reticulocalbin-1

Overview
Namereticulocalbin-1 (ADL74875.1)
Smed IDSMED30009457
Length (bp)1214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of reticulocalbin-1 (SMED30009457) t-SNE clustered cells

Violin plots show distribution of expression levels for reticulocalbin-1 (SMED30009457) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of reticulocalbin-1 (SMED30009457) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for reticulocalbin-1 (SMED30009457) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009457

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30009457SMESG000034805.1 SmedASXL_018750SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009457SMESG000034805.1 dd_Smed_v4_493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009457SMESG000034805.1 dd_Smed_v4_493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009457SMESG000034805.1 dd_Smed_v4_493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009457SMESG000034805.1 dd_Smed_v4_493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009457SMESG000034805.1 dd_Smed_v4_493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009457SMESG000034805.1 dd_Smed_v4_493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009457SMESG000034805.1 dd_Smed_v4_493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009457SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000073740.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000063429.1 SMESG000062535.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig3862GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009457SMESG000034805.1 Contig3862GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009457SMESG000034805.1 Contig48709newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009457SMESG000034805.1 Contig48709uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
secretory cellSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
secretory cellSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal region of the whole animalSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
marginal adhesive zoneSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
marginal adhesive zoneSMED30009457SMESG000034805.1 AY068175.1smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30009457SMESG000034805.1 dd_Smed_v6_493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009457SMESG000034805.1 dd_Smed_v6_493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30009457SMESG000034805.1 dd_Smed_v6_493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30009457SMESG000034805.1 dd_Smed_v6_493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of reticulocalbin-1 vs. Ensembl Human
Match: RCN2 (reticulocalbin 2 [Source:HGNC Symbol;Acc:HGNC:9935])

HSP 1 Score: 102.064 bits (253), Expect = 8.969e-24
Identity = 78/280 (27.86%), Postives = 140/280 (50.00%), Query Frame = 1
Query:  265 EFDYDPHQTDSDYDEDLVTGTSH----HAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHF-LDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            E  Y   +  SDYD + + G       + K   E+ +  +  I KK+D ++D  +   EL+ +I  + K    +    +F E DKNSD  V+ DEY +  + +  +  EN   + + ++ + F K    +++RF+ A+ DS   L++ E++   +P    +M   ++ E +E+ D N DG V  +E++  +  D  A++      V+K R    + YDKD +G++DP+E    + P  +  A+EE  HL  E D N D  ++ +E+  +  L+L  E  D
Sbjct:   27 ELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDEN--TALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFV--NDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDLFLTSEATD 302          
BLAST of reticulocalbin-1 vs. Ensembl Human
Match: RCN2 (reticulocalbin 2 [Source:HGNC Symbol;Acc:HGNC:9935])

HSP 1 Score: 96.6709 bits (239), Expect = 1.104e-21
Identity = 80/296 (27.03%), Postives = 140/296 (47.30%), Query Frame = 1
Query:  265 EFDYDPHQTDSDYDEDLVTGTSH----HAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKT-----SEAL-----ENLTRSANSSKTQDFAKKIQH------ERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHF-LDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            E  Y   +  SDYD + + G       + K   E+ +  +  I KK+D ++D  +   EL+ +I  + K    +    +F E DKNSD  V+ DEY +  + +      + AL     E+  +     K Q F   +        +++RF+ A+ DS   L++ E++   +P    +M   ++ E +E+ D N DG V  +E++  +  D  A++      V+K R    + YDKD +G++DP+E    + P  +  A+EE  HL  E D N D  ++ +E+  +  L+L  E  D
Sbjct:   27 ELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDENTALDDAEEESFRKEFAICKKQSFCFWLLRFNLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFV--NDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDLFLTSEATD 320          
BLAST of reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 93.5893 bits (231), Expect = 8.196e-21
Identity = 80/273 (29.30%), Postives = 125/273 (45.79%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSA-----NSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE-VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G        + T E++K  +  I  K+D + D  +   EL  +I    KK   +   ++++E D N D  +S DEY             N+T        +     ++ + +  +  RFK AD D D      E+   L+P  Y +M   +V E +ED D N DG +  +EYI      + D    E E VK +RE   +  DK+++GK+D EE    + P   + A+ E  HL  E+D NKDG +T +E+     L++G +  D
Sbjct:   46 DYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEY------------RNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMY--SHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 93.5893 bits (231), Expect = 1.061e-20
Identity = 80/273 (29.30%), Postives = 125/273 (45.79%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSA-----NSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE-VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G        + T E++K  +  I  K+D + D  +   EL  +I    KK   +   ++++E D N D  +S DEY             N+T        +     ++ + +  +  RFK AD D D      E+   L+P  Y +M   +V E +ED D N DG +  +EYI      + D    E E VK +RE   +  DK+++GK+D EE    + P   + A+ E  HL  E+D NKDG +T +E+     L++G +  D
Sbjct:   54 DYDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEY------------RNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMY--SHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATD 312          
BLAST of reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 92.0485 bits (227), Expect = 3.007e-20
Identity = 81/268 (30.22%), Postives = 127/268 (47.39%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE-VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G        + T E++K  + +I  K+D + D  +  DEL  +I    K+   E    ++K  D N D  VS +EY   K+      L++     +     ++ + +  +  RFK AD D D      E+   L+P  Y +M   +V E +ED D N DG +  +EYI      + D    E E VK +RE   +  DK+++GK+D EE    + P   + A+ E  HL  E+D NKDG +T +E+     L++G +  D
Sbjct:   46 DYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEY---KNATYGYVLDD----PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMY--SHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 86.2705 bits (212), Expect = 1.015e-18
Identity = 75/266 (28.20%), Postives = 128/266 (48.12%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFK--EVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE---VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            T E++K ++ ++  K+D ++D  I+ +EL  +I    K+         +K  + +K  D K+  ++Y         E +      A    + ++AK I  + +R+  AD DS+G L+  EY   ++P    HM   +V E ++D D N DG V  DEYI          +++ +E   V+ +RE   +  DKD +GK++ EE    + P   + A+ E  HL    D NKDG + LDE+ +H   ++G +  D   +   H   EL
Sbjct:   57 TPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIVDGKIKWEDY--------REMVYGSADGAGQELSPEYAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQKHDPAEL 314          
BLAST of reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 86.2705 bits (212), Expect = 1.015e-18
Identity = 75/266 (28.20%), Postives = 128/266 (48.12%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFK--EVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE---VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            T E++K ++ ++  K+D ++D  I+ +EL  +I    K+         +K  + +K  D K+  ++Y         E +      A    + ++AK I  + +R+  AD DS+G L+  EY   ++P    HM   +V E ++D D N DG V  DEYI          +++ +E   V+ +RE   +  DKD +GK++ EE    + P   + A+ E  HL    D NKDG + LDE+ +H   ++G +  D   +   H   EL
Sbjct:   57 TPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIVDGKIKWEDY--------REMVYGSADGAGQELSPEYAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQKHDPAEL 314          
BLAST of reticulocalbin-1 vs. Ensembl Celegans
Match: calu-2 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9TYS8])

HSP 1 Score: 75.485 bits (184), Expect = 4.452e-15
Identity = 71/273 (26.01%), Postives = 119/273 (43.59%), Query Frame = 1
Query:  310 DLVTGTSHHAKRTKEQ------TKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHK------HQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDE 1092
            D     S H K   EQ       +  +++  K +D NND  +D+ E+  ++ ++ +K       +   E+D+N+D  VS +EY          H K  E+L                  I  ++  FK AD D+DG LN+ E    L P  +PHM   ++   + + D N DG + + E++   LD     +  + EV++ R      YDK+K+GK+  +E    L          E + L   +D +KDG ++ +E+  H  L+   E   E
Sbjct:   24 DGSVSPSDHKKPASEQKLNLKSGQESVEKFAKALDTNNDGFVDKSEILAWVSESYQKTVDREAVERISELDENADGFVSWEEYLADSFPDEELHNKEEESL------------------IAQDKMYFKQADEDNDGKLNLEELASFLNPEHHPHMHPVLIAVTLLEKDQNGDGAIEEKEFLGE-LDEQRGSEWYKVEVERFRTV----YDKNKDGKLAGDELTDWLLVDGTTAGSYEAESLLTNSDDDKDGQLSYEEIVKHHALFAKTEAAQE 273          
BLAST of reticulocalbin-1 vs. Ensembl Celegans
Match: C56C10.9 (pep chromosome:WBcel235:II:6591048:6592351:-1 gene:WBGene00016965.1 transcript:C56C10.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C56C10.9)

HSP 1 Score: 55.8398 bits (133), Expect = 2.047e-8
Identity = 63/235 (26.81%), Postives = 108/235 (45.96%), Query Frame = 1
Query:  355 QTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDE----FKEVDKNSDQKVSLDEY---FLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEV----KKKREAEFD-KYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKD 1023
            Q    I E+FKK D N+D  +   EL   I  NM++ H E + ++    F  VD N D  +  +E+   F   H+K     E +        T+D   ++  E+  F  +D   DG L+  E+ + L+P +       IV++ +  +D NND +V +D+++        +     E +    K++R  EF+ + D++ +GK    E Y  + P     A +EV+ +   TD N D
Sbjct:   62 QLSESIKEMFKKTDVNDDGFLTAGELKQQIRKNMEE-HLEKSKNDSEIFFDIVDTNKDGSIVWEEFEPHFSKMHEKDHSDSELM-----DVHTED-PHRVDDEKRMFNRSDITRDGRLDRMEWHIFLHPEYSAQGLVEIVNDLMGVYDKNNDEVVSQDDFVNGIPGTVDELNPEFENMEKLEKERRLREFNEEIDENSDGKATFRELYDYVDPQNFRLASKEVNDIMMLTDANND 289          
BLAST of reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301907)

HSP 1 Score: 96.6709 bits (239), Expect = 5.805e-22
Identity = 77/273 (28.21%), Postives = 145/273 (53.11%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAA--DKK--ISEEEVKKKREAEFDK-YDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            ++D + + G +  A+     + +++K  +  + K +D N D  IDR EL  +I+ + KKL  E  +D F+E+D+++D++++  EY    +    E  +  T   +S   +D  K I+ ++E F AAD++ DG L + E++L   P  +P M   ++   ++D D ++DG +   E++    D A+  DK+  I+E+E        FDK +D + +G +  +E  + + P     A +EVDHLF  TD + D  ++  E+ ++   ++G E  D
Sbjct:   67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDS--YEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVG---DAASHHDKEWLITEKE-------RFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301905)

HSP 1 Score: 96.6709 bits (239), Expect = 5.805e-22
Identity = 77/273 (28.21%), Postives = 145/273 (53.11%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAA--DKK--ISEEEVKKKREAEFDK-YDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            ++D + + G +  A+     + +++K  +  + K +D N D  IDR EL  +I+ + KKL  E  +D F+E+D+++D++++  EY    +    E  +  T   +S   +D  K I+ ++E F AAD++ DG L + E++L   P  +P M   ++   ++D D ++DG +   E++    D A+  DK+  I+E+E        FDK +D + +G +  +E  + + P     A +EVDHLF  TD + D  ++  E+ ++   ++G E  D
Sbjct:   67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDS--YEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVG---DAASHHDKEWLITEKE-------RFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0079033)

HSP 1 Score: 96.6709 bits (239), Expect = 5.805e-22
Identity = 77/273 (28.21%), Postives = 145/273 (53.11%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAA--DKK--ISEEEVKKKREAEFDK-YDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            ++D + + G +  A+     + +++K  +  + K +D N D  IDR EL  +I+ + KKL  E  +D F+E+D+++D++++  EY    +    E  +  T   +S   +D  K I+ ++E F AAD++ DG L + E++L   P  +P M   ++   ++D D ++DG +   E++    D A+  DK+  I+E+E        FDK +D + +G +  +E  + + P     A +EVDHLF  TD + D  ++  E+ ++   ++G E  D
Sbjct:   67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDS--YEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVG---DAASHHDKEWLITEKE-------RFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0079034)

HSP 1 Score: 96.6709 bits (239), Expect = 5.805e-22
Identity = 77/273 (28.21%), Postives = 145/273 (53.11%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAA--DKK--ISEEEVKKKREAEFDK-YDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            ++D + + G +  A+     + +++K  +  + K +D N D  IDR EL  +I+ + KKL  E  +D F+E+D+++D++++  EY    +    E  +  T   +S   +D  K I+ ++E F AAD++ DG L + E++L   P  +P M   ++   ++D D ++DG +   E++    D A+  DK+  I+E+E        FDK +D + +G +  +E  + + P     A +EVDHLF  TD + D  ++  E+ ++   ++G E  D
Sbjct:   67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDS--YEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVG---DAASHHDKEWLITEKE-------RFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301906)

HSP 1 Score: 96.6709 bits (239), Expect = 5.805e-22
Identity = 77/273 (28.21%), Postives = 145/273 (53.11%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAA--DKK--ISEEEVKKKREAEFDK-YDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            ++D + + G +  A+     + +++K  +  + K +D N D  IDR EL  +I+ + KKL  E  +D F+E+D+++D++++  EY    +    E  +  T   +S   +D  K I+ ++E F AAD++ DG L + E++L   P  +P M   ++   ++D D ++DG +   E++    D A+  DK+  I+E+E        FDK +D + +G +  +E  + + P     A +EVDHLF  TD + D  ++  E+ ++   ++G E  D
Sbjct:   67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDS--YEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVG---DAASHHDKEWLITEKE-------RFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of reticulocalbin-1 vs. Ensembl Zebrafish
Match: rcn1 (reticulocalbin 1, EF-hand calcium binding domain [Source:ZFIN;Acc:ZDB-GENE-080225-33])

HSP 1 Score: 100.138 bits (248), Expect = 2.980e-23
Identity = 77/261 (29.50%), Postives = 133/261 (50.96%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAA--DKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD 1122
            T E++K  + +I +++D N D  I  DEL  +I    K+   E  +  + + D N D K+S DEY   K       L N     +++    F K +  +  RFK AD D +   +  E+   L+P  + HM   +V E +ED D N DG V +DEYI    D+ A  D     + V+ +R+   D  D +K+GK+D EE    + P   + A+ E  HL  E+DT+KD +++ +E+  + ++++G +  +   + + ++D+
Sbjct:   65 TPEESKARLGKIVERIDSNVDGFITTDELKAWIKRVQKRYVYENVAKVWTDYDLNKDNKISWDEY---KQATYGYYLANPEEFEDATDQFSFKKMLPRDERRFKTADLDGNLAADKEEFTAFLHPEEFAHMQEIVVLETLEDIDKNGDGHVDEDEYIA---DMFAHEDAGPEPDWVRTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLVYESDTDKDQMLSKEEILENWNMFVGSQATNYGEDLTRNHDE 319          
BLAST of reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 96.2857 bits (238), Expect = 6.114e-22
Identity = 81/271 (29.89%), Postives = 134/271 (49.45%), Query Frame = 1
Query:  289 TDSDYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            T+ +YD D   G    AK     T E++K  + +I +K+D + D  +   EL  +I    KK   +    ++K+ D N+D+ +S +EY   K+      L++           ++ + +  +  RFK AD + D   +  E+   L+P  Y HM   +V E +ED D N DG +  +EYI    +   D+    E V  +RE   +  DK+K+GK+D EE    + P   + A+ E  HL  E+DTNKDG +T +E+ +   L++G +  D
Sbjct:   45 TNFEYDHDAFLG-EEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEY---KNVTYGTYLDD----PEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYN-HEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATD 306          
BLAST of reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 96.2857 bits (238), Expect = 6.114e-22
Identity = 81/271 (29.89%), Postives = 134/271 (49.45%), Query Frame = 1
Query:  289 TDSDYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            T+ +YD D   G    AK     T E++K  + +I +K+D + D  +   EL  +I    KK   +    ++K+ D N+D+ +S +EY   K+      L++           ++ + +  +  RFK AD + D   +  E+   L+P  Y HM   +V E +ED D N DG +  +EYI    +   D+    E V  +RE   +  DK+K+GK+D EE    + P   + A+ E  HL  E+DTNKDG +T +E+ +   L++G +  D
Sbjct:   45 TNFEYDHDAFLG-EEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEY---KNVTYGTYLDD----PEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYN-HEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATD 306          
BLAST of reticulocalbin-1 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 94.3597 bits (233), Expect = 2.825e-21
Identity = 71/248 (28.63%), Postives = 122/248 (49.19%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            T E++K  + +I +K+D+++D  +  DE+  +I    ++   E    +++  D NSD  VS +EY        +     +   A+     ++ + +  +  RFK AD D D   N  E+   L+P  + +M   +V E +ED D N DGL+  +EYI        D     E VK +RE   +  DK+K+G++D +E    + P   + A+ E  HL  E+D +KDG +T  E+     L++G +  D
Sbjct:   65 TPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEY-------KNATYGYILDEADPEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSS-EPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 94.3597 bits (233), Expect = 3.510e-21
Identity = 75/267 (28.09%), Postives = 128/267 (47.94%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD +   G        + T E++K  + +I +K+D+++D  +  DE+  +I    ++   E    +++  D NSD  VS +EY        +     +   A+     ++ + +  +  RFK AD D D   N  E+   L+P  + +M   +V E +ED D N DGL+  +EYI        D     E VK +RE   +  DK+K+G++D +E    + P   + A+ E  HL  E+D +KDG +T  E+     L++G +  D
Sbjct:   46 DYDHEAFLGQEEAKTFDQLTPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEY-------KNATYGYILDEADPEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSS-EPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Xenopus
Match: fgf11 (fibroblast growth factor 11 [Source:Xenbase;Acc:XB-GENE-479522])

HSP 1 Score: 99.7525 bits (247), Expect = 5.734e-23
Identity = 74/259 (28.57%), Postives = 131/259 (50.58%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD 1122
            T E++K  + +I  ++D ++D  I  +ELT +I    K+   E  +  +K+ D N D  +S +EY   K       L N     ++++   F K +  +  RFK AD + D   N  E+   L+P  + HM   ++ E +ED D N DG V +DEYI        + +   + V  +RE   D  D +K+GK+D EE    + P   + A+ E  HL  E+D +KD ++T +EV  + ++++G +  +   + + ++D+
Sbjct:   66 TPEESKDRLGKIINRIDSDSDGLITTEELTAWIKRVQKRYVYENVARVWKDYDVNKDNTISWEEY---KQATYGYYLANPEEFQDAAEQFSFKKMLPRDERRFKQADLNGDLEANREEFTSFLHPEEFEHMKDIVILETLEDIDKNGDGFVDQDEYIADMFS-HEEGQPEPDWVATEREQFADFRDINKDGKMDKEEIRHWILPQDYDHAQAEARHLIYESDLDKDKVLTKEEVLQNWNMFVGSQATNYGEDLTRNHDE 320          
BLAST of reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 96.2857 bits (238), Expect = 8.132e-22
Identity = 81/272 (29.78%), Postives = 125/272 (45.96%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSA-----NSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G        + T E++K  +  I  K+D +ND  +   ELT +I    KK   +    +++E D N D  VS DEY             N+T        +   + ++ + +  +  RFK AD D D      E+   L+P  + +M   +V E +ED D N DGL+  +EYI    +   D     E VK +RE   +  DK+ +GK+D EE    + P   + A+ E  HL  E+D NKD  +T +E+     L++G +  D
Sbjct:   46 DYDHDAFLGAEEAKTFDQLTPEESKERLGMIVSKIDLDNDGYVTEGELTAWIKKAQKKYVYDNVERQWQEFDLNQDGLVSWDEY------------RNVTYGTYLDDPDPDNSFNYKQMMVRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDAN-EPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 92.8189 bits (229), Expect = 1.452e-20
Identity = 79/267 (29.59%), Postives = 126/267 (47.19%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G        + T E++K  +  I  K+D + D  +  +EL  +II   K+   E    ++K  D N D  VS +EY   K+      L++     +   + ++ + +  +  RFK AD D D      E+   L+P  + +M   +V E +ED D N DGL+  +EYI    +   D     E VK +RE   +  DK+ +GK+D EE    + P   + A+ E  HL  E+D NKD  +T +E+     L++G +  D
Sbjct:   46 DYDHDAFLGAEEAKTFDQLTPEESKERLGRIVGKIDADKDGYVTVNELRDWIIFAQKRWIYEDVERQWKGHDLNGDSMVSWEEY---KNATYGYILDD----PDPDNSFNYKQMMVRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDAN-EPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 90.5077 bits (223), Expect = 1.208e-19
Identity = 73/259 (28.19%), Postives = 126/259 (48.65%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD 1122
            T E+++  + +I  ++DK+ND  I   EL  +I    ++ + E +  + K+ D N D  +S DEY    +       E     A+  K + + K +  +  RFK AD D D      E+   L+P  Y +M   ++ E IED D N+DG+V   EYI        D+    + VK +R+   D  D +K+GK+D  E    + P   + A  E  HL  E+D +KDG +T  E+  + ++++G +  +   + +  +D+
Sbjct:   66 TPEESQHRLGKIIDQMDKDNDKYITSGELFAWIKHVSRRWNLEDSEKQGKKYDTNKDGMISWDEYAKGVYGHLLGKGEEFYDVADKDKER-YRKMMMRDERRFKVADKDGDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEP-EPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQATNYGEDLTRRHDE 322          
BLAST of reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn2 (reticulocalbin 2 [Source:NCBI gene;Acc:733807])

HSP 1 Score: 87.8113 bits (216), Expect = 9.591e-19
Identity = 79/299 (26.42%), Postives = 144/299 (48.16%), Query Frame = 1
Query:  262 HEFDYDPHQTDSDYDEDLVTGTSHHAKR----TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE----VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYS--HHYDDEL 1128
            HE  Y+  + ++++D+ +  G    A+     + E     +  I +K+D ++D  +  +EL+ +I  + K    E T + F E+DK+ D  V+ DEY +H + +  +  EN        + + F +    ++ RF  AD D    LN+ E+    +P    HM+  ++   +E+ D + DG V  +EY+    D   D    E+     V+K R    + YDKD +G+++P E  + + P     ++EE  HL +E D N+D  ++ +E+  +  ++L  E  D   +    H Y DEL
Sbjct:   25 HEEHYENGEHNAEFDKKMFLGGEEEAEEFTELSPEDQLKRLKSIIRKIDTDSDGYLTEEELSFWIQKSFKHYILEDTKEHFAEIDKDGDGIVTWDEYNMHMYDRIIDYDENTV--LEDEEEESFRQIHLRDKRRFDHADRDDIPGLNLTEFTDFEHPEETDHMSEFVIEGALEEHDKDGDGFVSLEEYLG---DYTQDPGTVEDPHWLIVEKDR--FMNDYDKDGDGRLNPVELLSWIVPNNLGISQEEASHLMEEMDKNEDQRLSEEEILQNKDIFLTSEATDYGRQLQDKHFYHDEL 316          
BLAST of reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn2 (reticulocalbin 2 [Source:MGI Symbol;Acc:MGI:1349765])

HSP 1 Score: 100.523 bits (249), Expect = 2.775e-23
Identity = 73/271 (26.94%), Postives = 138/271 (50.92%), Query Frame = 1
Query:  295 SDYDEDLVTGTSH----HAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISE--EEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            +DYD + + G       + K   E+ +  +  I KK+D ++D  +  +EL+ +I  + K    +    +F E DKNSD  V+ DEY +  + +  +  EN   + + ++   F +    +++RF+ A+ DS   L++ E++   +P    +M   ++ E +E+ D N DG V  +E++    D   D   +E  E +  +++   + YDKD +G++DP+E  + + P  +  A+EE  HL  E D N D  ++ +E+  +  L+L  E  D
Sbjct:   40 ADYDREALLGVQEDVDEYVKLGHEEQQRRLQSIIKKIDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGAVTWDEYNIQMYDRVIDFDENT--ALDDTEEGSFRQLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLG---DYRRDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLSWVVPNNQGIAQEEALHLIDEMDLNSDKKLSEEEILENQDLFLTSEATD 305          
BLAST of reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn1 (reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559])

HSP 1 Score: 98.5969 bits (244), Expect = 1.424e-22
Identity = 72/245 (29.39%), Postives = 124/245 (50.61%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGE 1080
            + +++K  + +I  ++D + D  +  +EL L+I    K+   +  +  +K+ D++ D+K+S +EY   K       L N     +SS    F K +  +  RFKA+D D D      E+   L+P  + HM   +V E +ED D N DG V +DEYI        D     + V  +RE   D  D +K+GK+D +E    + P   + A+ E  HL  E+D NKD ++T +E+  + ++++G +
Sbjct:   70 SPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEY---KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFS-HEDNGPEPDWVLSEREQFNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQ 310          
BLAST of reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 94.3597 bits (233), Expect = 3.393e-21
Identity = 81/274 (29.56%), Postives = 126/274 (45.99%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSA-----NSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFL--DIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G        + T E++K  +  I  K+D + D  +   EL  +I    KK   +   ++++E D N D  +S DEY             N+T        +     ++ + +  +  RFK AD D D      E+   L+P  Y +M   +V E +ED D N DG +  +EYI      D  AD+    E VK +RE   +  DK+++GK+D EE    + P   + A+ E  HL  E+D NKDG +T +E+     L++G +  D
Sbjct:   46 DYDHDAFLGAEEAKSFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEY------------RNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEP---EWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 92.4337 bits (228), Expect = 1.361e-20
Identity = 82/269 (30.48%), Postives = 128/269 (47.58%), Query Frame = 1
Query:  298 DYDEDLVTGTSHHA---KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFL--DIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G        + T E++K  + +I  K+D + D  +  DEL  +I    K+   E    ++K  D N D  VS +EY   K+      L++     +     ++ + +  +  RFK AD D D      E+   L+P  Y +M   +V E +ED D N DG +  +EYI      D  AD+    E VK +RE   +  DK+++GK+D EE    + P   + A+ E  HL  E+D NKDG +T +E+     L++G +  D
Sbjct:   46 DYDHDAFLGAEEAKSFDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNEDGLVSWEEY---KNATYGYVLDD----PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEP---EWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 88.1965 bits (217), Expect = 6.263e-19
Identity = 68/268 (25.37%), Postives = 131/268 (48.88%), Query Frame = 1
Query:  340 KRTKEQTKTEIDEIFKKVD--KNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEY--FLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE--VKKKREAEFDKYDKDKNGKIDPEEY-YAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD 1122
            K + E+++  +  I  ++D   ++D  +   EL  +I    ++   +  S  +   D + D +V  +E     + H +  E   ++         + + K +  +  RF+ AD D D      E    L+P  +PHM   +V E +ED D N DG V  +EYI    D+ +++   EE   V+ +R+   +  D +K+G++D  E  Y +L P  + P   E +HL  E+DT+KDG ++  E+ S+ ++++G +  +   + + H+D+
Sbjct:   70 KLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDV------EDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIA---DLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLV-EANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDE 327          
BLAST of reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q62703|RCN2_RAT (Reticulocalbin-2 OS=Rattus norvegicus OX=10116 GN=Rcn2 PE=1 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.804e-23
Identity = 74/271 (27.31%), Postives = 139/271 (51.29%), Query Frame = 1
Query:  295 SDYDEDLVTGTSH----HAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISE--EEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            +DYD + + G       + K   E+ +  +  I KK+D ++D  +  +EL+ +I  + K    +    +F E DKNSD  V+ DEY +  + +  +  EN   + + ++ + F +    +++RF+ A+ DS   LN+ E++   +P    +M   ++ E +E+ D N DG V  +E++    D   D   +E  E +  +++   + YDKD +G++DP+E  + + P  +  A+EE  HL  E D N D  ++ +E+  +  L+L  E  D
Sbjct:   40 ADYDRETLLGVQEDVDEYVKLGHEEQQRRLQSIIKKIDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGTVTWDEYNVQMYDRVIDFDENT--ALDDTEEESFRQLHLKDKKRFEKANQDSGPGLNLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLG---DYRRDPTANEDPEWILVEKDRFVNDYDKDSDGRLDPQELLSWVVPNNQGIAQEEALHLIDEMDLNSDKKLSEEEILENQDLFLTSEATD 305          
BLAST of reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q14257|RCN2_HUMAN (Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.307e-23
Identity = 78/280 (27.86%), Postives = 140/280 (50.00%), Query Frame = 1
Query:  265 EFDYDPHQTDSDYDEDLVTGTSH----HAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHF-LDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            E  Y   +  SDYD + + G       + K   E+ +  +  I KK+D ++D  +   EL+ +I  + K    +    +F E DKNSD  V+ DEY +  + +  +  EN   + + ++ + F K    +++RF+ A+ DS   L++ E++   +P    +M   ++ E +E+ D N DG V  +E++  +  D  A++      V+K R    + YDKD +G++DP+E    + P  +  A+EE  HL  E D N D  ++ +E+  +  L+L  E  D
Sbjct:   27 ELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDEN--TALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFV--NDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDLFLTSEATD 302          
BLAST of reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q8BP92|RCN2_MOUSE (Reticulocalbin-2 OS=Mus musculus OX=10090 GN=Rcn2 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.941e-22
Identity = 73/271 (26.94%), Postives = 138/271 (50.92%), Query Frame = 1
Query:  295 SDYDEDLVTGTSH----HAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISE--EEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            +DYD + + G       + K   E+ +  +  I KK+D ++D  +  +EL+ +I  + K    +    +F E DKNSD  V+ DEY +  + +  +  EN   + + ++   F +    +++RF+ A+ DS   L++ E++   +P    +M   ++ E +E+ D N DG V  +E++    D   D   +E  E +  +++   + YDKD +G++DP+E  + + P  +  A+EE  HL  E D N D  ++ +E+  +  L+L  E  D
Sbjct:   40 ADYDREALLGVQEDVDEYVKLGHEEQQRRLQSIIKKIDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGAVTWDEYNIQMYDRVIDFDENT--ALDDTEEGSFRQLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLG---DYRRDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLSWVVPNNQGIAQEEALHLIDEMDLNSDKKLSEEEILENQDLFLTSEATD 305          
BLAST of reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q05186|RCN1_MOUSE (Reticulocalbin-1 OS=Mus musculus OX=10090 GN=Rcn1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 9.958e-22
Identity = 72/245 (29.39%), Postives = 124/245 (50.61%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGE 1080
            + +++K  + +I  ++D + D  +  +EL L+I    K+   +  +  +K+ D++ D+K+S +EY   K       L N     +SS    F K +  +  RFKA+D D D      E+   L+P  + HM   +V E +ED D N DG V +DEYI        D     + V  +RE   D  D +K+GK+D +E    + P   + A+ E  HL  E+D NKD ++T +E+  + ++++G +
Sbjct:   70 SPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEY---KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFS-HEDNGPEPDWVLSEREQFNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQ 310          
BLAST of reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|O93434|RCN1_TAKRU (Reticulocalbin-1 OS=Takifugu rubripes OX=31033 GN=rcn1 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.834e-21
Identity = 77/261 (29.50%), Postives = 132/261 (50.57%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAA--DKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD 1122
            + E++K  + +I  ++D + ++ I  DEL  +I    K+   E     + + D N D K+S +EY   K       L N      ++    F K +  +  RFK AD D D   N  E+   L+P  + HM   +V E +ED D N+DG V +DEYI    D+ A  D+    E VK +RE   D  D +K+GK+D +E    + P   + A+ E  HL  E+D +KD ++T +E+  + ++++G +  +   + + ++D+
Sbjct:   67 SPEESKDRLSKIVDRIDGDGNSYITTDELKAWIKRVQKRYVYENVVKVWADYDLNKDNKISWEEY---KQATYGYYLSNPEEFDETTDQFSFKKMLPRDERRFKRADLDGDSAANREEFTSFLHPEEFEHMKDIVVLETLEDIDKNSDGHVDEDEYIA---DMFAHEDRGPEPEWVKTEREQFSDFRDLNKDGKMDLDEIRHWIMPQDYDHAQAEARHLVYESDKDKDQMLTKEEILDNWNMFVGSQATNYGEDLTRNHDE 321          
BLAST of reticulocalbin-1 vs. TrEMBL
Match: E5G9H8 (Reticulocalbin-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 342/352 (97.16%), Postives = 342/352 (97.16%), Query Frame = 1
Query:   73 MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEXXXXXXXXXXXXXXXXXXXXYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDD  H D      YEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKI EEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL
Sbjct:    1 MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDPSHGDD-----YEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKILEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 347          
BLAST of reticulocalbin-1 vs. TrEMBL
Match: A0A504YZD3 (Reticulocalbin-1 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_06313 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 4.101e-40
Identity = 93/268 (34.70%), Postives = 153/268 (57.09%), Query Frame = 1
Query:  301 YDEDLVTGTSHHAKRTK----EQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEA-LENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            +D   + GT   A + +    E+ K  +  + +++D N D  ++++EL  +I+ + K L  E +    K+ D+NSD  VS  EY LHK    SE  +E L ++ +  +TQ F + ++HE+ +F +AD D +G LN  EY    YP  YPHMA   + + ++DFD + DG +G++EY++       D K+  E ++ ++ A F +YDK+ +GK+D EE    + PG+E  A  E DHL  ETD++KDG ++ DE+     LW+G +  D
Sbjct:   63 FDHQAILGTHEQAMQFRQLEPEEAKKRLARLVERMDTNQDGAVNKEELVDWIVHSFKLLDLESSRQRLKDRDENSDGAVSWAEY-LHKTFGYSELEMEELKKN-DGPETQAFVQSVEHEKVKFDSADLDKNGLLNETEYAAFEYPHNYPHMAPYEIIQTLKDFDRDKDGFIGEEEYLQ-------DSKMQPEALQIEK-ANFKRYDKNGDGKLDKEELVNWVTPGFERTAASEADHLIMETDSDKDGQLSKDEILRQHELWVGSQATD 320          
BLAST of reticulocalbin-1 vs. TrEMBL
Match: A0A074ZLX5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04760 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.522e-39
Identity = 96/286 (33.57%), Postives = 157/286 (54.90%), Query Frame = 1
Query:  286 QTDSDYDEDLVTG----TSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMA-HTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            Q D D D ++V G    T +  +   E+ KT + ++F+K+D N +  +D++EL  +I+ +   L  E    +  + D + D  ++ +EY    +  +S  LE L + + S++TQ F + I+ E+ +FK+AD D +G LN  E+    +P  YPHMA + I+H  + DFDT+NDG + + EY+       AD K+  E  K + E  F +YD + +G++D EE    + PG++  A EE +HLF ETD N D  ++ +EV +   LW+G +  D      H   DEL
Sbjct:   58 QRDFDLDHEVVLGSFEQTQYFKQLEPEEAKTRLGQLFEKMDANQNGNLDKNELIDWIVQSFTNLDLESAKIKLNDYDADQDGTLTWEEYTTRVYGYSSTELEQLAKDS-SNETQAFLRSIEEEKIKFKSADLDQNGHLNATEFTAFEHPHNYPHMAPYEIIHT-LRDFDTDNDGFISQQEYL-------ADDKMHREAFKIELE-NFKRYDTNGDGRLDQEEMKHWVTPGFQRTATEEAEHLFSETDANGDKELSKEEVLAQHELWVGSQATDYGRHLEHSIRDEL 333          
BLAST of reticulocalbin-1 vs. TrEMBL
Match: A0A4Z2DY42 (Reticulocalbin-2 OS=Schistosoma japonicum OX=6182 GN=EWB00_000740 PE=4 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.793e-38
Identity = 97/283 (34.28%), Postives = 161/283 (56.89%), Query Frame = 1
Query:  253 YEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKE----QTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            Y+ HE   D  Q  S+YD DL+TG+  ++++ KE    + K ++ ++F K+D +N+ KID++EL  +II +   L  E +   FKE D + D +++  EY    +  T + LE+L R    ++T  F + I  E+ RF +AD D  G+LN  E++   +P  Y HMA   +   + DFD + DG + + EY+       AD K++++ +  +RE  F  YD + +GK+D +E    + PG+   A +E++HLF ETD +KDG++T +EV     LW+G +  D
Sbjct:   22 YQGHEHYDDFGQHYSEYDHDLITGSHEYSQKFKELEPEEAKLQLGKLFHKIDVDNNAKIDKEELKNWIIQSFISLDLEASKPRFKEYDADGDGQLAWSEYTNKIYGYTEQELEDL-RKDGKNETSLFMQSIDEEKFRFDSADQDKTGYLNETEFVAFEHPHNYRHMAPYELKHTLRDFDKDKDGYISEVEYL-------ADDKMNKDALIVERE-NFKNYDINADGKLDHDEMALWITPGFNRTATDEMEHLFNETDKDKDGLLTKEEVIDQHDLWVGSQATD 295          
BLAST of reticulocalbin-1 vs. TrEMBL
Match: H2KNT6 (Calumenin-B OS=Clonorchis sinensis OX=79923 GN=calub PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.793e-38
Identity = 96/286 (33.57%), Postives = 156/286 (54.55%), Query Frame = 1
Query:  286 QTDSDYDEDLVTG----TSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMA-HTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            Q D D D ++V G    T +  +   E+ K  + ++F+K+D N +  +D++EL  +I+ +   L  E    + K+ D + D  ++ +EY    +  +S  LE L   + S++TQ F + I+ E+ +FK+AD D +G LN  E+    +P  YPHMA + I+H  + DFDT+NDG + + EY+       AD K+  E  K + E  F +YD + +G++D EE    + PG++  A EE +HLF ETD N D  ++ +EV +   LW+G +  D      H   DEL
Sbjct:   58 QRDFDLDHEVVLGSFEQTQYFKQLEPEEAKMRLGQLFEKMDANQNGNLDKNELIDWIVRSFTNLDLESAKIKLKDYDADQDGTLTWEEYTNRVYGYSSTELEQLAEDS-SNETQAFLRSIEEEKIKFKSADLDQNGQLNATEFTAFEHPHNYPHMAPYEIIHT-LRDFDTDNDGFISQQEYL-------ADDKMHREAFKIELE-NFKRYDTNGDGRLDQEEMKHWVTPGFQRTATEEAEHLFSETDANGDKQLSKEEVLAQHELWVGSQATDYGRHLEHSIRDEL 333          
BLAST of reticulocalbin-1 vs. Ensembl Cavefish
Match: calua (calumenin [Source:NCBI gene;Acc:103043492])

HSP 1 Score: 95.1301 bits (235), Expect = 1.486e-21
Identity = 78/267 (29.21%), Postives = 129/267 (48.31%), Query Frame = 1
Query:  298 DYDEDLVTG---TSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            DYD D   G          T E++K  + +I +K+D + D  +   EL  +I    KK   +    ++K+ D N+D  +S DEY   K+      L++           ++ + +  +  RFK AD + D   +  E+   L+P  Y HM   +V E +ED D N DG +  +EYI    +   D+    E V  +RE   +  DK+K+GK+D EE    + P   + A+ E  HL  E+D+NKDG ++ +E+ +   L++G +  D
Sbjct:   46 DYDHDAFLGEEVAKSFDDLTPEESKDRLGKIVEKIDDDQDGFVTEAELKEWIKKAQKKYIYDNVDRQWKDFDMNNDGMISWDEY---KNVTYGTYLDD----PEPDDGYNYKQMMARDERRFKMADRNGDSIADKEEFTAFLHPEEYEHMKEIVVLETMEDIDKNGDGFIDLEEYIGDMYN-HEDEMDEPEWVATEREQFSEFRDKNKDGKMDKEETMDWILPADYDHAEAEAKHLVYESDSNKDGKLSKEEILNKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:103039743])

HSP 1 Score: 93.2041 bits (230), Expect = 6.753e-21
Identity = 84/296 (28.38%), Postives = 140/296 (47.30%), Query Frame = 1
Query:  274 YDPHQTDSDYDEDLVTGTSHHAKRTKEQTKT-----------EIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE--VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD 1122
            +DP  +    +ED      H A   KE  KT            + +I  ++D + +  I  +EL  +I    K+   E  +  + + D N D K+S DEY   K       L N     +++    F K +  +  RFK AD D D      E+   L+P  + HM   +V E +ED D N DG V +DEYI    D+ A ++   E   VK +R+   D  D +K+GK+D EE    + P   + A+ E  HL  E+DT+KD ++T +E+  + ++++G +  +   + + ++D+
Sbjct:   31 HDPQPSRPPPEEDQSHRYDHEAFLGKEDAKTFDQLSPAESRDRLGKIVDRIDADGNGYITTEELKAWIKRVQKRYVYENVAKVWSDYDLNKDNKISWDEY---KQATYGYYLANPEEFEDATDQFSFKKMLPRDERRFKLADLDGDLAAEREEFTAFLHPEEFDHMKEIVVLETMEDIDKNGDGHVDEDEYIA---DMFAHEEGGPEPDWVKTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLLLESDTDKDQMLTKEEILENWNMFVGSQATNYGEDLTRNHDE 320          
BLAST of reticulocalbin-1 vs. Ensembl Cavefish
Match: calub (calumenin-B [Source:NCBI gene;Acc:103027690])

HSP 1 Score: 92.4337 bits (228), Expect = 1.111e-20
Identity = 72/248 (29.03%), Postives = 125/248 (50.40%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            T E++K  +  I  K+D+++D  +  +EL  +I    K+   E    +++  D N+D  VS +EY   K+      L++    ++     ++ + +  +  RFK AD+D +   +  E+   L+P  Y +M   +V E +ED D N DG +  DEYI        D     E V+ +RE   +  DK+K+G++D EE    + P   + A+ E  HL  E+DT+KDG++T  E+     L++G +  D
Sbjct:   65 TPEESKERLGLIVDKIDEDHDAHVTVEELKKWIKHAQKRWIYEDVDRQWQSHDLNADGYVSWEEY---KNATYGYILDD----SDPDDGFNYRQMMARDERRFKMADTDGNLQADKEEFTAFLHPEEYDYMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYSQDGDP-TEPEWVRTEREQFTEFRDKNKDGRMDKEETRDWILPSDYDHAEAEAKHLLYESDTDKDGMLTKQEIVDKYDLFVGSQATD 304          
BLAST of reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn2 (reticulocalbin 2 [Source:NCBI gene;Acc:103045530])

HSP 1 Score: 91.6633 bits (226), Expect = 1.672e-20
Identity = 70/255 (27.45%), Postives = 123/255 (48.24%), Query Frame = 1
Query:  340 KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAE-----FDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            K +  + + ++ EI K++D ++D  +  +E+T++I    K+   +   + F   D NSD  V+ DEY +  H  T E  EN        ++  F      E+ RF  AD+D    LNV E+L   +P    HM+   + + + ++D + DG +   E+I        D + SE +   + EAE      D YD++K+GK++ +E    + P     A+EE  HL KE D + D  ++  E+  +  +++  E  D
Sbjct:   44 KLSPSEQRGKMVEIVKRIDTDSDKFLTPEEITVWIQRVYKRYAMDDAQERFPGFDINSDGLVTWDEYNMVMHGHTVEVDENAVLEDPEEESLRFLH--LKEKRRFDFADTDGTSGLNVTEFLAFTHPSEVDHMSDFAIEDVLSEYDLDKDGFISLSEFI-------GDLRASESDEPSQWEAEETVRFKDLYDQNKDGKLNRDEQLRWVAPNSYGSAREEAVHLIKEMDQDGDERLSETEILKNQDIFMNSEVTD 289          
BLAST of reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:103045651])

HSP 1 Score: 82.0333 bits (201), Expect = 4.862e-17
Identity = 66/248 (26.61%), Postives = 119/248 (47.98%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEV--KKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEP 1083
            T E++K ++ +I  ++D + D  +   EL  +I    ++   E     +KE D++ D K++  EY     + T+         ++    + +   +  +  RFK AD D DG  +  E+   L+P  + +M   +V E +ED D N DG +  +EYI      + D +   E V  +KK+ +EF   D +K+G +D  E    + PG  + A  E  HL  ETD + D  +T  E+  + ++++G + 
Sbjct:   60 TPEESKAKLGKIVDRIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWKEYDQDKDGKIAWTEY-----KNTTYGFYLDDEFSDVENRESYKAMLMRDERRFKVADKDGDGIASREEFTAFLHPEEFSYMKDLVVQETVEDIDKNGDGKINLEEYIGDMY-TSEDGENEPEWVNTEKKQFSEF--RDVNKDGFLDASEVAQWILPGDVDHADIEAKHLIHETDRDNDDKMTKKEILENWNMFVGSQA 299          
BLAST of reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 102.449 bits (254), Expect = 8.211e-25
Identity = 73/256 (28.52%), Postives = 128/256 (50.00%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHH 1113
            + E++K  + +I +K+D + D  + +DE+T++I    ++   E    ++   D + D  VS +EY        +     L  S       ++ + +  +  RFKAAD D DG  +  E+   L+P  + HM   IV E +ED D N DG +  +EYI    + A + +   E VK +R+   D  D +K+GK+D EE  A + P   + A+ E  HL  E+D++KDG ++ +E+     L++G +  +     + H
Sbjct:   67 SPEESKERLGKIVEKIDSDGDGLVTQDEMTMWIKHTQRRWVYEDVDRQWTGHDIDGDGSVSWEEY-------RNATYGFLAVSPIEEDGFNYKQMLGRDERRFKAADVDGDGQASKEEFTAFLHPEEFEHMKDIIVTETMEDIDKNGDGFIDLNEYIGDMYNQAGESE-EPEWVKTERQQFTDFRDTNKDGKMDKEETMAWILPSDYDHAEAEARHLIYESDSDKDGKLSKEEILDKHDLFVGSQATNFGEALTRH 314          
BLAST of reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 84.7297 bits (208), Expect = 3.412e-19
Identity = 71/238 (29.83%), Postives = 117/238 (49.16%), Query Frame = 1
Query:  379 IFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIK-HFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            I  ++D+N D  +   ELT +I    ++   E    ++   D + D  V+  EY   K+   S   E      +  +    A  ++ ER RF+AAD D DG  + +EY   L+P  +PHM + +V E IED D N DG +  DEYI   + + + +      E ++K+ AE    D D +G +  +E  A + P   + A+ E  HL  E D ++DG +T +E+ +   L++G +  D
Sbjct:    2 IVTRIDENGDGLVTETELTEWIRHAQRRWVLEEAERQWSSHDLDGDGYVNWAEY---KNATYSYLAEEDPEDPDGYR----AMVLRDER-RFQAADVDGDGRASRNEYAAFLHPEEHPHMRNLVVTETIEDIDKNGDGFINVDEYIGDMYSEESEEGDSEWVESERKQFAEL--RDTDGDGLMGHDEVAAWILPDDYDQAEAESKHLIHECDDDQDGNLTREEIIAKYDLFVGSQATD 229          
BLAST of reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 81.6481 bits (200), Expect = 3.582e-18
Identity = 64/228 (28.07%), Postives = 114/228 (50.00%), Query Frame = 1
Query:  451 NMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQ---HERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDS----EYSHH 1113
            + ++  TE T   F EVD++ D  VS DEY  H++    E+L        ++     A ++Q    E+++F  ADSD    LN+ E+L   +P  + +M  +++ E + + D + DG V   E++  +    +  +   E V  + +    ++D D +GK++P E  + L P     A++E +HL +  DT+ DG ++ DEV  +  L+L  E  D       +Y+HH
Sbjct:    3 SFRRYATEETRAFFPEVDRDGDGVVSWDEYRQHEY----ESLPGGDGGEAAAAAAQVAHRMQLYAREKKKFGKADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQLGEQYAHH 226          
BLAST of reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 73.1738 bits (178), Expect = 4.528e-15
Identity = 63/243 (25.93%), Postives = 113/243 (46.50%), Query Frame = 1
Query:  451 NMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQK------------------TSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDS----EYSHH 1113
            + ++  TE T   F EVD++ D  VS DEY  H+++                        ++      SS    +A+    E+++F  ADSD    LN+ E+L   +P  + +M  +++ E + + D + DG V   E++  +    +  +   E V  + +    ++D D +GK++P E  + L P     A++E +HL +  DT+ DG ++ DEV  +  L+L  E  D       +Y+HH
Sbjct:    3 SFRRYATEETRAFFPEVDRDGDGVVSWDEYRQHEYESLPGGDGGEAAAAAGGGGGDGGGGDDEEEEERSSLQSLYAR----EKKKFGKADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQLGEQYAHH 241          
BLAST of reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: sdf4 (stromal cell derived factor 4 [Source:NCBI gene;Acc:406360])

HSP 1 Score: 56.6102 bits (135), Expect = 1.845e-9
Identity = 60/249 (24.10%), Postives = 113/249 (45.38%), Query Frame = 1
Query:  388 KVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDE----FKEVDKNSDQKVSLDEYFLH-------KHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAAD-SDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKK---ISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            +VDK+ D +I   EL  +I++  ++ H +   DE    F+ +D + D  V+ DEY L          +  +E + +        +T++    +   +ER+  AD +  D  LN  E+L   +P     M   +V E I D D + D  +   E+    L    ++K   I ++ V+++R+   +  D +K+G I   E    + P   + A  E   +    D ++D  ++LDEV  ++  + G + +D
Sbjct:    8 RVDKDRDKRISAVELQEWIVEKTRE-HLQQALDENKPHFRTLDPDGDGLVTWDEYRLRYLVSKGFDEKDIAERIRDKQELKIDEETEELMDNL---KERWNQADDAPQDQKLNEKEFLSFQHPEHSRSMLSYMVQEIIHDLDQDKDQRLSLSEFASLPLGTVENQKEQDIDDDWVRERRKEFIEVIDSNKDGFITRSELEEYMDPTSSHNALSEAKQMISVADEDEDAQLSLDEVLRYSEYFTGSKLVD 252          
BLAST of reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO31169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP9])

HSP 1 Score: 107.071 bits (266), Expect = 1.044e-26
Identity = 82/264 (31.06%), Postives = 137/264 (51.89%), Query Frame = 1
Query:  301 YDEDLVTGTSHHAK---RTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSD-EFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERE-RFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGG 1077
            YD D   G    A+    T +QTK  + E+F K+D + D KI   EL  +I  NMKK HT  +S+   +++DKN D KVS +EY   ++   +E          S++ +D  K+++   E R+K AD D+D  L + E  + ++P   P M   +V E +E  D++ DG +   EY      +   ++ +++ +K  ++   +  DKDK+G ++ EE  + + P   +P+  E +HL  E D NKD  +T+DE+     L+ G 
Sbjct:    2 YDHDAFLGEDQAAEFDELTPKQTKQRLRELFPKIDVDQDQKISLKELVEWIDVNMKK-HTRKSSESRMEQMDKNKDGKVSWEEYVNVEYDPKNE-------KGMSNENKDHLKEMKKRDEKRWKHADMDNDNLLTIDELQMFIHPEETPRMTSVLVQENMEMLDSDKDGKISFAEYAGKLSVMWRMREDNQDSLKSLKDDFNNDLDKDKDGSLNKEELKSWIFPSG-SPSSGEAEHLMTEVDKNKDNFLTVDEIMERYELFAGS 256          
BLAST of reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO35844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKE6])

HSP 1 Score: 102.449 bits (254), Expect = 1.005e-24
Identity = 79/269 (29.37%), Postives = 133/269 (49.44%), Query Frame = 1
Query:  292 DSDYDEDLVTGTSHHA--KRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYEN-PAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD 1089
            + DYD +   GT          E+ K  +  + ++VD N D  +  +ELT ++    KK   E   ++ KE D N D KV  +EY    +   +E  E +         ++F   ++ ++ RF AAD++ DGFL   E  + L+P   P M+   + E IED D + DGL+   E++  + +   +     + VK +     ++YDK+K+GK+D EE    + P  ++  A EE  HL    D N DG +T++E+E +  +++G E  D
Sbjct:   45 NPDYDHEAFLGTEKEEFDHLPPEEAKKRLRALIREVDNNKDGAVTTEELTDWVKGVFKKRSMEGVDNDLKEKDANEDGKVDWNEYSKGTYGDQTEDDEEM---------KEF---LRRDKRRFDAADTNKDGFLTREEMAIFLHPESSPEMSEVHILETIEDIDRDKDGLISLKEFLGEYEEEPGE---VPDWVKDETNRFNEEYDKNKDGKLDKEEVRLWILPETDHLMAAEEAKHLVSSADDNSDGKLTIEEIEKNYAVFVGSEATD 298          
BLAST of reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO49919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA2])

HSP 1 Score: 94.3597 bits (233), Expect = 2.957e-22
Identity = 79/245 (32.24%), Postives = 133/245 (54.29%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFK-KVDKNNDTKIDRDELTLYIIDNMKK-LHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFD-KYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWL 1071
            + E+TK +++++ K +VD + D  +  DEL L +++  +K   TE+ S      D N D KVS +E F   H   +E  E+  ++      +D AK        FK AD + DG L++HEY+   +P     M+  ++ + ++  DT+ DG++ K EY+  F D   D KI       + E +FD  +DK+K+GK+D  E    L P  ++ AKEE  H+ KE D NKDG ++++E+  H+ +++
Sbjct:   14 SAEETKQKLEQLVKSEVDLDKDGFVTEDELRLRLLNTSRKHRKTEVNS-TVTFHDDNKDGKVSWEE-FKKAHFTHTEGKED-DKATKEQMAEDEAK--------FKYADVNGDGMLDLHEYVTFYHPGDDERMSAWVIQDTLKKHDTDKDGMISKSEYMATFSDANNDAKI-------ELEKDFDTSFDKNKDGKLDQTEIRHWLFPD-DDMAKEEPAHMIKEADDNKDGKLSMEEILKHSSVFV 239          
BLAST of reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO31185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN5])

HSP 1 Score: 93.2041 bits (230), Expect = 5.715e-21
Identity = 71/235 (30.21%), Postives = 121/235 (51.49%), Query Frame = 1
Query:  355 QTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEV----DKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEV 1047
            ++K ++  I +K+D N D KI   EL     D++K +     ++E K++    D N D  V+ DEY       + +          S  T D  K   +E+ RF AAD+D D  L   E  +M+ P   P+MA  ++ EY+++FD +NDG + K E+I      + D+K+ ++EV++    +FD  D+D +G ++ +E   +L P       ++   LF+ TDT+ DG +T  E+
Sbjct:  120 ESKIKLRRILRKIDTNKDRKITEQELK----DHIKTMIDARLAEEGKKLMELYDNNMDGGVTWDEYANRSGYNSGDL---------SEPTGDQEKAKLNEKRRFAAADTDKDEKLTAVEIAMMMMPEDSPNMADVVIAEYLDNFDKDNDGKISKKEFIGAG---SEDEKL-DKEVEEGLATQFDDDDRDSSGFLEKDEIAGMLMP-------DDASLLFRNTDTDMDGFLTEKEI 330          
BLAST of reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO32638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH8])

HSP 1 Score: 78.9518 bits (193), Expect = 2.120e-16
Identity = 68/267 (25.47%), Postives = 124/267 (46.44%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANS--------SKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEE---VKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHH 1113
            + E++K  + ++  K+D ++D K+  +EL  +I  + K+   E    ++  + K    K+ +D+    K    +  +       N+            ++   I+ +R R++ AD + D  L+  EY   L+P  Y +M   +V E ++D D N DG V  +EY+    D+  + +  +EE   VK +RE      DK+++GK+D +E    + P   +    EV HL  E D NKDG +T  E+     ++ G +  D     + H
Sbjct:   66 SPEESKERLGKLVDKIDVDHDGKVTEEELKQWIKKSAKRYVYEDVDRQWDHLKKIEHAKIKMDDLVDGKRVDMAAPIGWEEYKNNTYGFIKEDDKSEYNYDNMIKRDRRRWEKADINRDDKLSKEEYTAFLHPEEYEYMKDVVVEETLDDIDKNKDGYVSLEEYLG---DLYPESEKEDEEPDWVKTEREQFLTVRDKNRDGKMDKDEVRDWIVPADFDHVGAEVTHLINEADVNKDGYLTKSEIIDKHEVFAGSQATDFGDALTRH 329          
BLAST of reticulocalbin-1 vs. Ensembl Medaka
Match: calub (calumenin [Source:NCBI gene;Acc:101165303])

HSP 1 Score: 95.5153 bits (236), Expect = 1.209e-21
Identity = 77/257 (29.96%), Postives = 125/257 (48.64%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKY-DKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHH 1113
            T E++K  +  +  ++D++ D  +  +E+  +I D  K+   +    ++K  D N D  VS +EY   K+      L++       S  Q  A+    +  RFK AD D+D   N  E+   L+P  Y HM   +V E +ED D N DG +  DEYI    +   D + +E E  K    +F ++ DK+K+GK+D EE    + P   + A+ E  HL  E+D +KDG +T  E+     L++G +  D     + H
Sbjct:   68 TPEESKERLGMLVDRIDEDKDGYVTAEEMKRWIKDAQKRWIYDDVDRQWKSHDLNGDGFVSWEEY---KNATYGYVLDDQDPDDGFSYKQMMAR----DERRFKMADQDNDMKANKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYN--QDGETTEPEWVKTEREQFTEFRDKNKDGKMDKEETKDWILPSDYDHAEAEAKHLVYESDVDKDGRLTKAEIVDKYDLFVGSQATDFGEALTRH 315          
BLAST of reticulocalbin-1 vs. Ensembl Medaka
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:101175141])

HSP 1 Score: 93.5893 bits (231), Expect = 7.525e-21
Identity = 77/257 (29.96%), Postives = 124/257 (48.25%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLD--EDSEYSH 1110
            T E+++  + +I +++D + D  I   EL  +I    K+   E  +  + + D N D ++S DEY   K       L N     +      F K +  +  RFKAAD + D   +  E+   L+P  + HM   +V E +ED D N DG V +DEYI        D     + VK +RE   D  D +K+GK+D +E    + P   + A+ E  HL  E+D +KD  +T DE+  + ++++G +  +  ED   SH
Sbjct:   97 TPEESRDRLGKIVERIDGDGDGYITTAELKDWIKRVQKRYVYENVAKVWTDYDLNKDNRISWDEY---KQATYGYYLANPEEFQDDKDQFSFKKMLPRDERRFKAADLNGDNTADKEEFTSFLHPEEFDHMKDIVVQETLEDIDKNGDGYVDEDEYIADMFS-HEDGGPEPDWVKTEREQFSDFRDLNKDGKMDKDEIRHWIMPQDYDHAQAEARHLVYESDQDKDQKLTKDEILENWNMFVGSQATNYGEDLTRSH 349          
BLAST of reticulocalbin-1 vs. Ensembl Medaka
Match: rcn3 (reticulocalbin-1 [Source:NCBI gene;Acc:101175408])

HSP 1 Score: 91.2781 bits (225), Expect = 3.119e-20
Identity = 69/247 (27.94%), Postives = 122/247 (49.39%), Query Frame = 1
Query:  346 TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEV--KKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGE 1080
            T E++K  + +I +++D + D  I   EL  +I    ++   +  +  +K+ DKN D +++ +EY     + T+          +      +   +  +  RF+AAD D+DG     E+   L+P  + HM   +V E +ED D N DG +  +EYI        D +   + V  +KK  +EF   D +K+G +D  E    + PG  + A  E  HL  ETDT+KDG +T  E+ ++ ++++G +
Sbjct:   65 TPEESKARLAKIVERIDTDKDGFISHAELHHWIKHRQRRYIEDNVNKHWKDYDKNRDDQIAWEEY-----KNTTYGYYLGEDFDDVEDKATYKSMLARDERRFRAADRDADGIATRSEFTAFLHPEEFDHMKDVVVQETLEDIDKNKDGKIDINEYIGDMF-TPEDGETEPDWVHTEKKHFSEF--RDSNKDGYLDAGEVAHWILPGEVDHADNEAKHLIHETDTDKDGKVTKKEILANWNMFVGSQ 303          
BLAST of reticulocalbin-1 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 86.2705 bits (212), Expect = 1.492e-18
Identity = 79/269 (29.37%), Postives = 127/269 (47.21%), Query Frame = 1
Query:  268 FDYDPHQTDSDYDEDLVTGTSHHAKR-TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKT-----SEALENLTRSANSSKTQDFAKKIQ-HERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFL--DIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEV 1047
            F+ D H  D D    L   T+   K+ T E+ + ++ EI KK+D N D  +  +E+TL+I    +K   E   + F E D N D  ++ +EY    H +      S  LE+          QD  +++   E++RF  AD D    L+V E+L   +P     MA   + + + ++DT+ DG +   E+I      D +  K   EE V+ K     + YD+DK+G ++ +E    + P     A+EE  HL  E D + D  I++ EV
Sbjct:   29 FNGDQHNPDHDMAVLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEYNTVAHDQLFTFDESTVLED--------PEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRGEDNSPSKWEIEETVRFK-----ELYDQDKDGNLNRDEQLRWIAPNSYGSAREEALHLINEMDQDGDEQISVAEV 284          
BLAST of reticulocalbin-1 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 74.3294 bits (181), Expect = 6.070e-14
Identity = 71/248 (28.63%), Postives = 116/248 (46.77%), Query Frame = 1
Query:  268 FDYDPHQTDSDYDEDLVTGTSHHAKR-TKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKT-----SEALENLTRSANSSKTQDFAKKIQ-HERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFL--DIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEE 984
            F+ D H  D D    L   T+   K+ T E+ + ++ EI KK+D N D  +  +E+TL+I    +K   E   + F E D N D  ++ +EY    H +      S  LE+          QD  +++   E++RF  AD D    L+V E+L   +P     MA   + + + ++DT+ DG +   E+I      D +  K   EE V+ K     + YD+DK+G ++ +E    + P     A+EE
Sbjct:   29 FNGDQHNPDHDMAVLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEYNTVAHDQLFTFDESTVLED--------PEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRGEDNSPSKWEIEETVRFK-----ELYDQDKDGNLNRDEQLRWIAPNSYGSAREE 263          
BLAST of reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000034805.1 (SMESG000034805.1)

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 352/352 (100.00%), Postives = 352/352 (100.00%), Query Frame = 1
Query:   73 MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEXXXXXXXXXXXXXXXXXXXXYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDSHHDDPSHGDDYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL
Sbjct:    1 MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDSHHDDPSHGDDYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 352          
BLAST of reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000034805.1 (SMESG000034805.1)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 342/342 (100.00%), Postives = 342/342 (100.00%), Query Frame = 1
Query:  103 MLFVMFIAQIKCSDPDHDTDQDHHESESVEXXXXXXXXXXXXXXXXXXXXYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            MLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDSHHDDPSHGDDYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL
Sbjct:    1 MLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDSHHDDPSHGDDYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 342          
BLAST of reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000034805.1 (SMESG000034805.1)

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 338/338 (100.00%), Postives = 338/338 (100.00%), Query Frame = 1
Query:  115 MFIAQIKCSDPDHDTDQDHHESESVEXXXXXXXXXXXXXXXXXXXXYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 1128
            MFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDSHHDDPSHGDDYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL
Sbjct:    1 MFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDSHHDDPSHGDDYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDDEL 338          
BLAST of reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000054251.1 (SMESG000054251.1)

HSP 1 Score: 125.561 bits (314), Expect = 1.090e-32
Identity = 93/330 (28.18%), Postives = 166/330 (50.30%), Query Frame = 1
Query:   73 MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEXXXXXXXXXXXXXXXXXXXXYEPHE-FDYDPHQTDSDYDEDLVTGTSHHAKRTK----EQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEV 1047
            M+ K  I  + L ++ +  I  S+ +     DHH   S                        PHE +D   H  D  +D D VTG+ H ++  K    E+ K  +  +  K+D N+D+ +++ EL  +I+ + + L  E  + + ++VD+N+D+ ++  EY    +  + + ++ + ++  S+  + F + +  ++++F+ AD ++D  L+V E+    +P  YP M+   + + +EDFD N DG V   E++   +D   DK+  E E K      F +YDKDKNG +   E    + PG+E  A  EV+HLF ETD NKD  ++ +E+
Sbjct:    1 MSIKTKITCISLTIILLFGIASSETEQHESDDHHADSST-----------------------PHEHYDKSGHH-DETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTG-STDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFV---VDEKMDKETEEHEKKS-----FAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEI 297          
BLAST of reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000012033.1 (SMESG000012033.1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.222e-18
Identity = 77/264 (29.17%), Postives = 125/264 (47.35%), Query Frame = 1
Query:  325 TSHHAKRTKEQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEF-DKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHH 1113
            +S +   + E++K ++ +I  K+D N+D KI  DEL  +I    ++   E T       DKN        +Y + K + T    EN  + A   +  D A  ++ +  R+  AD D D  L   E+   L+P     M   ++ E I+D D N DG +  DEYI+   +   D++  E +  K   A+F D  D +K+GK+D EE    + P   N    E  HL ++TD NKDG +T +E+     +++G +  D     + H
Sbjct:   58 SSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDT-------DKN------WADYTIEKDKLT---FENYKKKA--YEDDDEADMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEE--EPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDVNKDGHLTKEEILEKYDVFIGSQATDFGDALTRH 301          
The following BLAST results are available for this feature:
BLAST of reticulocalbin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RCN28.969e-2427.86reticulocalbin 2 [Source:HGNC Symbol;Acc:HGNC:9935... [more]
RCN21.104e-2127.03reticulocalbin 2 [Source:HGNC Symbol;Acc:HGNC:9935... [more]
CALU8.196e-2129.30calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU1.061e-2029.30calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU3.007e-2030.22calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
calu-11.015e-1828.20CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-11.015e-1828.20CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-24.452e-1526.01CALUmenin (Calcium-binding protein) homolog [Sour... [more]
C56C10.92.047e-826.81pep chromosome:WBcel235:II:6591048:6592351:-1 gene... [more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG316505.805e-2228.21gene:FBgn0031673 transcript:FBtr0301907[more]
CG316505.805e-2228.21gene:FBgn0031673 transcript:FBtr0301905[more]
CG316505.805e-2228.21gene:FBgn0031673 transcript:FBtr0079033[more]
CG316505.805e-2228.21gene:FBgn0031673 transcript:FBtr0079034[more]
CG316505.805e-2228.21gene:FBgn0031673 transcript:FBtr0301906[more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcn12.980e-2329.50reticulocalbin 1, EF-hand calcium binding domain [... [more]
calua6.114e-2229.89calumenin a [Source:NCBI gene;Acc:415241][more]
calua6.114e-2229.89calumenin a [Source:NCBI gene;Acc:415241][more]
calub2.825e-2128.63calumenin b [Source:NCBI gene;Acc:394057][more]
calub3.510e-2128.09calumenin b [Source:NCBI gene;Acc:394057][more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgf115.734e-2328.57fibroblast growth factor 11 [Source:Xenbase;Acc:XB... [more]
calu8.132e-2229.78calumenin [Source:NCBI gene;Acc:407965][more]
calu1.452e-2029.59calumenin [Source:NCBI gene;Acc:407965][more]
rcn31.208e-1928.19reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
rcn29.591e-1926.42reticulocalbin 2 [Source:NCBI gene;Acc:733807][more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rcn22.775e-2326.94reticulocalbin 2 [Source:MGI Symbol;Acc:MGI:134976... [more]
Rcn11.424e-2229.39reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559... [more]
Calu3.393e-2129.56calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Calu1.361e-2030.48calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Rcn36.263e-1925.37reticulocalbin 3, EF-hand calcium binding domain [... [more]
back to top
BLAST of reticulocalbin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62703|RCN2_RAT1.804e-2327.31Reticulocalbin-2 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q14257|RCN2_HUMAN4.307e-2327.86Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 P... [more]
sp|Q8BP92|RCN2_MOUSE1.941e-2226.94Reticulocalbin-2 OS=Mus musculus OX=10090 GN=Rcn2 ... [more]
sp|Q05186|RCN1_MOUSE9.958e-2229.39Reticulocalbin-1 OS=Mus musculus OX=10090 GN=Rcn1 ... [more]
sp|O93434|RCN1_TAKRU1.834e-2129.50Reticulocalbin-1 OS=Takifugu rubripes OX=31033 GN=... [more]
back to top
BLAST of reticulocalbin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E5G9H80.000e+097.16Reticulocalbin-1 OS=Schmidtea mediterranea OX=7932... [more]
A0A504YZD34.101e-4034.70Reticulocalbin-1 (Fragment) OS=Fasciola gigantica ... [more]
A0A074ZLX52.522e-3933.57Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4Z2DY421.793e-3834.28Reticulocalbin-2 OS=Schistosoma japonicum OX=6182 ... [more]
H2KNT61.793e-3833.57Calumenin-B OS=Clonorchis sinensis OX=79923 GN=cal... [more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calua1.486e-2129.21calumenin [Source:NCBI gene;Acc:103043492][more]
rcn16.753e-2128.38reticulocalbin 1 [Source:NCBI gene;Acc:103039743][more]
calub1.111e-2029.03calumenin-B [Source:NCBI gene;Acc:103027690][more]
rcn21.672e-2027.45reticulocalbin 2 [Source:NCBI gene;Acc:103045530][more]
rcn34.862e-1726.61reticulocalbin 3 [Source:NCBI gene;Acc:103045651][more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU8.211e-2528.52calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU3.412e-1929.83calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
rcn23.582e-1828.07reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
rcn24.528e-1525.93reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
sdf41.845e-924.10stromal cell derived factor 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of reticulocalbin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311691.044e-2631.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358441.005e-2429.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499192.957e-2232.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311855.715e-2130.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326382.120e-1625.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of reticulocalbin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calub1.209e-2129.96calumenin [Source:NCBI gene;Acc:101165303][more]
rcn17.525e-2129.96reticulocalbin 1 [Source:NCBI gene;Acc:101175141][more]
rcn33.119e-2027.94reticulocalbin-1 [Source:NCBI gene;Acc:101175408][more]
pstpip1a1.492e-1829.37proline-serine-threonine phosphatase-interacting p... [more]
pstpip1a6.070e-1428.63proline-serine-threonine phosphatase-interacting p... [more]
back to top
BLAST of reticulocalbin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034805.10.000e+0100.00SMESG000034805.1[more]
SMESG000034805.10.000e+0100.00SMESG000034805.1[more]
SMESG000034805.10.000e+0100.00SMESG000034805.1[more]
SMESG000054251.11.090e-3228.18SMESG000054251.1[more]
SMESG000012033.11.222e-1829.17SMESG000012033.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009457
GenBankADL74875.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009457 ID=SMED30009457|Name=reticulocalbin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1214bp
GATTTTCAAGGACATTAAAAATATCATATTTAAATCTTCAACTTTGGTAA
AAAAGTTAGTGATCGTTTCAAAATGAATCCAAAGTGTTTTATATTATCCT
TGATGTTATTTGTTATGTTCATAGCACAAATAAAATGCAGTGATCCTGAT
CATGATACCGATCAAGATCATCATGAATCAGAAAGCGTTGAGCATGGTGA
TGATTTTCATCACGACGATTCTCATCACGATGATCCAAGTCATGGTGATG
ATTATGAACCCCATGAATTTGATTACGATCCACATCAAACTGATTCAGAT
TATGATGAAGATTTAGTTACAGGAACTTCACACCATGCAAAGCGAACGAA
AGAACAAACCAAGACAGAAATTGATGAGATATTCAAAAAGGTTGACAAAA
ACAATGACACGAAAATAGACAGAGACGAATTGACGTTGTATATTATTGAC
AACATGAAGAAACTTCATACTGAAATCACAAGCGATGAATTTAAAGAGGT
TGATAAGAACTCTGATCAGAAAGTATCATTGGATGAGTACTTCCTACATA
AACACCAGAAAACTTCAGAAGCATTGGAGAATCTCACTCGTTCTGCTAAT
TCCAGCAAAACCCAGGATTTTGCCAAGAAAATTCAACATGAAAGAGAAAG
ATTCAAGGCAGCAGACAGTGATTCTGATGGGTTTTTGAATGTTCATGAAT
ATCTGTTAATGCTATATCCGGTTTTCTATCCTCATATGGCACATACAATT
GTACATGAATACATAGAGGATTTCGATACAAATAATGATGGTTTGGTTGG
GAAAGATGAATACATAAAGCACTTTCTTGACATTGCAGCGGACAAAAAAA
TATCAGAAGAAGAGGTTAAAAAGAAAAGAGAAGCCGAATTTGATAAATAC
GACAAAGATAAAAATGGAAAGATCGATCCTGAAGAATATTATGCAATACT
GAAACCAGGATATGAAAATCCAGCAAAGGAAGAAGTGGATCATCTATTCA
AAGAAACTGATACTAATAAAGATGGAATTATAACTTTGGATGAAGTTGAG
AGCCATGCCCATTTATGGCTTGGCGGTGAGCCACTTGATGAAGACAGCGA
ATACTCTCATCACTACGATGACGAATTGTAAGATTTTGAAACCGGGTTCA
AATTAGGTCTACGTAAAATCAGTCATGTTTTTAGTTGAATAAATAAATTT
GTAGTGGTCTTCGG
back to top

protein sequence of SMED30009457-orf-1

>SMED30009457-orf-1 ID=SMED30009457-orf-1|Name=SMED30009457-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=353bp
MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDS
HHDDPSHGDDYEPHEFDYDPHQTDSDYDEDLVTGTSHHAKRTKEQTKTEI
DEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQK
VSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSD
SDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKH
FLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENP
AKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD
EL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000105secretory cell
PLANA:0000141dorsal region of the whole animal
PLANA:0000418head
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0002054marginal adhesive zone
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 135..163
e-value: 29.0
score: 6.0
coord: 304..332
e-value: 2.7
score: 14.3
coord: 226..254
e-value: 1.5
score: 16.4
coord: 189..217
e-value: 16.0
score: 7.9
coord: 268..296
e-value: 1.0
score: 17.7
coord: 99..127
e-value: 0.35
score: 19.9
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 271..326
e-value: 3.9E-12
score: 46.4
coord: 98..156
e-value: 5.2E-8
score: 33.2
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 95..130
score: 12.756
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 131..166
score: 6.647
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 185..220
score: 9.743
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 222..257
score: 9.241
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 264..299
score: 12.617
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 300..335
score: 11.278
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 255..337
e-value: 3.0E-17
score: 65.1
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 159..254
e-value: 2.1E-11
score: 46.1
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 88..158
e-value: 1.7E-10
score: 42.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 27..58
NoneNo IPR availablePANTHERPTHR10827RETICULOCALBINcoord: 10..346
NoneNo IPR availablePANTHERPTHR10827:SF52IP16409Pcoord: 10..346
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.86
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 144..156
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 277..289
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 198..210
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 235..247
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 313..325
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 96..214
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 187..331