SMED30009480

Overview
NameSMED30009480
Smed IDSMED30009480
Length (bp)4522
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009480 (SMED30009480) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009480 (SMED30009480) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009480 (SMED30009480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009480 (SMED30009480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30009480SMESG000063980.1 dd_Smed_v4_11408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009480SMESG000063980.1 dd_Smed_v4_11408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30009480SMESG000063980.1 dd_Smed_v4_11408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30009480SMESG000063980.1 dd_Smed_v4_11408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009480SMESG000063980.1 dd_Smed_v4_11408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009480 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000513:65417..87135 -16436
Homology
BLAST of SMED30009480 vs. UniProt/SwissProt
Match: sp|P04185|UROK_PIG (Urokinase-type plasminogen activator OS=Sus scrofa OX=9823 GN=PLAU PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.169e-6
Identity = 31/91 (34.07%), Postives = 43/91 (47.25%), Query Frame = 3
Query:  324 DSSRPCRSTENGWDYDGPVNISSNNKSCKPWKIGDV------KYKLDALQIKDFNENFCRNPNNRSSVWCYVDVN---TTEPCTVPLCLAN 569
            D+S+ C    NG  Y G  N ++  + C PW    V       ++ DALQ+     N+CRNP+N+   WCYV V      + C VP C   
Sbjct:   67 DTSQTCFEG-NGHSYRGKANTNTGGRPCLPWNSATVLLNTYHAHRPDALQLGLGKHNYCRNPDNQRRPWCYVQVGLKQLVQECMVPNCSGG 156          
BLAST of SMED30009480 vs. Ensembl Nematostella
Match: EDO43993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX97])

HSP 1 Score: 53.9138 bits (128), Expect = 3.637e-7
Identity = 30/75 (40.00%), Postives = 37/75 (49.33%), Query Frame = 3
Query:  357 GWDYDGPVNISSNNKSCKPWKIGDVKYKLDALQIKDFNENFCRNPNNRSSV-WCYVDVNTTEPCTVPLCLANPEA 578
            G DY G +N++     C  WK  D  YKL        + NFCRNP  +    WCYVD NT E C +P C    +A
Sbjct:  137 GEDYIGRLNVTKYGMPCLSWKSNDPVYKL--------SHNFCRNPRGQHEAPWCYVDKNTYEYCVIPKCSEASDA 203          
BLAST of SMED30009480 vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 54.299 bits (129), Expect = 9.920e-7
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  354 NGWDYDGPVNISSNNKSCKPWKIGDVKYKL---DALQIKDFNENFCRNPNNRSSVWCY-VDVNTT-EPCTVPLCLANPEAN 581
            NG DY GP++ + + K C+ W + +    L        K  ++N+CRNPN R   WC+  D NT  E CT+ +C   P++N
Sbjct:  195 NGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDDNYCRNPNGRHRPWCFTTDPNTPWEYCTIKVCETPPDSN 275          
BLAST of SMED30009480 vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 54.299 bits (129), Expect = 1.044e-6
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  354 NGWDYDGPVNISSNNKSCKPWKIGDVKYKL---DALQIKDFNENFCRNPNNRSSVWCY-VDVNTT-EPCTVPLCLANPEAN 581
            NG DY GP++ + + K C+ W + +    L        K  ++N+CRNPN R   WC+  D NT  E CT+ +C   P++N
Sbjct:  201 NGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDDNYCRNPNGRHRPWCFTTDPNTPWEYCTIKVCETPPDSN 281          
BLAST of SMED30009480 vs. Planmine SMEST
Match: SMESG000063980.1 (SMESG000063980.1)

HSP 1 Score: 1197.19 bits (3096), Expect = 0.000e+0
Identity = 593/597 (99.33%), Postives = 593/597 (99.33%), Query Frame = 3
Query:  552 PLCLANPEANYCIPIPIRDFTACPILFQNKDLFKQNVSKEFVFCCLKDQIHTEYLPIIEGCLLSIISTKFLQPKFSLCPPGYYYKRIFNLLLEDKSIYQCCRFSVVKASYSLWLYQSVLDENKNNSISVFGSLTNSSCKPVHDFYTEVIEYFNTFEQEYRFIEYGDRLCFYYLNTMTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLXXXXXXXXXXXXXAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKDF 2342
            P   ANPEANYCIPIPIRDFTACPILFQNKDLFKQNVSKEFVFCCLKDQIHTEYLPIIEGCLLSIISTKFLQPKFSLCPPGYYYKRIFNLLLEDKSIYQCCRFSVVKASYSLWLYQSVLDENKNNSISVFGSLTNSSCKPVHDFYTEVIEYFNTFEQEYRFIEYGDRLCFYYLNTMTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSK F
Sbjct:  274 PEIAANPEANYCIPIPIRDFTACPILFQNKDLFKQNVSKEFVFCCLKDQIHTEYLPIIEGCLLSIISTKFLQPKFSLCPPGYYYKRIFNLLLEDKSIYQCCRFSVVKASYSLWLYQSVLDENKNNSISVFGSLTNSSCKPVHDFYTEVIEYFNTFEQEYRFIEYGDRLCFYYLNTMTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKGF 870          

HSP 2 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 2
Query: 2333 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRXXXXXXXXXXXXXXFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 3787
            KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP
Sbjct:  868 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 1352          
BLAST of SMED30009480 vs. Planmine SMEST
Match: SMESG000063980.1 (SMESG000063980.1)

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 591/593 (99.66%), Postives = 592/593 (99.83%), Query Frame = 3
Query:  564 ANPEANYCIPIPIRDFTACPILFQNKDLFKQNVSKEFVFCCLKDQIHTEYLPIIEGCLLSIISTKFLQPKFSLCPPGYYYKRIFNLLLEDKSIYQCCRFSVVKASYSLWLYQSVLDENKNNSISVFGSLTNSSCKPVHDFYTEVIEYFNTFEQEYRFIEYGDRLCFYYLNTMTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLXXXXXXXXXXXXXAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKDF 2342
            +NPEANYCIPIPIRDFTACPILFQNKDLFKQNVSKEFVFCCLKDQIHTEYLPIIEGCLLSIISTKFLQPKFSLCPPGYYYKRIFNLLLEDKSIYQCCRFSVVKASYSLWLYQSVLDENKNNSISVFGSLTNSSCKPVHDFYTEVIEYFNTFEQEYRFIEYGDRLCFYYLNTMTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSK F
Sbjct:   32 SNPEANYCIPIPIRDFTACPILFQNKDLFKQNVSKEFVFCCLKDQIHTEYLPIIEGCLLSIISTKFLQPKFSLCPPGYYYKRIFNLLLEDKSIYQCCRFSVVKASYSLWLYQSVLDENKNNSISVFGSLTNSSCKPVHDFYTEVIEYFNTFEQEYRFIEYGDRLCFYYLNTMTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKGF 624          

HSP 2 Score: 945.266 bits (2442), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 2
Query: 2333 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRXXXXXXXXXXXXXXFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 3787
            KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP
Sbjct:  622 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 1106          
BLAST of SMED30009480 vs. Planmine SMEST
Match: SMESG000063980.1 (SMESG000063980.1)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 2
Query: 2333 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRXXXXXXXXXXXXXXFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 3787
            KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP
Sbjct:  420 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 904          

HSP 2 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 421/422 (99.76%), Postives = 421/422 (99.76%), Query Frame = 3
Query: 1077 MTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLXXXXXXXXXXXXXAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKDF 2342
            MTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSK F
Sbjct:    1 MTDRMTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKGF 422          
BLAST of SMED30009480 vs. Planmine SMEST
Match: SMESG000063980.1 (SMESG000063980.1)

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 2
Query: 2333 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRXXXXXXXXXXXXXXFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 3787
            KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP
Sbjct:  416 KGFFPLKNYEKFPLIGLVAIGGKCPNVDNKIYSFQNAIEEVFEIERAKLNSDELYNFIKLSLIIDLNSKPNFVRITYKFCIYRLSKSQNSSINLLGIIKPLQSKCPINFYEEIHIISINRRENFHSIFPYFFKESNSSNKVYASFCFQRINAEINFFLLKYSSLCFFSYKTCPTGYKSELNDLLSLSKNNVEWESLILCCNKNREVIQNDSPHISMETPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVSPISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQYCLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGKIFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESAVTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMESIIDYKDSGSNRIYSELENVP 900          

HSP 2 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 417/418 (99.76%), Postives = 417/418 (99.76%), Query Frame = 3
Query: 1089 MTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLXXXXXXXXXXXXXAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKDF 2342
            MTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSK F
Sbjct:    1 MTSNSKLGVFSLRNCPFSFIESNYTGSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIRSAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMISNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKKIGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKGNYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNSVSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAYRTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPKDPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKGF 418          
BLAST of SMED30009480 vs. Planmine SMEST
Match: SMESG000059844.1 (SMESG000059844.1)

HSP 1 Score: 173.711 bits (439), Expect = 1.833e-46
Identity = 91/160 (56.88%), Postives = 115/160 (71.88%), Query Frame = -2
Query: 4048 WDRRYSRSTYGSQEWSH*NPER-G*DVEVSSVVIKREPGRNPA**IRREAEFQLQQHEYFERKYRWKASN*RRRLARINADIESGLIPSLDGYLSDYKVAFNPEDPMLLNINTPVHLAVPKKLLQPEILDNLIDRD-DDHSYARRPLQQDNHDKNHRNEI 4521
            WD RYS ST+G+ EW + N  R   D+E+ S+ IKREPGRNPA  IR EAE  LQQ  + ERKY WKAS   RRL +IN DI  G IPS DGYL +Y V FNPEDP  L +NTPVHLA+PK+LLQP+IL+ L DR  ++H+Y+RRPL ++   +N+ ++I
Sbjct:   72 WDPRYSLSTHGTSEWPYRNKNRHDEDMELLSLAIKREPGRNPAREIRHEAEVALQQFVHLERKYHWKASLQLRRLVKINKDIAGGRIPSSDGYLLEYNVTFNPEDPAFLELNTPVHLALPKRLLQPDILEALTDRTYEEHAYSRRPLNREAPPRNYGHKI 231          
The following BLAST results are available for this feature:
BLAST of SMED30009480 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P04185|UROK_PIG1.169e-634.07Urokinase-type plasminogen activator OS=Sus scrofa... [more]
back to top
BLAST of SMED30009480 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009480 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO439933.637e-740.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30009480 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hgfb9.920e-735.80hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
hgfb1.044e-635.80hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SMED30009480 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063980.10.000e+099.33SMESG000063980.1[more]
SMESG000063980.10.000e+099.66SMESG000063980.1[more]
SMESG000063980.10.000e+0100.00SMESG000063980.1[more]
SMESG000063980.10.000e+0100.00SMESG000063980.1[more]
SMESG000059844.11.833e-4656.88SMESG000059844.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009480 ID=SMED30009480|Name=SMED30009480|organism=Schmidtea mediterranea sexual|type=transcript|length=4522bp
ATTTCTTGTAAAGGGCAAAAATTTTTCATTTTTATCTAGTAACATTTTCA
CGGTGAATGACACGAATTTTATTTTTGACTTAAAAAATTCATGATAAAAT
ATCCCTCATGTTCTGCTGTCTGTTACAGACACAAATAAAAATGATTGGCT
GAAAACATTGAATAAACAACATGAATTCGATGCATGAATTCACCGGATAT
AATTATTGATTCTCCATCACGATTCCCATCATTGATTATCTGTCAAACGA
TTCTCGTGATGCAATGAAATCCTGGATAATTGGTCTGTGTCTTCTTCTGT
CATTGTGGAATATTTCTACTCGTGATTCTTCACGTCCGTGCCGATCTACG
GAAAACGGTTGGGATTATGATGGACCTGTGAATATCTCATCAAACAATAA
ATCCTGCAAACCTTGGAAAATAGGAGATGTTAAATACAAATTGGATGCGC
TTCAAATCAAGGATTTCAATGAGAATTTCTGCCGAAATCCCAATAACAGA
TCAAGTGTTTGGTGCTATGTTGATGTGAATACGACAGAGCCATGCACTGT
GCCACTTTGTTTGGCCAACCCAGAAGCAAATTATTGCATTCCTATACCAA
TCAGAGATTTTACAGCTTGCCCGATTTTATTTCAAAATAAGGATTTATTT
AAACAAAATGTTTCCAAGGAATTTGTATTCTGCTGCTTAAAAGATCAAAT
CCACACAGAGTACTTACCAATAATCGAGGGATGCCTGTTGAGTATCATAT
CTACAAAATTTCTCCAACCCAAATTTTCTCTATGTCCACCAGGATATTAT
TATAAAAGAATATTCAACCTTCTTCTGGAAGACAAATCTATTTATCAGTG
TTGTAGATTTTCTGTGGTCAAGGCTTCCTACAGCCTTTGGCTGTATCAAT
CGGTTCTTGATGAAAATAAAAATAATTCCATTTCAGTTTTCGGTTCACTA
ACTAATAGCTCATGTAAACCGGTTCATGACTTTTATACTGAAGTCATAGA
GTATTTCAATACATTTGAACAAGAATATCGGTTTATAGAATATGGAGACA
GATTATGCTTTTATTATTTAAACACCATGACTGACAGAATGACAAGTAAT
TCGAAACTAGGTGTATTTTCTCTTAGAAATTGCCCTTTCAGTTTTATTGA
ATCGAACTACACGGGAAGTCTGACAACAACTGACAAAATGCATGTAAAGA
TTTGTCGGCCAATTTCAAAAGATTTCATTTATCCTTCTGGGCAATATTGT
CTTTTACTTTTATCGCAAGAAAAGTTAAAATGTCCTTCTGATTTTCATGC
TTATATTATCCGATCAGCTGTGAATGGAGAACAATTATTAAAGTTTTGTT
GCTTAGTAAATAACTTAACAACAATTATGTGGTTAAGCCATGAAAATAAT
TCAATTAATGAAAATTCATCTATAGCATTTGTTTTGCTAACAAAAGAATG
TCCATTTATGATATCAAATGTTTCCATGTCCTATTCCATTATCAATGCAA
CTGTTGAATCCAGTTCAAATCCGAGAGGCAATCAAACAATGAGTGACATG
GGGTCACAAATACTAAAATTGTGCAATTACGAATTATTAATTGATAGATT
TGCTTATAAAAAAATTGGTGAAGTTTGTCCACCCGGAATGGTTGATAGTT
GGTTAACTTTCACTTCTGTATTCCACTGGGACCCAGATTTACCAAATGAG
ATCTTCAAATTGGAGTATTGTGTCGGAAATGCCATTTTGAAACTCGATTC
CTTTCCCAAAGGAAACTATTGTTTGTATAAGATTGGAAATATCTGTCCTC
TTGGATTTATTTCCTCATCAATGCCGAACCCGAAAACTGTACTTAACCAG
ACTCTGTATGCACCTAATTATACGGGTGATGCCTTCTGCTGCCGAACAGA
TGGTCAGAACTCAGTTTCAATAAGTTCAGAGAGATTTCCATTTTTAAATA
AAAATAAACATTCATTTGGAATCTTGATTTCAAATAAAAAAGATGTTTGC
CCAAAAATCATTGGATATGTTGATCATCACGGAGCAAATTTAGACGGGTT
TTATTGTGCCTATAGGACAGCTAATGACAATTACAAATGGTCAAATAAAA
TCATTTTTCCGATGCAGACCAGTGAAACAACGCAAAAATTTCCAAAAAGA
AAACATTGGGAATCATTAATGAATTTTCAATACGTTTCTTCGGTTGTTCT
TTCATATCCAAAAGATCCATTTTGTATTGTTTCAGGGGAAAAGTGTTCTT
CCATGAAAAACATTGATTTTGCAATGTTGTATCCCATTTCAAATATGTTT
CTATGTTGTTCTTTGAATAAATATTACGTTTCAAAGGATTTTTCCCTTTG
AAAAACTACGAAAAATTCCCACTGATTGGTCTTGTTGCAATTGGTGGAAA
GTGTCCAAACGTAGATAATAAAATATATTCATTCCAAAACGCTATTGAAG
AAGTTTTTGAGATTGAAAGAGCTAAACTGAATTCGGATGAATTATACAAT
TTCATCAAATTGAGTCTTATCATCGACTTAAATTCTAAACCAAATTTCGT
TAGAATAACGTATAAATTTTGTATCTATCGGCTGTCTAAAAGTCAAAATT
CTTCAATCAATTTACTTGGAATTATAAAGCCTTTACAATCAAAATGCCCT
ATAAATTTCTATGAGGAAATTCACATAATTTCAATTAACCGTAGAGAAAA
TTTTCATTCTATTTTCCCATATTTCTTCAAAGAAAGTAACAGTTCTAATA
AAGTTTACGCAAGTTTCTGTTTTCAACGTATCAATGCAGAAATAAATTTT
TTTTTACTAAAATACAGTTCTTTGTGTTTTTTTAGTTATAAAACCTGCCC
AACCGGATATAAATCTGAACTTAATGACTTATTATCTTTGTCAAAAAATA
ACGTGGAATGGGAATCTTTAATCCTTTGCTGTAATAAAAATAGAGAGGTG
ATTCAAAACGATTCTCCTCATATTTCAATGGAAACTCCATTCATATTACC
ATTAAAGCCTGGCACAAAAGAGTGTCCAAAAATAACAAATTTCAGTTACG
AAAAATGGAAATCAAAAAAAATACATTTTCAAACAATACAATACATGATT
TTTTGTTTTTACCATAAAAATGTTTCACCGATTTCTTGGCCGAGCGGAAA
TTATATGACTATTGCGATAAATAATTACTGTCCCCCATATTTTACTTTAC
TTCAACATAAATTGACAGGATTATGCATGAGGAATGAAATAAATACAGAA
CAAATAGAGTTTCCAAGTGGTCAGTATTGCCTTCTTAGTCATCTGGGACT
CAGGTGTCCCTTATCACATGGAGAAAATCCTGTGAGAAATTTTATTAATA
TAGAGAATAAATTATATTTGATTTGCTGCTCTCAAAGCATCGATATGATA
TTTAATATTTATATTCCAGAAGGGAAAATTTTTAGTTTCCTTTCTTTAGA
GAAATGCTCAATAATTTCTGGAGTGTCAGTAATCGCCAAGCCATTTGCAA
ATTTTAGTCGAATTATCCAGTGTATATATGTTTCAGATTGTTTTAACAAA
TCATCTACAAACTGTAAAGAATCCGCGGTCACTTTGAAGGAATCTTCAGT
CAATTCTCGAACGCTAATTATTGTAATTTTGACAATAATGGTTATTGTTA
TTTTCGCAACTTTTGGTGTCATTGTTTTGACAAAGTTTAAAAATAACTCT
TTTGCAGAACACTTCAAAATGGAGTCTATTATAGATTACAAAGATTCTGG
TTCCAATCGAATTTACTCTGAATTGGAAAACGTTCCAAGTGTTACATATA
GTACTTTAACCTAATTATATTGTTATTAGGTTAAAATTGTGCGTATTTCA
TAATTTTATTTTTTAATTTTAATTTTTAATTTTTAATTTCTACTAATCGT
GATTAAACAGCGGATCGGTTAATCTCCAGTTTGCTAAGTCAATTAATTCA
TTATTTACAAATACTTATTGCAGATCAAATAGAAGATTTACTACAAAACA
TTTATTTCACGACATGGTTTTAATTACAATGTACATATTCATTTCAAGAT
TTCATTGCGGTGATTTTTATCATGGTTGTCTTGTTGCAGCGGACGACGTG
CGTACGAGTGGTCGTCATCTCGATCGATCAAATTGTCCAGGATTTCGGGT
TGCAGCAGCTTCTTAGGAACCGCCAAGTGCACCGGCGTGTTGATATTGAG
AAGCATTGGATCCTCCGGATTAAAAGCCACTTTATAGTCGGAAAGATAGC
CATCCAAACTCGGAATGAGGCCACTTTCGATGTCGGCATTGATTCTTGCC
AATCTCCGGCGCTAGTTGCTTGCTTTCCAGCGATATTTCCGTTCAAAATA
TTCATGTTGTTGGAGTTGGAATTCTGCTTCGCGCCTGATTTATCAAGCCG
GATTCCGCCCGGGCTCTCTCTTGATGACTACGCTGGATACTTCGACGTCT
CAGCCCCTCTCTGGATTTCAGTGGGACCATTCTTGACTTCCATAAGTGGA
GCGTGAGTATCTCCGATCCCAC
back to top

protein sequence of SMED30009480-orf-1

>SMED30009480-orf-1 ID=SMED30009480-orf-1|Name=SMED30009480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=696bp
MKSWIIGLCLLLSLWNISTRDSSRPCRSTENGWDYDGPVNISSNNKSCKP
WKIGDVKYKLDALQIKDFNENFCRNPNNRSSVWCYVDVNTTEPCTVPLCL
ANPEANYCIPIPIRDFTACPILFQNKDLFKQNVSKEFVFCCLKDQIHTEY
LPIIEGCLLSIISTKFLQPKFSLCPPGYYYKRIFNLLLEDKSIYQCCRFS
VVKASYSLWLYQSVLDENKNNSISVFGSLTNSSCKPVHDFYTEVIEYFNT
FEQEYRFIEYGDRLCFYYLNTMTDRMTSNSKLGVFSLRNCPFSFIESNYT
GSLTTTDKMHVKICRPISKDFIYPSGQYCLLLLSQEKLKCPSDFHAYIIR
SAVNGEQLLKFCCLVNNLTTIMWLSHENNSINENSSIAFVLLTKECPFMI
SNVSMSYSIINATVESSSNPRGNQTMSDMGSQILKLCNYELLIDRFAYKK
IGEVCPPGMVDSWLTFTSVFHWDPDLPNEIFKLEYCVGNAILKLDSFPKG
NYCLYKIGNICPLGFISSSMPNPKTVLNQTLYAPNYTGDAFCCRTDGQNS
VSISSERFPFLNKNKHSFGILISNKKDVCPKIIGYVDHHGANLDGFYCAY
RTANDNYKWSNKIIFPMQTSETTQKFPKRKHWESLMNFQYVSSVVLSYPK
DPFCIVSGEKCSSMKNIDFAMLYPISNMFLCCSLNKYYVSKDFSL*
back to top

protein sequence of SMED30009480-orf-2

>SMED30009480-orf-2 ID=SMED30009480-orf-2|Name=SMED30009480-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
METPFILPLKPGTKECPKITNFSYEKWKSKKIHFQTIQYMIFCFYHKNVS
PISWPSGNYMTIAINNYCPPYFTLLQHKLTGLCMRNEINTEQIEFPSGQY
CLLSHLGLRCPLSHGENPVRNFINIENKLYLICCSQSIDMIFNIYIPEGK
IFSFLSLEKCSIISGVSVIAKPFANFSRIIQCIYVSDCFNKSSTNCKESA
VTLKESSVNSRTLIIVILTIMVIVIFATFGVIVLTKFKNNSFAEHFKMES
IIDYKDSGSNRIYSELENVPSVTYSTLT*
back to top

protein sequence of SMED30009480-orf-3

>SMED30009480-orf-3 ID=SMED30009480-orf-3|Name=SMED30009480-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MVVLLQRTTCVRVVVISIDQIVQDFGLQQLLRNRQVHRRVDIEKHWILRI
KSHFIVGKIAIQTRNEATFDVGIDSCQSPALVACFPAIFPFKIFMLLELE
FCFAPDLSSRIPPGLSLDDYAGYFDVSAPLWISVGPFLTSISGA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038178Kringle_sf
IPR000001Kringle
IPR031569ApeC
IPR018056Kringle_CS
IPR013806Kringle-like
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0031639plasminogen activation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000001KringleSMARTSM00130KR_2coord: 24..101
e-value: 1.4E-8
score: 41.1
IPR000001KringlePFAMPF00051Kringlecoord: 29..99
e-value: 1.1E-10
score: 41.6
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 31..119
score: 11.106
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 25..105
e-value: 4.3E-12
score: 47.9
IPR031569Apextrin, C-terminal domainPFAMPF16977ApeCcoord: 468..620
e-value: 2.7E-8
score: 34.0
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 72..84
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.78
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 27..104