTGTCA
back to top

protein sequence of SMED30009489-orf-1

>SMED30009489-orf-1 ID=SMED30009489-orf-1|Name=SMED30009489-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=595bp
MGFISGSVGIRSFSNKMLRIKLKKILLFFIVLLGIFLIQNILSDWKETSD
EINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQL
METNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEH
WSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKV
RILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRD
HYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHP
EKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGG
KMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQ
KHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQP
ENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSNEQNLAFTWEME
IKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKC
IDYRYNPESLEINIQKCSRKLSQKWILENMNAMIANHLWKEIKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR035992Ricin_B-like_lectins
IPR000772Ricin_B_lectin
IPR001173Glyco_trans_2-like
IPR027791Galactosyl_T_C
IPR029044Nucleotide-diphossugar_trans
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000772Ricin B, lectin domainSMARTSM00458ricin_3coord: 456..578
e-value: 9.6E-19
score: 78.3
IPR000772Ricin B, lectin domainPFAMPF00652Ricin_B_lectincoord: 455..575
e-value: 1.1E-21
score: 77.4
IPR000772Ricin B, lectin domainPROSITEPS50231RICIN_B_LECTINcoord: 454..578
score: 20.49
IPR000772Ricin B, lectin domainCDDcd00161RICINcoord: 456..577
e-value: 1.72573E-23
score: 94.1094
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 141..287
e-value: 1.0E-29
score: 103.5
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 451..584
e-value: 5.7E-29
score: 102.7
NoneNo IPR availablePANTHERPTHR11675:SF23N-ACETYLGALACTOSAMINYLTRANSFERASE 4-RELATEDcoord: 53..590
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 53..590
NoneNo IPR availableCDDcd02510pp-GalNAc-Tcoord: 141..437
e-value: 8.09052E-165
score: 469.763
NoneNo IPR availableTMHMMTMhelixcoord: 25..42
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 59..447
e-value: 3.3E-160
score: 535.0
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 117..439
IPR035992Ricin B-like lectinsSUPERFAMILYSSF50370Ricin B-like lectinscoord: 451..579