TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30009482
Length (bp)1570
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30009482) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30009482) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30009482) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30009482) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009482

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009482SMESG000067336.1 dd_Smed_v4_3952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009482SMESG000067336.1 dd_Smed_v4_3952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009482SMESG000067336.1 dd_Smed_v6_3952_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30009482SMESG000067336.1 dd_Smed_v4_3952_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009482SMESG000067336.1 dd_Smed_v4_3952_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30009482SMESG000067336.1 dd_Smed_v4_3952_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 113.62 bits (283), Expect = 2.713e-26
Identity = 61/150 (40.67%), Postives = 86/150 (57.33%), Query Frame = 1
Query: 1081 FLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            F+WKI ++  K   A +G +  +FS  FY  R GYKMCLRI  NGD   RGTH SLFF +MKG  D  L+WPF   VTL + + + R  +  D   F  D  S +++RPV+D +    G P F  +S++   +  +++D I IK  V +T
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNR-EHVIDA--FRPDVTSSSFQRPVNDMNI-ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLT 499          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 112.079 bits (279), Expect = 3.833e-26
Identity = 95/366 (25.96%), Postives = 162/366 (44.26%), Query Frame = 1
Query:  439 EENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSEL--IKHSDLIQNDRILIKCKVHVT 1530
            E    CPF  VGC + +     ++ H       H  +L+ F+       +   R    L+     L++ L  +++    +    L++      C+  ++E   + F    K K +     +LR ++    N    L+++ + S     T  ++S       + +     RV    Q L  K  +++  +E S     +RL+E  +F+       FLWKI N   +   +  G    +FS  FY  + GYK+CLR+  NGD   + TH SLF  +M+G+YD  L WPFRN VT  + + + R         F  D  S +++RP  +T+    G P F  LS+L   KH+  +++D + +KC V  +
Sbjct:   83 EAGIGCPFAGVGC-SFKGSPQSVQEHEVTSQTSHLNLLLGFMK------QWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHF---MKEKLLAELEGKLRVFE----NIVAVLNKEVEASHLALATSIHQS---QLDRERILSLEQRVVELQQTLAQKD-QALGKLEQS-----LRLMEEASFD-----GTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID---AFRPDLSSASFQRPQSETNV-ASGCPLFFPLSKLQSPKHA-YVKDDTMFLKCIVETS 415          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 112.079 bits (279), Expect = 3.833e-26
Identity = 95/366 (25.96%), Postives = 162/366 (44.26%), Query Frame = 1
Query:  439 EENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSEL--IKHSDLIQNDRILIKCKVHVT 1530
            E    CPF  VGC + +     ++ H       H  +L+ F+       +   R    L+     L++ L  +++    +    L++      C+  ++E   + F    K K +     +LR ++    N    L+++ + S     T  ++S       + +     RV    Q L  K  +++  +E S     +RL+E  +F+       FLWKI N   +   +  G    +FS  FY  + GYK+CLR+  NGD   + TH SLF  +M+G+YD  L WPFRN VT  + + + R         F  D  S +++RP  +T+    G P F  LS+L   KH+  +++D + +KC V  +
Sbjct:   83 EAGIGCPFAGVGC-SFKGSPQSVQEHEVTSQTSHLNLLLGFMK------QWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHF---MKEKLLAELEGKLRVFE----NIVAVLNKEVEASHLALATSIHQS---QLDRERILSLEQRVVELQQTLAQKD-QALGKLEQS-----LRLMEEASFD-----GTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID---AFRPDLSSASFQRPQSETNV-ASGCPLFFPLSKLQSPKHA-YVKDDTMFLKCIVETS 415          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 113.235 bits (282), Expect = 4.427e-26
Identity = 97/398 (24.37%), Postives = 183/398 (45.98%), Query Frame = 1
Query:  385 CRFKDDLIAVEEHSKTCNEENFECPFIDVGCRN---------NQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDV-----NQVLKKELKI--VKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            C+ +  +IA+++H      E+ +CP + V C +         ++    +I++H       H  +L E+  ++  ++ +L+ E +E         NQ+   E++I   K  L + +  IL LQ   +    K  E  +++   R+  +    E D ++S  E   N   +L E  D+S  +             ++ G+ +  +    RH  +      SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +  +   +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:  180 CKSQVPMIALQKH------EDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWE----EADSMKSSVESLQNRVTEL-ESVDKSAGQVA-----------RNTGLLESQLS---RHDQM-----LSVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 538          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 113.235 bits (282), Expect = 4.427e-26
Identity = 97/398 (24.37%), Postives = 183/398 (45.98%), Query Frame = 1
Query:  385 CRFKDDLIAVEEHSKTCNEENFECPFIDVGCRN---------NQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDV-----NQVLKKELKI--VKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            C+ +  +IA+++H      E+ +CP + V C +         ++    +I++H       H  +L E+  ++  ++ +L+ E +E         NQ+   E++I   K  L + +  IL LQ   +    K  E  +++   R+  +    E D ++S  E   N   +L E  D+S  +             ++ G+ +  +    RH  +      SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +  +   +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:  180 CKSQVPMIALQKH------EDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWE----EADSMKSSVESLQNRVTEL-ESVDKSAGQVA-----------RNTGLLESQLS---RHDQM-----LSVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 538          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 72.4034 bits (176), Expect = 2.511e-13
Identity = 46/151 (30.46%), Postives = 79/151 (52.32%), Query Frame = 1
Query: 1078 EFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTR------LPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIK 1512
            + +WKI+  + +   AKSG  T +FS PF  +R GYKM       GD  + G   SL+  L+KG++D  L+WPF   + +S+ + + R      + Y  D  K   +++ +A  RP  + +A   G   F SL+ L    + +++D+I ++
Sbjct:  264 QLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLA--RPRGERNA-AFGSQSFCSLAIL---QNYVKDDKIYVQ 408          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 61.2326 bits (147), Expect = 5.367e-10
Identity = 28/59 (47.46%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1147 VFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSI 1323
            ++S PFY +  GYKM     P GD      + S+F  LMKG++D+ L+WPFR DVT SI
Sbjct:  183 IYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSI 241          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 91.2781 bits (225), Expect = 2.695e-19
Identity = 45/149 (30.20%), Postives = 75/149 (50.34%), Query Frame = 1
Query: 1075 NEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
               LWKI +W +K+  A+     E+ S PFY  + GYK+   +  NG+     TH S++  ++ G+YD  LKWPF + +T ++     +         F  D     ++RP ++    G G+P+FIS  EL+     I+ D + ++ KV
Sbjct:  322 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 90.8929 bits (224), Expect = 3.757e-19
Identity = 45/149 (30.20%), Postives = 75/149 (50.34%), Query Frame = 1
Query: 1075 NEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
               LWKI +W +K+  A+     E+ S PFY  + GYK+   +  NG+     TH S++  ++ G+YD  LKWPF + +T ++     +         F  D     ++RP ++    G G+P+FIS  EL+     I+ D + ++ KV
Sbjct:  331 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 61.2326 bits (147), Expect = 1.104e-9
Identity = 39/151 (25.83%), Postives = 74/151 (49.01%), Query Frame = 1
Query: 1081 FLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHA-SLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
             +W+IE   + V   ++    +V+S   Y   +GYK C R+    +   R  H  SL  HLM+ + D  L WPF+  + L + + +       DT+      + +A+ +P    S  G G+ ++ ++S +I+      +DR+LIK ++++ 
Sbjct:  332 IVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARL----NIQPRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIM--TKPEILAFHKPREAISTRGFGFLEYANISNIIQ-LGFCADDRLLIKIEINIV 475          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 119.783 bits (299), Expect = 2.211e-28
Identity = 105/392 (26.79%), Postives = 172/392 (43.88%), Query Frame = 1
Query:  385 CRFKDDLIA-VEEHSKTCNEENFECPFIDVGC--RNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVN----------LNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
            C F   L + +  H   C +    C FI  GC  +    ++ E ES    E   H +M+     T+  ++E +K E++E   V   L   L  V+            L  K V++  L +SH+    K  E + ++  LR   + M+ E++ LR   E   +    LD     S   + TL   SL                  RH +L      SV ++ ++     ++++E  +F         +WKI ++K +   A       ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L+WPF+  VTL + +      +  D   F  D  S ++ RP  + +    G P F++ + ++++   I++D I IK  V
Sbjct:  210 CSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLNQEMREHESSFASE---HLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHS---EKLLEVEMELRELR-PLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLA--SLEQQLT-------------RHDDL-----MSVHDVRLAEMDLKLQVLETASFN-----GTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDA--FKPDPSSSSFRRPTGEMNI-ASGCPLFVAQT-VLENGTYIKDDTIFIKVTV 565          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 114.775 bits (286), Expect = 2.786e-28
Identity = 67/180 (37.22%), Postives = 96/180 (53.33%), Query Frame = 1
Query:  991 SVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
             ++++ I    + MR +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I++D I IK  V +T
Sbjct:  103 GLRDLSIVEMEAKMREMSAATYD-----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDISSSSFQRPVSDMN-IASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 273          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 114.775 bits (286), Expect = 2.786e-28
Identity = 67/180 (37.22%), Postives = 96/180 (53.33%), Query Frame = 1
Query:  991 SVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
             ++++ I    + MR +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I++D I IK  V +T
Sbjct:  103 GLRDLSIVEMEAKMREMSAATYD-----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDISSSSFQRPVSDMN-IASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 273          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 113.62 bits (283), Expect = 7.235e-28
Identity = 66/180 (36.67%), Postives = 96/180 (53.33%), Query Frame = 1
Query:  991 SVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
             VK++ ++     +R +   TF+       F+W+I ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + S R  +  D   F  D  S +++RPV + +    G P F  L++L   +  I++D I IK  V +T
Sbjct:  109 GVKDLTVAEMEGRLREMSATTFD-----GVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQSNR-EHIIDA--FRPDITSSSFQRPVSEMN-IASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVDLT 279          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 117.857 bits (294), Expect = 1.250e-27
Identity = 112/407 (27.52%), Postives = 174/407 (42.75%), Query Frame = 1
Query:  418 EHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELK-----DVNQVLKK-ELKIVKVNLNSKQV----------------------------AILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETL--KYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +H K C +    C F  VGC     K  +I  H    +Y H  +L+ FIM +   +E L+ + +EL      +++Q L++ ELK+ ++      V                            A L+LQ       +K  E  ++   L  K  T +  +  L    ER + +    + ++    D+ E L  K R L                         + +  ++++ I    + MR +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I++D I IK  V +T
Sbjct:  204 DHIKLCTKFRTPCRFHVVGCDMTVEK-EKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIHELHQSLRELELKMGQLCGAGASVQGACALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSE--KTKVVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQL-------------------------ERTVGLRDLSIVEMEAKMREMSAATYD-----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDISSSSFQRPVSDMNI-ASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 573          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 108.997 bits (271), Expect = 2.702e-25
Identity = 57/149 (38.26%), Postives = 87/149 (58.39%), Query Frame = 1
Query: 1081 FLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSEL--IKHSDLIQNDRILIKCKV 1521
            FLWKI +  +K   A +G    ++S  FY  + GYK+CLRI  NGD   +GTH SLFF +MKG+YD  L WPF++ VT  + +H+ R   F     F  D  S +++RP++D +    G P F  +++L   KH+  I+ + + I+C +
Sbjct:  232 FLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRDSVFD---AFRPDVTSASFQRPINDMNV-ASGCPLFCPIAKLNSPKHA-YIRENTLYIRCII 375          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 109.768 bits (273), Expect = 3.899e-25
Identity = 77/258 (29.84%), Postives = 124/258 (48.06%), Query Frame = 1
Query:  757 SLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +L +KN T +  +  L    ER S+++ +L  +   + ++ E L  +   ++                     T   K +   E+ TR   M+  E+ T++       F+WKI  +  K   A +G    +FS PFY  + GYKMCLRI  NGD   R TH SLFF +MKG+ D  L+WPF   VTL + + + R  +  D   F  D  S +++RP+ + +    G P F  +S+L   +  +++D I +K  V +T
Sbjct:  254 TLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLE--------------------RTLGQKELIVAELETR---MQESELSTYD-----GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR-EHVIDA--FRPDVSSSSFQRPISEMNI-ASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDLT 479          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 109.383 bits (272), Expect = 7.056e-25
Identity = 117/528 (22.16%), Postives = 211/528 (39.96%), Query Frame = 1
Query:  142 IADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPC-------PNSKKF----CKDSLLNIHQNI--------ELDRAVNVLI-----------SCLDFKCS-------------------KLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRN---------NQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKK-------ELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            + +++KC  CR ++       CG R+C  C+ + L+     C          K F    C+  +L +            EL    N+LI           SC    C                    + PC+F  + + + E  K    E+ +CP + + C +         ++    +I++H       H  ++ E+   +  ++ ML+ E  E     Q+L         E++  K  L + +  I+QLQ                        + ++ + D+L+  D+   N     DE  D      E+L+ R   ++   K        V     N H +   SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  V+L + +      +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:   42 VEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQK---HEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQ------------------------RVIEGQADKLKDLDKEIRNLRQTGDEA-DGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQML-SVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 108.227 bits (269), Expect = 1.226e-24
Identity = 82/270 (30.37%), Postives = 126/270 (46.67%), Query Frame = 1
Query:  721 NSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            ++K  E   K  +L +KN T +  +  L    ER S+++    E+  R L   +T   R+L                            K +   E+ TR   M+  E+ T++       F+WKI  +  K   A +G    +FS PFY  + GYKMCLRI  NGD   R TH SLFF +MKG+ D  L+WPF   VTL + + + R  +  D   F  D  S +++RP+ + +    G P F  +S+L   +  +++D I +K  V +T
Sbjct:  225 SAKVAEMLLKFDTLDKKNTTFENIVSVLNREVERSSHAA----EELARQLRAADTRLERTL--------------------------GQKELIVAELETR---MQESELSTYD-----GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR-EHVIDA--FRPDVSSSSFQRPISEMNI-ASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDLT 452          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 108.227 bits (269), Expect = 2.416e-24
Identity = 106/435 (24.37%), Postives = 187/435 (42.99%), Query Frame = 1
Query:  256 ERPCPNSKKFCKDS--LLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIA-VEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKK-------ELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            E PC    KFC++   L+ + ++ ++D   +V+ISC         C  K  L + +  H   C      C F   GC   +    +I++H       H  ++ E+   +  ++ ML+ E  E     Q+L         E++  K  L + +  I+QLQ                        + ++ + D+L+  D+   N     DE  D      E+L+ R   ++   K        V     N H +   SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  V+L + +      +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:  169 ETPC----KFCRNQVPLVEMQKHEDVD-CPSVVISCPHM------CSVKSLLRSELNAHLLECVNAPSTCSFKRYGC-TFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQ------------------------RVIEGQADKLKDLDKEIRNLRQTGDEA-DGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQML-SVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 556          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 120.939 bits (302), Expect = 6.281e-29
Identity = 123/511 (24.07%), Postives = 210/511 (41.10%), Query Frame = 1
Query:  139 QIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNS--KKFCKDSLLNIHQNIEL-DRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQA--KLNEIESHLFQENY-------------------VHSKMLMEFIMTMSN-EMEMLKREVI----------------------ELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            ++  ++ CS C+ ++ +     CG RYC  C+ S L+   + C     +   ++ +  +  +    D A    +  L   C    C +K  L   E    +C+E    CPF+   C   +   +L+E E H  QE                     VH ++  +F +T      + + RE                        E+ +   +   EL+ ++ +L     + L+ QAS    N    E  Q+   L +K  T +  +  L    ER + ++     ++    D+ E L  +   ++                        S  +K++ ++     +  +E+ T++       F+WKI ++  K   A +G    +FS  FY  R GYKMCLR+  NGD   RGTH SLFF +MKG  D  L+WPF   VTL + +H+ R  +  D   F  D  S +++RPV D +    G P F  +S++   +  +++D I IK  V +T
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYE----SCHEG--LCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLE-----------------------RSIGLKDLAMADLEQKVSELEVSTYD-----GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDA--FRPDVTSSSFQRPVSDMNI-ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLT 499          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 117.857 bits (294), Expect = 7.012e-28
Identity = 124/518 (23.94%), Postives = 208/518 (40.15%), Query Frame = 1
Query:  139 QIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLN--IHQNIEL--------DRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQA--KLNEIESHLFQEN-------------------YVHSKMLMEFIMTMSN-EMEMLKREVI----------------------ELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            ++  ++ CS C+ ++ +     CG RYC  C+ S L        +  + C   +      + I +        D A    +  L   C    C +K  L   E    +C+E    CPF+   C   +   +L+E E H  QE                     VH ++  +F +T      + + RE                        E+ +   +   EL+ ++ +L     + L+ QAS    N    E  Q+   L +K  T +  +  L    ER + ++     ++    D+ E L  +   ++                        S  +K++ ++     +  +E+ T++       F+WKI ++  K   A +G    +FS  FY  R GYKMCLR+  NGD   RGTH SLFF +MKG  D  L+WPF   VTL + +H+ R  +  D   F  D  S +++RPV D +    G P F  +S++   +  +++D I IK  V +T
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYE----SCHEG--LCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLE-----------------------RSIGLKDLAMADLEQKVSELEVSTYD-----GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDA--FRPDVTSSSFQRPVSDMNI-ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLT 506          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 114.005 bits (284), Expect = 2.070e-26
Identity = 121/526 (23.00%), Postives = 217/526 (41.25%), Query Frame = 1
Query:  142 IADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCP-----------------------------NSKKFCKDSLLNIHQNIELDRAVNVL-ISCLDFKCSKLPCRFKDDLIAVEEHSK----TCNE-------------ENFECPFIDVGCRN---------NQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDV-----NQVLKKELKI--VKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            + D++KC  CR ++       CG R+C  C+ + L+     C                              N  + C + L   H  + L        + CL   C +   R KD    VE+  K    TC+              E+ +CP + V C +         ++    +I++H       H  +L E+  ++  ++ +L+ E +E         NQ+   E++I   K  L + +  IL LQ   +    K  E  +++   R+  +    E D ++S  E   N   +L E  D+S  +             ++ G+ +  +    RH  +      SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +  +   +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:   46 VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLR-KDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWE----EADSMKSSVESLQNRVTEL-ESVDKSAGQAA-----------RNTGLLESQLS---RHDQML-----SVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 537          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 114.005 bits (284), Expect = 2.070e-26
Identity = 121/526 (23.00%), Postives = 217/526 (41.25%), Query Frame = 1
Query:  142 IADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCP-----------------------------NSKKFCKDSLLNIHQNIELDRAVNVL-ISCLDFKCSKLPCRFKDDLIAVEEHSK----TCNE-------------ENFECPFIDVGCRN---------NQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDV-----NQVLKKELKI--VKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            + D++KC  CR ++       CG R+C  C+ + L+     C                              N  + C + L   H  + L        + CL   C +   R KD    VE+  K    TC+              E+ +CP + V C +         ++    +I++H       H  +L E+  ++  ++ +L+ E +E         NQ+   E++I   K  L + +  IL LQ   +    K  E  +++   R+  +    E D ++S  E   N   +L E  D+S  +             ++ G+ +  +    RH  +      SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +  +   +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:   46 VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLR-KDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWE----EADSMKSSVESLQNRVTEL-ESVDKSAGQAA-----------RNTGLLESQLS---RHDQML-----SVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 537          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 111.694 bits (278), Expect = 1.332e-25
Identity = 103/403 (25.56%), Postives = 182/403 (45.16%), Query Frame = 1
Query:  343 VLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDV-----NQVLKKELKI--VKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            V++SC   KCS +    + +L A   H   C      C F   GC   Q    +I++H       H  +L E+  ++  ++ +L+ E +E         NQ+   E++I   K  L + +  IL LQ   +    K  E  +++   R+  +    E D ++S  E   N   +L E  D+S  +             ++ G+ +  +    RH  +      SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +  +   +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:  199 VVVSC-PHKCS-VQTLLRSELSA---HLSECVNAPSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWE----EADSMKSSVESLQNRVTEL-ESVDKSAGQAA-----------RNTGLLESQLS---RHDQML-----SVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 562          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.393e-28
Identity = 123/511 (24.07%), Postives = 210/511 (41.10%), Query Frame = 1
Query:  139 QIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNS--KKFCKDSLLNIHQNIEL-DRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQA--KLNEIESHLFQENY-------------------VHSKMLMEFIMTMSN-EMEMLKREVI----------------------ELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            ++  ++ CS C+ ++ +     CG RYC  C+ S L+   + C     +   ++ +  +  +    D A    +  L   C    C +K  L   E    +C+E    CPF+   C   +   +L+E E H  QE                     VH ++  +F +T      + + RE                        E+ +   +   EL+ ++ +L     + L+ QAS    N    E  Q+   L +K  T +  +  L    ER + ++     ++    D+ E L  +   ++                        S  +K++ ++     +  +E+ T++       F+WKI ++  K   A +G    +FS  FY  R GYKMCLR+  NGD   RGTH SLFF +MKG  D  L+WPF   VTL + +H+ R  +  D   F  D  S +++RPV D +    G P F  +S++   +  +++D I IK  V +T
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYE----SCHEG--LCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLE-----------------------RSIGLKDLAMADLEQKVSELEVSTYD-----GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDA--FRPDVTSSSFQRPVSDMNI-ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLT 499          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.870e-26
Identity = 97/379 (25.59%), Postives = 167/379 (44.06%), Query Frame = 1
Query:  412 VEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSL--PMDYKHKGVCKRYIRVNPRHQNL---HTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDL-IQNDRILIKCKVHVT 1530
            V EH   C E   +CPF   GC     + N +E                      +E   L+  ++ + + N  L++ +  +  +L  K+  I QL  +      +  +F Q MF    +N T  + +  L S+ ++ +     + +       +   L  RSL   +D     V +R  ++    Q L     ++SK   +I I            +  E      + +WK+ +++ K   A  G    VFS PFY  R GY++C R   NGD   +GTH SL+F +M+G++D+ L+WPFR  VTL + + S +  +  +T  F  D  S +++RP  + +    G P+F+S S L    +  I++D + +K  V +T
Sbjct:  208 VNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLE----------------------HERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQ-MFG---RNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVD----SVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNI-ASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDLT 553          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.303e-25
Identity = 61/150 (40.67%), Postives = 86/150 (57.33%), Query Frame = 1
Query: 1081 FLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            F+WKI ++  K   A +G +  +FS  FY  R GYKMCLRI  NGD   RGTH SLFF +MKG  D  L+WPF   VTL + + + R  +  D   F  D  S +++RPV+D +    G P F  +S++   +  +++D I IK  V +T
Sbjct:  354 FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNR-EHVIDA--FRPDVTSSSFQRPVNDMNI-ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLT 499          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13077|TRAF1_HUMAN (TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.841e-25
Identity = 95/366 (25.96%), Postives = 162/366 (44.26%), Query Frame = 1
Query:  439 EENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSEL--IKHSDLIQNDRILIKCKVHVT 1530
            E    CPF  VGC + +     ++ H       H  +L+ F+       +   R    L+     L++ L  +++    +    L++      C+  ++E   + F    K K +     +LR ++    N    L+++ + S     T  ++S       + +     RV    Q L  K  +++  +E S     +RL+E  +F+       FLWKI N   +   +  G    +FS  FY  + GYK+CLR+  NGD   + TH SLF  +M+G+YD  L WPFRN VT  + + + R         F  D  S +++RP  +T+    G P F  LS+L   KH+  +++D + +KC V  +
Sbjct:   83 EAGIGCPFAGVGC-SFKGSPQSVQEHEVTSQTSHLNLLLGFMK------QWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHF---MKEKLLAELEGKLRVFE----NIVAVLNKEVEASHLALATSIHQS---QLDRERILSLEQRVVELQQTLAQKD-QALGKLEQS-----LRLMEEASFD-----GTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID---AFRPDLSSASFQRPQSETNV-ASGCPLFFPLSKLQSPKHA-YVKDDTMFLKCIVETS 415          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 9.314e-25
Identity = 103/403 (25.56%), Postives = 182/403 (45.16%), Query Frame = 1
Query:  343 VLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDV-----NQVLKKELKI--VKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            V++SC   KCS +    + +L A   H   C      C F   GC   Q    +I++H       H  +L E+  ++  ++ +L+ E +E         NQ+   E++I   K  L + +  IL LQ   +    K  E  +++   R+  +    E D ++S  E   N   +L E  D+S  +             ++ G+ +  +    RH  +      SV +I ++      +++E  ++         +WKI ++K +   A  G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +  +   +  D   F  D  S ++++P  + +    G P F++ + ++++   I++D I IK  V  +
Sbjct:  199 VVVSC-PHKCS-VQTLLRSELSA---HLSECVNAPSTCSFKRYGCVF-QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWE----EADSMKSSVESLQNRVTEL-ESVDKSAGQAA-----------RNTGLLESQLS---RHDQML-----SVHDIRLADMDLRFQVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNI-ASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 562          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.562e-31
Identity = 133/478 (27.82%), Postives = 215/478 (44.98%), Query Frame = 1
Query:   67 LTMANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIV-----KVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDE----KYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNE--FLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSEL 1467
            +++ N NL    +  ++ +F     I+D  KC IC +L+++A    CGCRYC EC++ Y    +  C      C D       NI  D AVN  I  L  KC    C   + L  + +H  +C  +        + C++   +L +IE     + +   K  M  +       EM    + EL       K   K+V     K + N K+V +L  + S   C+ K       +FS    N+ M  E     + +E   +S + + E    K D S  + +TL++  L +++                    ++    +K++E   RH+      + + E+K V     F+WKIE +      A+ G    + SD FY    GYKM ++I P GD   +GTH S+FF LM+G++D+ L+WPF+N VTL+I +   +    SDT  F  D +S  Y++P  D +    G P+FI+ S+L
Sbjct:    1 MSLLNSNLPTNIKRYRKKHFPF--NISDNLKCIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCLTDG--CGDL-----GNIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDSCIHQT-------INCKSCNEELTKIE----LKEHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVHTEKLCAKLVGKCPYKCD-NGKEVNLLDHRKS---CSKKPVTC---LFSEIGCNRVMTKEDLIKHNNEESLQHSRLLMKEIITMKNDISELKMKTLEFNILKIEF----------------SKFQSEILDKIKSLEKIPRHTSPSTSSVRSSEEKTVYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGTHLSVFFTLMRGEFDDLLQWPFKNKVTLTILDQKNKTNDHSDT--FKPDVRSTCYQQPTDDYNI-ASGSPKFITFSQL 432          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 3.482e-31
Identity = 125/502 (24.90%), Postives = 222/502 (44.22%), Query Frame = 1
Query:   85 NLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEM----EMLKREVIELKDVNQVLKKELKIVKVNLNSKQVA-----ILQLQASHNMC---NSKRDEFKQKMFSLRRKN----KTMKTEIDQLRSYDERKSN-----SSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFND-DKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVH 1524
            N++E+  + K N  +V + + ++  C +C KLM  AC   CGC YC+ C+R YL+     CP  K  CK+  LN+  ++  +  ++  IS +  KC  + C +  +L+ ++EH   C  E+ ECP + +GC       +E+  HL  +   H++++M F   + +E+    E  K ++  LK   +VL+     V+  LN ++ A     I +L+   NM    +    E K +M +L        K +K++I   R   E   N      S D+  +      E   +K      + + +      IR+N           K   N+++                      +F+W+IE +  K        VT+V+SD F    + YK CL +   GD      +  L+  +MKG+ D+ L+WP R  VTLSI    +   + +   +++   +   A++RP  + +    G    +  S + +   ++ ND I++ C VH
Sbjct:    8 NVQEL--LSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLK---EVLR-----VQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLN-----------KLCPNVDM----------------------DFMWRIEEYSKK-----RRTVTDVYSDSFQ--SHNYKFCLNLYIYGD------NLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVVH 453          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: K1RLP3 (TNF receptor-associated factor 3 OS=Crassostrea gigas OX=29159 GN=CGI_10023158 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 7.652e-31
Identity = 126/480 (26.25%), Postives = 215/480 (44.79%), Query Frame = 1
Query:  133 YQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEER---PCPNSKKFC---KDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNN-------QAKLNEIE----SHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
            Y  + D F+C +C  ++ +A    CG R C +CVR  L G      PCP S   C   K+    IH+++ + R ++ L    +F+     CR      A+E H +T      ECP + V C N+       + K  E +    + +F++N  H+ +  +    ++ +    ++++ E+    Q L + +      + S   A+   + +      K     +++ +L R+   M       R   E++  S + L E+   +L++  T   R+ P      G C+      PR +N    +    +  +I      +R+  IET     V    +WKI ++  +   AK+G    ++S PFY     YKMC R+  NGD   +GTH SLFF + KG+YD  L WPF+  VTL + +      +  D+  F  D  S +Y+RPV + +    G P FIS   +++    +++D I IK  V
Sbjct:   48 YVSLTDNFRCPVCWGVLREAVQTRCGHRACAQCVRDLLAGNPGGVVPCPVSDDTCVVLKEE--EIHRDVSMRREIHKLEVYCNFRNEG--CREILPWNALESHEET------ECPRVVVQCPNSCGSESCPRQKGEEADLLRHTEVFRDN--HAYLTAQHSHQVALDTAGCRKDIQEINSSLQSLTERMTDQSRQMESLISALDGFKHTLKTIKIKAVSQTERLITLERRVDNMAD-----RELVEKQGRSVMLLTERQG-TLEQRVTHLERAGPSG-GEGGACQ------PRGENDQRLALLDARFADID-----LRMQVIETVNYGGV---LMWKIRDYNLRKQDAKAGKTNSLYSQPFYTGPFWYKMCARVYLNGDGMGKGTHLSLFFVVQKGEYDALLPWPFKQKVTLMLLDQQNGSRHVVDS--FRPDTTSSSYQRPVTEMNIAS-GCPLFIS-HVVLETPTYLRDDTIFIKVVV 490          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2I4D4C5 (TNF receptor-associated factor OS=Austrofundulus limnaeus OX=52670 GN=LOC106534871 PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.066e-30
Identity = 113/383 (29.50%), Postives = 180/383 (47.00%), Query Frame = 1
Query:  418 EHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIE-----LKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQL-RSYDERK------SNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +H K C +    C F  VGC  +  K  +I+ H  Q +Y H  +L+ FIM M   +E L+ + +E     L++++Q L+ EL++    L     A++Q   +  +  S          +L  + ++ KT++ +L R   E +       N    L+ + +RS    E    R   +D     +    +R          + + S++++ I      MR +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I++D I IK  V +T
Sbjct:  202 DHIKFCGKFKTPCRFHVVGCDISVEK-EKIQDHERQCSYEHLNLLLHFIMGMKVSLESLQPQSLEVASQRLQELHQSLR-ELELKMRELGGGDTALVQGACATTLSTSFTPLPSAMGAALELQIQSEKTKVAELSRRCRELELKVITFENIVCVLNREMERSCTTMEAYN-RQHRLDQDKVEILNNKVR--------QLERTVSLRDLSIVEMEGKMREMSAATYD-----GIFIWKISDFTKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDISSSSFQRPVSDMNI-ASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 564          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1A8FEA8 (TNF receptor-associated factor OS=Nothobranchius korthausae OX=1143690 GN=BX901915.1 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.168e-30
Identity = 119/400 (29.75%), Postives = 178/400 (44.50%), Query Frame = 1
Query:  418 EHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIE-----LKDVNQVLKK-ELKIVKVN---------------------LNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETL--KYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +H K C++    C F  VGC N   +  +I  H  Q +Y H  +L++FIM +   +E L+ + +E     L++++Q L+  ELKI K+                      L+S     L+LQ  +     K  E  Q+   L  K  T +  I  L    ER S +    + ++    D+ E L  K R L                         + + S++++ I      MR +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I++D I IK  V  T
Sbjct:  204 DHIKFCSKFKSPCRFHVVGC-NTSVEKEKIHDHECQCSYEHLNLLLQFIMGIKVSLESLQPQSLEVASKRLQELHQSLRGLELKISKLGGGAAASMQGAITSTLLTSFTPLSSAVAITLELQLQNE--KKKVAELSQRCQELELKVSTFENIICVLNREMERSSTTMEAYNRQHRLDQDKIEILNNKVRQL-------------------------ERTVSLRDLSIVEMEGKMREMSASTYD-----GIFIWKISDFTKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDVSSSSFQRPVSDMNI-ASGCPLFCPLSKLDSKNSYIRDDTIFIKTIVDPT 566          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 120.553 bits (301), Expect = 1.239e-28
Identity = 112/404 (27.72%), Postives = 177/404 (43.81%), Query Frame = 1
Query:  418 EHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIEL-----KDVNQVLKK-ELKIVKVN-------------------------LNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETL--KYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +H K C +    C F  VGC  +  K  +I  H    +Y H  +L+ FIM +   +E L+ + +EL     ++++Q L++ ELK+ +++                         L +   A L+LQ       +K  E  ++   L  K  T +  +  L    ER + +    + ++    D+ E L  K R L                         + +  ++++ I      MR +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I++D I IK  V +T
Sbjct:  204 DHIKLCTKFRTPCRFHVVGCDMSVEK-EKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIQELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPTLATSFTPLPTTVGAALELQLHSE--KTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQL-------------------------ERTVGLRDLSIVEMEGKMREMSAATYD-----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDISSSSFQRPVSDMNI-ASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 570          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 113.235 bits (282), Expect = 1.555e-26
Identity = 67/180 (37.22%), Postives = 95/180 (52.78%), Query Frame = 1
Query:  991 SVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
             ++++ I      MR +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I++D I IK  V +T
Sbjct:  287 GLRDLSIVEMEGKMREMSAATYD-----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDISSSSFQRPVSDMNI-ASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLT 457          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 113.235 bits (282), Expect = 2.718e-26
Identity = 60/180 (33.33%), Postives = 100/180 (55.56%), Query Frame = 1
Query:  991 SVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            ++++++++     +R ++  T++       F+WKI ++  +   A +G    +FS  FY  + GYKMCLR+  NGD   RG+H SLFF +M+G YD  LKWPF   VTL + + + R  +  D   F  D  S +++RP+ + +    G P F  L++L   S  +++D I IK  V +T
Sbjct:  359 TMRDLQLAESEQALRELQFCTYD-----GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDA--FRPDISSTSFQRPISEMNI-ASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDLT 529          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 105.916 bits (263), Expect = 7.712e-24
Identity = 95/385 (24.68%), Postives = 190/385 (49.35%), Query Frame = 1
Query:  412 VEEHSKTCNEENFECPFIDVGC--RNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVI----ELKDVNQV---LKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKS-NSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSEL--IKHSDLIQNDRILIKCKVHVT 1530
            +++H+  C E+  +C +   GC  RN   K  +++ H   E   H  +L+E    +  +++ L+++      ELK+ N +   LK+E+      +++ Q ++              +E ++ + S++R+ K ++  ++   + +E  S  +S+D        +  T++L+        +H G   +  + + R  ++H      V+ ++ S +    + +E  +++ K      +WK+ ++     H K    T + S PFY   +GYK+  R+   G+   RGTH SL+  LM+GD+D+ L WPFR +VTL++ + S    + S  L F  D  S  + RP  +T+A   G+P+FI+ ++L   +++  +++D + IK KV  T
Sbjct:  210 LKDHADECPEQETDCIYKKYGCTVRN---KRGQVKVHEQTEFNHHVLLLLESNSKLIKQVDQLQQDFAAQQGELKERNLLVSNLKREVSKCDTTVSAMQRSV--------------EEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLD---SLREQVAMTQSLR--------EHLGALGQTCQSHTRLLDIH------VQQLQCSEQR--FQQLESTSYDGK-----LIWKVHDY-----HRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVS--LSFTPDLASNNFRRPTSETNA-ALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVDTT 545          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 1.571e-23
Identity = 51/149 (34.23%), Postives = 79/149 (53.02%), Query Frame = 1
Query: 1075 NEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
               +WKI ++K +   A +     ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +      +  D   F  D  S ++ RP  + +    G P F++   ++++   I++D I IK  V
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDA--FKPDPNSSSFRRPTGEMNIA-SGCPLFVA-QTVLENGTYIKDDTIFIKVTV 148          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.013e-28
Identity = 112/447 (25.06%), Postives = 185/447 (41.39%), Query Frame = 1
Query:  235 RSYLNGEERPCPNSKKFCKD-------SLLNIHQNIELDRAVNVLISCLDFKCSKLPC-----RFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEM----LKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASH--NMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
            R+ L      CP+  +FCK        SLL  H   E          C  +    LPC             + +H   C      C F  +GC   Q     +  H  +E+ V S   +  +++ ++E+E+    L+  + +  +++++L            +++VA L+   SH   +  S        +  L + N       +QL+S    +     D D    R    T   + R+L     + G C+    ++ +   +H        +  + T    ++++E   +  K      +WKI ++  +   A SG    ++S PFY    GYKMC R   NGD   RGTH SLFF +M+G+YD  L+WPFR  VTLS+ +      + SDT  F  D  S ++ RP  D +    G P F+S   L   S L+ +D + ++  V
Sbjct:   19 RTRLAAHRASCPHRAEFCKYCSAAVTCSLLERHHKEE----------CAQYP---LPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREH--EESAVRSHFTL--VISRNSELELQCARLQCSIEDHTNMSEML------------TQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHN-------EQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMH--------DGLLDTAERRLQVLETAGYSGK-----LVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDT--FTPDPASGSFRRPDGDMNV-ASGCPLFVSHVALEGSSYLV-DDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 2.509e-26
Identity = 63/169 (37.28%), Postives = 87/169 (51.48%), Query Frame = 1
Query: 1015 TRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
            TR + M L   +  E      + +WKI ++  +   A SG    ++S PFY    GY+MC R   NGD   RGTH SLFF +M+G+YD  L WPFR  VTL++ +        SDT  F  D  S ++ RP  D +    G P F+S   L + +  +Q+D I IK  V
Sbjct:  306 TRLAEMDL-RFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDT--FKPDPASSSFRRPTSDMNI-ASGCPLFVSHVAL-ESASYLQDDTIFIKVVV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 97.8265 bits (242), Expect = 7.424e-22
Identity = 112/528 (21.21%), Postives = 215/528 (40.72%), Query Frame = 1
Query:  142 IADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVG-CRNNQAKLNE-------------IESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVI----------------------ELKDVNQVLKKEL---KIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSN--SSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHA--KSGFVTE---------VFSDPFYIYRNGYKMCLRID-------PNGDSD------NRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +  +++C IC   + +    PCG R+C  C+   +   +      K    +++L+  Q    + A   ++S L  +C   PC  + +L A++EH   C      C   ++  CR + AK  E              E   ++++  H +M    ++   +  + L RE +                      E + V  +L   +     V + L +  + IL++Q       S          SL   + T   ++    +   + S   ++ D  ++ DR  + T TL+ R +   ++ + +  +        Q L  ++++ V+++E     S  RL              F W++E + S++L     SGF ++         + S  FY    GY++CLR+        P G +        R  H +LF HL++GDYD+ L WPF+  + +S+ +   R      T   + D Q  A++RP    +  G GY  F+ ++ L  H   +++D ++++C+V  T
Sbjct:   59 LESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDA---GPKCPVDNAVLHEGQLFPDNFAKREILS-LTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNHEQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAK----TDNQQGLLAEATRLVRSLEARVAESESRLCA----------GIFTWRVERF-SRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCER-DSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTL-HHRSYLRDDCLVVRCEVVTT 565          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 112.079 bits (279), Expect = 2.155e-26
Identity = 91/380 (23.95%), Postives = 169/380 (44.47%), Query Frame = 1
Query:  394 KDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLD-EKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +D+L+     +  C +    C F   GC     +   +E+H   +  VH  +L+    T +   E  + E+     ++Q+ K+  K        +Q  + + + +  + N     ++ K+  + R     + E+ +L+   ER     V+    + DR L   E    R          +         + +N H     ++ +I+++     ++++E  +++       ++WKI+ +  +     SG    ++S PFY+ R GYK C R+ PNGD   +G+H SLFF LM+G++D  L WPFR  VT  + +   R+    DT  F  D  S +++RP  + +    G P FIS + L   +  +++D + IK  V  T
Sbjct:  178 RDELL--HHQTNICEQAELPCSFAKHGCHFKGTR-EALETHFRDQASVHVNLLL----TATQNEEKARSEMA--AKLSQMEKERAK--------QQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELK---ERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEH---QLALHDIQLAEHDLKLQMLEATSYD-----GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQD-RVHDIGDT--FRPDPTSSSFKRPTSNMNI-ASGCPLFISHTNLQTRA-YVRDDTMFIKIAVDTT 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 106.686 bits (265), Expect = 8.816e-25
Identity = 62/172 (36.05%), Postives = 96/172 (55.81%), Query Frame = 1
Query: 1021 HSPMRLVEIETFEKKPVCN-EFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHS----TRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKV 1521
            H  MRL   E   +  VCN  F+WK++N++     + +G    + S PFY    GYKMCLR++ NG     G H SLF H+M+GD+D  L+WPF   +TLSI + S    +R P  S+TL    +   +A++RP    +  G GY +F  + +L +    I+N+ IL++ ++
Sbjct:  313 HKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRP-ISETLVAKPNL--LAFQRPTSPRNHKGYGYVEFCPIDQLTE-GQYIKNNSILVRIQI 480          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 105.916 bits (263), Expect = 2.238e-24
Identity = 49/129 (37.98%), Postives = 79/129 (61.24%), Query Frame = 1
Query: 1081 FLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSEL 1467
            FLWKI+ +  +   AKSG  T ++S PFY +R GYK+C R+ PNGD   R  + S+F  LM+G+YD+ L WPF+  +T+++ +    +   S+T  F+ D  S++++RP  + +    G P+F S + L
Sbjct:  382 FLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGM-NISET--FDPDPCSISFQRPTRNINV-ASGCPRFCSQTVL 506          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 100.138 bits (248), Expect = 1.457e-22
Identity = 64/190 (33.68%), Postives = 100/190 (52.63%), Query Frame = 1
Query:  943 IRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIK 1512
            IR   R   LH + +  ++N+ I+     +  ++  TF+     +  LWKI N  +K   A SG VT  +S  F+   +GYKMC RI  NGD   R  H SLFF +M+G++D  L+WPFR  VTL + +    + +  D   F  D  S +++RP  + +    G P F S  +L +H+  I++D + +K
Sbjct:  295 IRRLERQLELHDQGT-GLRNLAIADLEERLNTLQGTTFD-----SVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN-VEHVIDA--FRPDPSSSSFQRPRAEMNI-ASGCPLFCSHEQLTQHA-YIRDDTMFLK 473          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 92.4337 bits (228), Expect = 5.384e-20
Identity = 62/168 (36.90%), Postives = 87/168 (51.79%), Query Frame = 1
Query: 1081 FLWKIENWKSKVLHAKSGFVTE--------------------VFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSV----AYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIK 1512
            F+W+I N+K K   A + F T                     + S PFY  R GYKM L+  PNG  D +GTH SL   +MKG+YD  L+WPFR  +TLS+ N S +  + S+T++   D  +      +ERP+ + +  G GY  FIS  EL    D I++D I I+
Sbjct:  322 FVWRICNYKDKYKKAVA-FATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQ--WRSETVEIYPDDATPDKKHKFERPIENENV-GCGYSCFISHMEL-NSGDYIKDDVIFIE 484          

HSP 2 Score: 50.0618 bits (118), Expect = 1.573e-6
Identity = 31/104 (29.81%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  148 DEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEER-PCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFEC 456
            DE  C+IC  ++ +     CG  YC  C+  + NG+E   CP   +  K S       I  D+  + ++  L+ KC+  PCR+K +L   ++H K C+ +  +C
Sbjct:   26 DELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPS------QIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKC 123          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 127.102 bits (318), Expect = 7.168e-31
Identity = 109/383 (28.46%), Postives = 178/383 (46.48%), Query Frame = 1
Query:  418 EHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIE-----LKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQL-RSYDERK------SNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            +H K C++    C F  VGC  +  K  +I  H  Q +Y H  +L+ FIM +   +E L+ + +E     L +++Q L+ +L++    L     A LQ   +  +  S          +L  + ++ KT++ +L R   E +       N    L+ + +RS    E    R   +D     +    +R          + + S++++ I      M+ +   T++       F+WKI ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + + R  +  D   F  D  S +++RPV D +    G P F  LS+L   +  I+++ I IK  V ++
Sbjct:  205 DHIKFCSKFKAPCRFHVVGCDTSVEK-EKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQKLHELHQSLR-DLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGAALELQLQSEKTKVAELSRRCQELELKVSTFENIVCILNRELERSCATMEAYN-RQHRLDQDKIEILSNKVR--------QLERTVSLRDLSIVEMEGKMKDMSAATYD-----GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDA--FRPDISSSSFQRPVSDMNI-ASGCPLFCPLSKLDSKNSYIRDETIFIKAIVDLS 567          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 112.849 bits (281), Expect = 4.639e-26
Identity = 66/180 (36.67%), Postives = 96/180 (53.33%), Query Frame = 1
Query:  991 SVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
             +K++ ++     +R +   TF+       F+W+I ++  K   A +G    +FS  FY  + GYKMCLRI  NGD   RGTH SLFF +M+G  D  LKWPF   VTL + + S R  +  D   F  D  S +++RPV + +    G P F  LS+L   +  I++D I IK  V +T
Sbjct:  424 GLKDLTVAEMEGRLREMAATTFD-----GVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNR-EHIIDA--FRPDVTSSSFQRPVSEMNI-ASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVDLT 594          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 112.079 bits (279), Expect = 6.230e-26
Identity = 65/182 (35.71%), Postives = 100/182 (54.95%), Query Frame = 1
Query:  985 SKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            S +VK++++S     +R ++  T++       F+WKI ++  +   A SG    +FS  FY  + GYKMCLR+  NGD   RGTH SLFF +M+  YD  LKWPF   VTL + + + R  +  D   F  D  S +++RPV + +    G P F  L++L   S  +++D I IK  V ++
Sbjct:  342 SLTVKDLQLSEAEQMVRELQYCTYD-----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR-EHIIDA--FRPDITSTSFQRPVSEMNI-ASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDLS 514          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 111.694 bits (278), Expect = 6.586e-26
Identity = 65/182 (35.71%), Postives = 100/182 (54.95%), Query Frame = 1
Query:  985 SKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            S +VK++++S     +R ++  T++       F+WKI ++  +   A SG    +FS  FY  + GYKMCLR+  NGD   RGTH SLFF +M+  YD  LKWPF   VTL + + + R  +  D   F  D  S +++RPV + +    G P F  L++L   S  +++D I IK  V ++
Sbjct:  349 SLTVKDLQLSEAEQMVRELQYCTYD-----GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR-EHIIDA--FRPDITSTSFQRPVSEMNI-ASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDLS 521          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 107.457 bits (267), Expect = 1.167e-24
Identity = 55/152 (36.18%), Postives = 82/152 (53.95%), Query Frame = 1
Query: 1075 NEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
               +WKI ++K +   A +G    ++S PFY    GYKMC R+  NGD   +GTH SLFF +M+G+YD  L WPF+  VTL + +      +  D   F  D  S ++ RPV + +    G P F+S S +++    I++D I IK  V  +
Sbjct:  298 GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDA--FKPDPSSSSFRRPVAEMNI-ASGCPLFVSQS-VLESGTYIKDDTIFIKVTVDTS 445          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000067336.1 (SMESG000067336.1)

HSP 1 Score: 1004.59 bits (2596), Expect = 0.000e+0
Identity = 484/486 (99.59%), Postives = 484/486 (99.59%), Query Frame = 1
Query:   73 MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 1530
            MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWEC RSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTH SLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT
Sbjct:    1 MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECARSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHVSLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT 486          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025566.1 (SMESG000025566.1)

HSP 1 Score: 300.442 bits (768), Expect = 1.521e-96
Identity = 160/485 (32.99%), Postives = 275/485 (56.70%), Query Frame = 1
Query:   73 MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHV 1527
            MA   LE +W+I+  N ++   +I  + +C +C+KL++ A N PCGCR+C+ C+  +L+ E + CP + +FCK   L+++ NI +D  +N+ IS +  KC++  C F D+LI +E+HS+TC   +  CP+ ++GC      L+++  HL  E   H+K+LM+F    +NEMEMLK     L+  N++L+ E+  +K++   ++  I +LQ              + +  L  +N  M+  +++L S  ER   + V++ +   +  D+ E +K  +L M    K + +           +  K  KS+ N++        +L+E+E  + +    EF WK++ +  K+ HAK+G  T+++S+ F  ++N YKMCL ++P+G  D +GTH ++ FHLMKG++D  L+WPFR  VTL++ N  TRLP+   T    ++  S A  +P       G G+PQF+S  EL  + DL++N++I IKC V +
Sbjct:    1 MAFSKLENVWQIIINNKYESLAEIQHDMQCLLCKKLLINARNAPCGCRFCFSCISGFLDNENKICPGNTEFCKLEKLDMNINICVDNPINIKISQIKVKCAEKSCEFVDELIKMEDHSRTCKYRSAACPYSNIGCDKCNISLDKVADHLQSEILTHTKLLMDFFGNFNNEMEMLKTNNYGLRAENKLLRNEINELKLDGERRREEIAELQ--------------RNIICLNGENVAMREIMNKLISDWER---NRVEIGDLQRKCADQVEEIKLLNLEMPTSRKNLTE-----------ISNKIDKSMDNVD-------RKLLEMEANQNQLNYGEFAWKLDKFTDKMAHAKNGINTDIYSESFLTHKNSYKMCLSVNPDGFGDGKGTHLTVGFHLMKGEFDEILEWPFRYSVTLALINQRTRLPHVCKTTNCANNPNSKALIQPTDRNG--GMGFPQFVSHEELASNPDLMRNNQIFIKCSVDI 448          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 294.278 bits (752), Expect = 4.062e-94
Identity = 155/485 (31.96%), Postives = 277/485 (57.11%), Query Frame = 1
Query:   73 MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHV 1527
            M+   LE +W+IM++ N++   +I ++  C +C+KL+V A   PCGCR+C+ C+  +L+ +E+ CP   + CK  +L++++NI +D  +N+ IS L  KC ++ C + D+L  +E+HS+TC   +  CP+ ++GC       +++  HL  E + H+K+LM+F++  +NEMEMLK     L  VN++L+ E+  +K++   ++V I  LQ     C  + +E            + +  +I  LR+ D   S                 + L    L ++   K +  +  ++  + +   T+ S  +  +   + +   +L+E+   + + +  EF+WK++ +  K+  AK+G  T ++S+ F  ++NG+KMCLR+DP+G+   +GTH S+FFHLMKG++D  L+WPFR+ VT ++ N  TRLP+ S T+K  +     A  +P  D +A G G+P+F+S  EL  + DL++N++I IKC V +
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRVEIADLQRK---CADQAEEI-----------ELLNEDIPALRNVDRNVS-----------------DRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKL---SGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQPT-DRNA-GLGFPKFVSHEELSSNPDLMRNNQIFIKCSVDI 449          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025901.1 (SMESG000025901.1)

HSP 1 Score: 276.174 bits (705), Expect = 1.139e-86
Identity = 161/500 (32.20%), Postives = 282/500 (56.40%), Query Frame = 1
Query:   73 MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRY----IRVNPRHQNL-----HTKSSKSVKNIEISTRHSPM------RLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHV 1527
            M+   LE +W+IM++ N++   +I ++  C +C+KL+V A   PC CR+C+ C+  YL+  E  CP + + CK  +L++++NI +D+ +N+ IS L  KC ++ C + D+L  +EEHS+TC   +  C + ++GC       +++E HL  E +VH+K+LM+F++  +NEMEMLK     L  VN++L+ E+  +K++   ++  I +L+ +              +  L  +N  M+  +D+L S  ER      DL  K     +E E L      +    + V  R     + +    + L       ++ + V   E+S +   +      +L+E+   + + +  EF+WK++ +  K+  AK+G    ++S+ F  ++NG+KMCL + P+G    +GTH S++FHLMKG++D  L+WPFR+ VTL++ N  TRLP+ S+T K+ +D  S    +P  D +A G G+P+F+S  EL  + DL++N++I IKC V +
Sbjct:    1 MSCSKLENVWQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE-ICPGNTEDCKQEVLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSEACLYSNIGCDKCNISQDKVEDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELRVN--------------IICLNGENAAMRENMDKLISAGERNQVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGVGVGKGTHLSVYFHLMKGEFDGILEWPFRHSVTLALINQRTRLPHVSETTKYANDSNSKTLIQPT-DRNA-GLGFPKFVSHEELSSNPDLMRNNQIFIKCSVDI 483          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027308.1 (SMESG000027308.1)

HSP 1 Score: 275.018 bits (702), Expect = 2.257e-86
Identity = 162/496 (32.66%), Postives = 276/496 (55.65%), Query Frame = 1
Query:   73 MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYCWECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKCSKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLFQENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLNSKQVAILQLQASHNMCNSKRDEFK---QKMFSLRRKNKTMKTEIDQLRSYDERKSNSSVDLDEKYDRSLDETET------LKYRSLPM--DYKHKGVCKRYIRVNPRHQNLHTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLHAKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGDYDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTSACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHV 1527
            MA   LE +W+I++ NN++   ++  +  C +C+KL+V A + PCGCR+C+ C+ ++L+ E + CP + +FCK   L+++ NI +D+ +N+ IS +  KC +  C+F  +LI +EEHS+TC   +  CP+ ++GC       +++  HL  E   H+ +LM+FI    NEMEMLK         N+ L  E+  +K++    QV I  LQ     C  + +E +   + + +LR  +++M   +D L+   E    +    +    + + +  T       K+ +     + K K +  +  ++  +   +     KS+ N++       M+L+E    + +    EF+WK++ +  K+  AK G  T ++S+ F  ++NGYKMCL +DP+G+   +GTH S+FFHLMKG++D+ L+WPFR+ VT ++ N  TRLP+ S T K  D     AY +P       G G+PQF+S  EL  + DL++N++ILIKC V +
Sbjct:    1 MAFLKLENVWQIIRNNNYESLVEVQHDMLCLLCKKLLVNARSAPCGCRFCFSCISNFLDCENKICPGNTEFCKLEKLDMNINILVDQPMNIKISQIKVKCPEKSCQFVGELIKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVADHLQSEILAHTNLLMDFIGNFKNEMEMLKAN-------NKELSAEINGLKLDRERMQVEIGDLQRK---CADQVEEIELLNEDIPALRNADRSMSDRLDGLQLNVEGNQVAMRACENNLQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIDQMEKKQNEI----DKSMDNVD-------MKLLETAANQNQLNYGEFVWKLDKFTDKMADAKKGINTHIYSESFLTHKNGYKMCLLVDPDGNGGGKGTHLSVFFHLMKGEFDDILEWPFRHSVTFALINQRTRLPHVSWTEKCADYPNEEAYIQPTDRNG--GMGFPQFVSHEELSSNPDLMRNNQILIKCSVDI 473          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF22.713e-2640.67TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF13.833e-2625.96TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF13.833e-2625.96TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF34.427e-2624.37TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.427e-2624.37TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-12.511e-1330.46TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-25.367e-1047.46TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Traf42.695e-1930.20gene:FBgn0026319 transcript:FBtr0334401[more]
Traf43.757e-1930.20gene:FBgn0026319 transcript:FBtr0077429[more]
Traf61.104e-925.83gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf32.211e-2826.79TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
BX901915.12.786e-2837.22pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.12.786e-2837.22pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
unm_sa8087.235e-2836.67un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2a1.250e-2727.52Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspb62.702e-2538.26heat shock protein family B (small) member 6 [Sour... [more]
TRAF23.899e-2529.84TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh27.056e-2522.16slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF21.226e-2430.37TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh22.416e-2424.37slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf26.281e-2924.07TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf27.012e-2823.94TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf32.070e-2623.00TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.070e-2623.00TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.332e-2525.56TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE4.393e-2824.07TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|P70191|TRAF5_MOUSE3.870e-2625.59TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.303e-2540.67TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q13077|TRAF1_HUMAN1.841e-2525.96TNF receptor-associated factor 1 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE9.314e-2525.56TNF receptor-associated factor 3 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG601.562e-3127.82TNF receptor-associated factor-2-like protein B OS... [more]
T1E1013.482e-3124.90TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
K1RLP37.652e-3126.25TNF receptor-associated factor 3 OS=Crassostrea gi... [more]
A0A2I4D4C53.066e-3029.50TNF receptor-associated factor OS=Austrofundulus l... [more]
A0A1A8FEA85.168e-3029.75TNF receptor-associated factor OS=Nothobranchius k... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a1.239e-2827.72TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a1.555e-2637.22TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b2.718e-2633.33TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf57.712e-2424.68TNF receptor-associated factor 5 [Source:NCBI gene... [more]
ENSAMXT00000035169.11.571e-2334.23pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.11.013e-2825.06pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.12.509e-2637.28pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf67.424e-2221.21TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494642.155e-2623.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487738.816e-2536.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352372.238e-2437.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.457e-2233.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483945.384e-2036.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.27.168e-3128.46TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8084.639e-2636.67TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b6.230e-2635.71TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b6.586e-2635.71TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf31.167e-2436.18TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067336.10.000e+099.59SMESG000067336.1[more]
SMESG000025566.11.521e-9632.99SMESG000025566.1[more]
SMESG000025794.14.062e-9431.96SMESG000025794.1[more]
SMESG000025901.11.139e-8632.20SMESG000025901.1[more]
SMESG000027308.12.257e-8632.66SMESG000027308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009482 ID=SMED30009482|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1570bp
ATCTTTTTGTTTCTAAAAACGACAGCCAATATAAAACGAAGAACTAGTTG
AAAATTCAAACAATTGTTAACAATGGCCAACAAAAACTTAGAAGAAATTT
GGCGCATTATGAAAGAGAACAATTTTCAGGTTTATCAACAAATAGCGGAC
GAATTTAAATGCTCGATTTGCCGAAAGCTGATGGTGAAGGCTTGCAATGG
ACCCTGTGGCTGCCGATATTGTTGGGAATGCGTCAGGAGTTATTTGAACG
GCGAAGAGAGACCGTGCCCAAATTCGAAGAAGTTTTGCAAGGATTCATTG
TTGAATATCCACCAAAACATTGAACTCGATCGAGCAGTCAATGTTTTGAT
ATCATGCTTGGATTTTAAATGCTCAAAGTTGCCTTGCCGGTTCAAAGACG
ATCTTATTGCAGTTGAGGAGCATTCAAAAACCTGCAATGAAGAGAACTTT
GAGTGTCCATTTATCGATGTAGGCTGTCGGAACAACCAAGCAAAGTTAAA
TGAAATCGAGAGTCATTTGTTTCAAGAAAATTACGTACATTCGAAAATGT
TGATGGAATTTATCATGACGATGAGCAACGAAATGGAAATGCTGAAAAGA
GAAGTAATTGAGCTGAAGGATGTCAATCAAGTTTTAAAGAAAGAACTGAA
AATAGTGAAAGTCAACTTGAATAGTAAACAAGTGGCCATTCTTCAATTGC
AAGCGAGCCATAATATGTGCAATTCAAAAAGAGATGAATTTAAACAAAAA
ATGTTTTCGTTAAGAAGAAAAAATAAAACAATGAAAACAGAAATTGATCA
ACTAAGATCTTATGATGAAAGAAAATCGAATTCGAGTGTGGATTTGGATG
AAAAATACGATAGAAGTCTGGATGAAACTGAAACTTTAAAGTACAGATCC
CTTCCAATGGATTATAAACACAAAGGAGTCTGCAAAAGATATATCCGTGT
CAATCCAAGACATCAAAACTTGCACACTAAATCAAGCAAATCAGTAAAAA
ATATTGAAATAAGTACTAGACATTCTCCTATGAGACTCGTTGAAATTGAA
ACCTTTGAAAAGAAACCGGTCTGTAATGAATTCCTATGGAAAATAGAAAA
TTGGAAAAGCAAAGTACTCCATGCGAAATCAGGTTTCGTGACAGAGGTGT
TCAGTGATCCGTTTTATATCTACAGAAACGGATACAAAATGTGTCTTCGA
ATCGATCCGAATGGCGATTCTGACAACCGGGGAACTCACGCTTCTTTGTT
TTTCCATTTAATGAAAGGTGATTATGACAATGAGCTGAAATGGCCGTTCA
GAAATGATGTAACCCTCTCCATTTGTAACCACAGCACGCGCTTGCCATAT
TTCAGTGACACCCTGAAATTCAATGATGACAAGCAATCGGTAGCATATGA
GAGACCAGTTCATGATACGAGTGCCTGCGGTCGGGGTTACCCTCAATTCA
TTAGTTTGAGTGAACTAATTAAACATTCCGATCTGATTCAAAATGACAGA
ATATTAATAAAGTGTAAAGTGCACGTAACGTAGGGATTTATATAAATATA
CTATTATTATTAAAAAAAAA
back to top

protein sequence of SMED30009482-orf-1

>SMED30009482-orf-1 ID=SMED30009482-orf-1|Name=SMED30009482-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MANKNLEEIWRIMKENNFQVYQQIADEFKCSICRKLMVKACNGPCGCRYC
WECVRSYLNGEERPCPNSKKFCKDSLLNIHQNIELDRAVNVLISCLDFKC
SKLPCRFKDDLIAVEEHSKTCNEENFECPFIDVGCRNNQAKLNEIESHLF
QENYVHSKMLMEFIMTMSNEMEMLKREVIELKDVNQVLKKELKIVKVNLN
SKQVAILQLQASHNMCNSKRDEFKQKMFSLRRKNKTMKTEIDQLRSYDER
KSNSSVDLDEKYDRSLDETETLKYRSLPMDYKHKGVCKRYIRVNPRHQNL
HTKSSKSVKNIEISTRHSPMRLVEIETFEKKPVCNEFLWKIENWKSKVLH
AKSGFVTEVFSDPFYIYRNGYKMCLRIDPNGDSDNRGTHASLFFHLMKGD
YDNELKWPFRNDVTLSICNHSTRLPYFSDTLKFNDDKQSVAYERPVHDTS
ACGRGYPQFISLSELIKHSDLIQNDRILIKCKVHVT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 164..191
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 23..484
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 2.59812E-5
score: 39.3729
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 21..75
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 344..465
e-value: 5.3E-13
score: 59.2
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 334..483
score: 20.928
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 11..133
e-value: 7.7E-11
score: 44.0
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 297..486
e-value: 1.6E-47
score: 163.5
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 334..485
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 23..484
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 30..69
score: 8.668