von Willebrand factor

Overview
Namevon Willebrand factor
Smed IDSMED30009453
Length (bp)1822
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of von Willebrand factor (SMED30009453) t-SNE clustered cells

Violin plots show distribution of expression levels for von Willebrand factor (SMED30009453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of von Willebrand factor (SMED30009453) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for von Willebrand factor (SMED30009453) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009453

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30009453 SmedASXL_013540SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009453 SmedASXL_013540SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30009453SMESG000068986.1 SMESG000032814.1 SMESG000031044.1 SMESG000026497.1 SMESG000023054.1 SMESG000005181.1 Contig16935newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009453SMESG000068986.1 SMESG000032814.1 SMESG000031044.1 SMESG000026497.1 SMESG000023054.1 SMESG000005181.1 Contig16935uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009453 dd_Smed_v6_3185_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009453 OX_Smed_1.0.18561ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009453 OX_Smed_1.0.23308ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30009453SMESG000068986.1 SMESG000032814.1 SMESG000031044.1 SMESG000026497.1 SMESG000023054.1 SMESG000005181.1 Contig16935newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009453SMESG000068986.1 SMESG000032814.1 SMESG000031044.1 SMESG000026497.1 SMESG000023054.1 SMESG000005181.1 Contig16935uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009453 Contig37777newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009453 Contig37777uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC6 (mucin 6, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7517])

HSP 1 Score: 77.411 bits (189), Expect = 6.802e-14
Identity = 70/244 (28.69%), Postives = 102/244 (41.80%), Query Frame = 2
Query:  557 CTANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGN-----C--SYLLCTEKGLVKWFDTKS-KECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEEL----------DGKCCY 1219
            CT  C  +  F+  +  CE TC S   L D+  + H     V GC CP GT L+  G+C+R  +C C   L+G  + L E+  + N     C    L C ++  +     ++ K  K+C    E      C  TC+       C   +C PGC C EG  Y   + +CV    CPC ++  +Y    +    CR C C   +G    ++G H   CP   +L  E  +          DG C Y
Sbjct:  660 CTIPCTGNTTFSYNSQACERTCLS---LSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCI--LEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEG-LYENADGQCVPPEECPCEFSGVSYPGGAELHTDCRTCSC--SRGRWACQQGTH---CPSTCTLYGEGHVITFDGQRFVFDGNCEY 892          

HSP 2 Score: 53.5286 bits (127), Expect = 1.424e-6
Identity = 39/122 (31.97%), Postives = 57/122 (46.72%), Query Frame = 2
Query:  902 ECNN-CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEK--CV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEE-----LDGKCCYCKPDKP 1237
            EC + C KTC + + + + +   C  GC CPEGT  +++     CV  ++CPC+ +   Y   E    AC+ C C + +  VCTE+ C      EG S VT  +       G C Y     P
Sbjct:  310 ECGSACVKTCSNPQHSCSSS---CTFGCFCPEGTVLNDLSNNHTCVPVTQCPCVLHGAMYAPGEVTIAACQTCRCTLGRW-VCTERPCPGHCSLEGGSFVTTFDARPYRFHGTCTYILLQSP 427          

HSP 3 Score: 51.6026 bits (122), Expect = 5.892e-6
Identity = 35/105 (33.33%), Postives = 49/105 (46.67%), Query Frame = 2
Query:  563 ANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVL----DNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTK 859
              CP ++V+  C   C +TCS+         +  C   C  GC CP GTVL    +N  C+ VT+C C   L G +Y  GE + +  C    CT   L +W  T+
Sbjct:  300 GQCPANQVYQECGSACVKTCSN--------PQHSCSSSCTFGCFCPEGTVLNDLSNNHTCVPVTQCPCV--LHGAMYAPGE-VTIAACQTCRCT---LGRWVCTE 390          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC6 (mucin 6, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7517])

HSP 1 Score: 74.7146 bits (182), Expect = 3.961e-13
Identity = 70/244 (28.69%), Postives = 102/244 (41.80%), Query Frame = 2
Query:  557 CTANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGN-----C--SYLLCTEKGLVKWFDTKS-KECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEEL----------DGKCCY 1219
            CT  C  +  F+  +  CE TC S   L D+  + H     V GC CP GT L+  G+C+R  +C C   L+G  + L E+  + N     C    L C ++  +     ++ K  K+C    E      C  TC+       C   +C PGC C EG  Y   + +CV    CPC ++  +Y    +    CR C C   +G    ++G H   CP   +L  E  +          DG C Y
Sbjct:  660 CTIPCTGNTTFSYNSQACERTCLS---LSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCI--LEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEG-LYENADGQCVPPEECPCEFSGVSYPGGAELHTDCRTCSC--SRGRWACQQGTH---CPSTCTLYGEGHVITFDGQRFVFDGNCEY 892          

HSP 2 Score: 51.9878 bits (123), Expect = 4.092e-6
Identity = 39/122 (31.97%), Postives = 57/122 (46.72%), Query Frame = 2
Query:  902 ECNN-CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEK--CV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEE-----LDGKCCYCKPDKP 1237
            EC + C KTC + + + + +   C  GC CPEGT  +++     CV  ++CPC+ +   Y   E    AC+ C C + +  VCTE+ C      EG S VT  +       G C Y     P
Sbjct:  310 ECGSACVKTCSNPQHSCSSS---CTFGCFCPEGTVLNDLSNNHTCVPVTQCPCVLHGAMYAPGEVTIAACQTCRCTLGRW-VCTERPCPGHCSLEGGSFVTTFDARPYRFHGTCTYILLQSP 427          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC6 (mucin 6, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7517])

HSP 1 Score: 70.0922 bits (170), Expect = 9.990e-12
Identity = 65/229 (28.38%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  545 TIFGCTANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNC-------SYLLCTEKGLVKWFDTKS-KECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTE 1192
            ++  CT  C  +  F+  +  CE TC S   L D+  + H     V GC CP GT L+  G+C+R  +C C   L+G  + L E+  + N          L C ++  +     ++ K  K+C    E      C  TC+       C   +C PGC C EG  Y   + +CV    CPC ++  +Y    +    CR C C   +G    ++G H   CP   +L  E
Sbjct:  656 SVDNCTIPCTGNTTFSYNSQACERTCLS---LSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCI--LEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEG-LYENADGQCVPPEECPCEFSGVSYPGGAELHTDCRTCSC--SRGRWACQQGTH---CPSTCTLYGE 873          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC6 (mucin 6, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7517])

HSP 1 Score: 70.0922 bits (170), Expect = 9.990e-12
Identity = 65/229 (28.38%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  545 TIFGCTANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNC-------SYLLCTEKGLVKWFDTKS-KECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTE 1192
            ++  CT  C  +  F+  +  CE TC S   L D+  + H     V GC CP GT L+  G+C+R  +C C   L+G  + L E+  + N          L C ++  +     ++ K  K+C    E      C  TC+       C   +C PGC C EG  Y   + +CV    CPC ++  +Y    +    CR C C   +G    ++G H   CP   +L  E
Sbjct:  656 SVDNCTIPCTGNTTFSYNSQACERTCLS---LSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCI--LEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEG-LYENADGQCVPPEECPCEFSGVSYPGGAELHTDCRTCSC--SRGRWACQQGTH---CPSTCTLYGE 873          
BLAST of von Willebrand factor vs. Ensembl Human
Match: MUC6 (mucin 6, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7517])

HSP 1 Score: 70.0922 bits (170), Expect = 9.990e-12
Identity = 65/229 (28.38%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  545 TIFGCTANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNC-------SYLLCTEKGLVKWFDTKS-KECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTE 1192
            ++  CT  C  +  F+  +  CE TC S   L D+  + H     V GC CP GT L+  G+C+R  +C C   L+G  + L E+  + N          L C ++  +     ++ K  K+C    E      C  TC+       C   +C PGC C EG  Y   + +CV    CPC ++  +Y    +    CR C C   +G    ++G H   CP   +L  E
Sbjct:  656 SVDNCTIPCTGNTTFSYNSQACERTCLS---LSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCI--LEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEG-LYENADGQCVPPEECPCEFSGVSYPGGAELHTDCRTCSC--SRGRWACQQGTH---CPSTCTLYGE 873          
BLAST of von Willebrand factor vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0075753)

HSP 1 Score: 57.7658 bits (138), Expect = 2.992e-8
Identity = 66/234 (28.21%), Postives = 102/234 (43.59%), Query Frame = 2
Query:  518 KKISSSADVTIFGCTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGT-VLDNGKCIRVTECSCYHSLDGKVYELGEK-IKLGNCSYLLCT-----------EKGLVKWFDTKSKECKTCDNGREP-CECNNCE----KTCKHR-KFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            + + +   +++  C   CP  +VF  C   C  +C    S      K  C  +CV GC+CP G  V ++G+C+    C C  + DG  +  G K ++ G     LCT           E G    +   S+    C   ++P  E   C     KTCK+  K+ A+ +  +C+PGC C EG  Y      CV  + C C +  ++Y+  EK  + C  CEC       C++ GC
Sbjct: 1114 QGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSCDDLPS------KGSCKRECVEGCRCPHGEYVNEDGECVPKKMCHC--NFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKC--AKQPYAEFTKCAPKEPKTCKNMDKYVADSS--DCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKEDCNLCECRAGNWK-CSKNGC 1334          
BLAST of von Willebrand factor vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0333020)

HSP 1 Score: 57.7658 bits (138), Expect = 3.149e-8
Identity = 66/234 (28.21%), Postives = 102/234 (43.59%), Query Frame = 2
Query:  518 KKISSSADVTIFGCTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGT-VLDNGKCIRVTECSCYHSLDGKVYELGEK-IKLGNCSYLLCT-----------EKGLVKWFDTKSKECKTCDNGREP-CECNNCE----KTCKHR-KFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            + + +   +++  C   CP  +VF  C   C  +C    S      K  C  +CV GC+CP G  V ++G+C+    C C  + DG  +  G K ++ G     LCT           E G    +   S+    C   ++P  E   C     KTCK+  K+ A+ +  +C+PGC C EG  Y      CV  + C C +  ++Y+  EK  + C  CEC       C++ GC
Sbjct: 1113 QGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSCDDLPS------KGSCKRECVEGCRCPHGEYVNEDGECVPKKMCHC--NFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKC--AKQPYAEFTKCAPKEPKTCKNMDKYVADSS--DCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKEDCNLCECRAGNWK-CSKNGC 1333          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 62.7734 bits (151), Expect = 1.025e-9
Identity = 61/215 (28.37%), Postives = 94/215 (43.72%), Query Frame = 2
Query:  557 CTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVL-DNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVK--------------WFD----TKSKECKTCDNGREPCECNN-------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECEC 1111
            C   CP  +V+  C  +C +TC S  SL D      C   C  GC CP G  L D G+C+    CSC+H  +G+++E  + I  G+   +   E G +               +FD    ++ +   +C    +  EC +       C KTC++ +   +C    C+ GC CP GT      + C+   +CPC +N+R Y   +  T  C  C C
Sbjct:  627 CELTCPDAQVYEMCGSVCNQTCRSL-SLPDT----GCDGVCEEGCFCPRGLFLSDAGECVPPQHCSCHH--NGEIFEPNDMI--GDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLEL--DCVSLGCVSGCMCPPGTV--RYRKDCIPQEQCPCYHNSRPYESGQSITVDCNTCVC 828          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 61.2326 bits (147), Expect = 3.388e-9
Identity = 61/213 (28.64%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  557 CTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVL-DNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVK--------------WFDTKS----KECKTCDNGREPCECNN-------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECEC 1111
            C   CP  +V+  C  +C +TC S  SL D      C   C  GC CP G  L D G+C+    CSC+H  +G+++E  + I  G+   +   E G +               +FD +S    +   +C    +  EC +       C KTC++ +   +C    C+ GC CP GT     +     +CPC +N+R Y   +  T  C  C C
Sbjct:  641 CELTCPDAQVYEMCGSVCNQTCRSL-SLPDT----GCDGVCEEGCFCPRGLFLSDAGECVPPQHCSCHH--NGEIFEPNDMI--GDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLEL--DCVSLGCVSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSITVDCNTCVC 842          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: muc5.3 (mucin 5.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1562])

HSP 1 Score: 61.2326 bits (147), Expect = 4.065e-9
Identity = 55/181 (30.39%), Postives = 72/181 (39.78%), Query Frame = 2
Query:  602 CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVL-DNGKCIRVTECSCYHSLDGKVYELGEKIKL--GNCSYLLCTEKGLVKWFDTKSKECK------TCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSR--CPCMYNNRTYNVNEKWTDACRECEC 1111
            C  TC S           H     V GC C  G  + +NG C+    CSCY S  GKV  LGE I    G+C   +C +  L     +  +EC        C +     E   C+K+C        C    C+ GC CP G   S+    C+ +  CPC++N  TY   E     C  C C
Sbjct:  701 CGRTCRSLSQADGSCTHDHV---LVDGCGCAEGKYMNENGDCVEAAACSCYDS--GKVVALGETISKDGGSC---ICQQGKLSCSGVSNGEECTEPMRFFNCSSASPGSEGAECQKSCNTLDMA--CISTGCVSGCVCPSG-LVSDGNGGCIDKDQCPCIHNGHTYQSGESIKIDCNTCSC 870          

HSP 2 Score: 53.5286 bits (127), Expect = 7.633e-7
Identity = 39/110 (35.45%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  908 NNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEK-CV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECP-----EGESLVTEEELDGKC 1213
            N C  TC + +    C  + CI GC CP GT Y +I +  C+  + C C+   + Y   E +T  CR+C C  D+G    +  C+IK+CP     EG S +T    DGK 
Sbjct:  332 NPCTDTCTNSERGQVC-AQHCIDGCFCPPGTVYDDIHQSGCIPYTECSCVLGGKIYASGENYTSNCRDCTC--DQG----QWDCYIKDCPHSCSVEGGSHIT--TFDGKA 432          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 58.151 bits (139), Expect = 3.331e-8
Identity = 57/199 (28.64%), Postives = 80/199 (40.20%), Query Frame = 2
Query:  557 CTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTV--LDNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKT------CDN---GREPCECNNCEKTCKHRKFTANCNFKE-CIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECEC 1111
            C  +CP    +  C+  C+  C  F SL      Q C D+C  GC CP GT   +    C+   EC C  S  G  Y  G+ I + +    +C +  LV         C        C N   G    +   CE+TC+       C+  E C+PGC CP G      E      CPC++  + Y   +K +  C +C C
Sbjct:  759 CAVSCPSTMEYGVCVSACQRRCL-FLSLP-----QPCGDECEEGCVCPEGTYFNMHTHTCVPRNECPC--SFLGADYSPGDVI-ITSSGVQICQDGKLVSQTSIIETLCPAGQFYEDCGNRVDGPSASKGLACEQTCETYLLNLTCSTHEPCVPGCVCPAGLLKHGDECFKPRACPCLWKGKEYYPGDKVSSPCHQCVC 948          
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Match: CR848794.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_42:41827381:41835246:-1 gene:ENSDARG00000113851.1 transcript:ENSDART00000193188.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR848794.2)

HSP 1 Score: 56.9954 bits (136), Expect = 7.518e-8
Identity = 50/173 (28.90%), Postives = 69/173 (39.88%), Query Frame = 2
Query:  599 ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCEC-----------------NNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTY 1066
            +C +TCSS  +     K Q CP  C  GCQC  G + D G+C  + +C C+  +DG  Y+ GE + LG C        G+      + K+ + CD       C                   C  TC +R     C    C+ GC C  G   S  E   V +C C Y  + Y
Sbjct:  571 LCTDTCSS--TCASLTKSQRCP-LCQEGCQCDDGFLFDGGECKALQDCGCH--VDGTFYKSGEAVVLGECKETCTCTAGVFTCVPMECKKEEICDKKEGAVGCYSKKTYCPVNMHYEACGTACAPTCANRDGPEKCAL-PCVEGCQCNAGFVRSGDECIPVKQCGCAYKGQYY 737          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ENSXETT00000018772.1 (mucin-2-like [Source:NCBI gene;Acc:100495470])

HSP 1 Score: 61.6178 bits (148), Expect = 4.068e-9
Identity = 64/212 (30.19%), Postives = 81/212 (38.21%), Query Frame = 2
Query:  566 NCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGEKIKLGNC------SYLLCTEKGL-----VKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCH 1153
            NCP +  +   I  C+ TC S             P   V GC CP GT LD +G C+    C CY+   G     GE I             L C  K L     + +FD        C N         C+KTC       +C   +C  GC CP+G   +     CV   +CPCM+N   Y+  E     C  C C  D+   CT K CH
Sbjct:  663 NCPKNTTYQYSISSCQPTCRSLSEPDPTCSVSFPP---VDGCGCPNGTYLDESGSCVPDHNCPCYYK--GTPMPAGEVIYDNGAMCTCQSGRLQCVGKTLKCPENMVYFD--------CANASMGARGAECQKTC--HTLDMDCISIQCASGCICPDGLVLNN-NGSCVPEEQCPCMHNGEMYHSGETIQQDCNTCVC-KDRKWNCTNKACH 857          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ENSXETT00000033057.1 (mucin-2-like [Source:NCBI gene;Acc:100495470])

HSP 1 Score: 61.6178 bits (148), Expect = 4.182e-9
Identity = 64/212 (30.19%), Postives = 81/212 (38.21%), Query Frame = 2
Query:  566 NCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGEKIKLGNC------SYLLCTEKGL-----VKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCH 1153
            NCP +  +   I  C+ TC S             P   V GC CP GT LD +G C+    C CY+   G     GE I             L C  K L     + +FD        C N         C+KTC       +C   +C  GC CP+G   +     CV   +CPCM+N   Y+  E     C  C C  D+   CT K CH
Sbjct:  663 NCPKNTTYQYSISSCQPTCRSLSEPDPTCSVSFPP---VDGCGCPNGTYLDESGSCVPDHNCPCYYK--GTPMPAGEVIYDNGAMCTCQSGRLQCVGKTLKCPENMVYFD--------CANASMGARGAECQKTC--HTLDMDCISIQCASGCICPDGLVLNN-NGSCVPEEQCPCMHNGEMYHSGETIQQDCNTCVC-KDRKWNCTNKACH 857          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ENSXETT00000018702.1 (mucin-2-like [Source:NCBI gene;Acc:100495470])

HSP 1 Score: 60.8474 bits (146), Expect = 6.083e-9
Identity = 63/209 (30.14%), Postives = 85/209 (40.67%), Query Frame = 2
Query:  560 TANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHS-----LDGKVYELG-EKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCH 1153
            T NCP +  +   I  C+ TC S             P   V GC CP GT LD +G C+    C CY+          +Y+ G + I+  N   L    + +V +FD        C N         C+KTC       +C   +C  GC CP+G   +     CV   +CPCM+N   Y+  E     C  C C  D+   CT K CH
Sbjct:  619 TKNCPKNTTYQYSISSCQPTCRSLSEPDPTCSVSFPP---VDGCGCPNGTYLDESGSCVPDHNCPCYYKGTPMPAGEVIYDNGAQAIETSNIFCLTECPENMV-YFD--------CANASMGARGAECQKTC--HTLDMDCISIQCASGCICPDGLVLNN-NGSCVPEEQCPCMHNGEMYHSGETIQQDCNTCVC-KDRKWNCTNKACH 811          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: ENSXETT00000033131.1 (mucin-2-like [Source:NCBI gene;Acc:100495470])

HSP 1 Score: 59.3066 bits (142), Expect = 2.035e-8
Identity = 60/193 (31.09%), Postives = 77/193 (39.90%), Query Frame = 2
Query:  599 ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGE-----KIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCH 1153
            IC+ TC S             P   V GC CP GT LD +G C+    C CY+   G     GE      I+  N   L    + +V +FD        C N         C+KTC       +C   +C  GC CP+G   +     CV   +CPCM+N   Y+  E     C  C C  D+   CT K CH
Sbjct:  625 ICQPTCRSLSEPDPTCSVSFPP---VDGCGCPNGTYLDESGSCVPDHNCPCYY--KGTPMPAGEVIYDNAIETSNIFCLTECPENMV-YFD--------CANASMGARGAECQKTC--HTLDMDCISIQCASGCICPDGLVLNN-NGSCVPEEQCPCMHNGEMYHSGETIQQDCNTCVC-KDRKWNCTNKACH 799          
BLAST of von Willebrand factor vs. Ensembl Xenopus
Match: pigo (phosphatidylinositol glycan anchor biosynthesis class O [Source:Xenbase;Acc:XB-GENE-5945117])

HSP 1 Score: 58.151 bits (139), Expect = 4.866e-8
Identity = 58/193 (30.05%), Postives = 83/193 (43.01%), Query Frame = 2
Query:  557 CTANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLV-KWFDT--KSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSR--CPCMYNNRTYNVNEKWTDACRECEC 1111
            CT  CP ++ ++  T  C  TC S   L +K  + +  D  V GC CP G  LDN   C+R   C CY  LD     L ++           T  GL    F +    K  KTCD+  +      C  TC+      +C   +C+ GC CP GT Y +++  CV++  C C +    Y   +     C+ C C
Sbjct:  633 CTVQCPGNQTYSYNTTSCGRTCLS---LSNKELECYPNDIPVEGCNCPTGFYLDNKNMCVRKESCPCY--LDANTILLPQQQT---------TYNGLTCNHFKSCPAPKMMKTCDSLTDKYGAA-CAPTCQLLATGISCIPTKCVSGCVCPSGT-YEDLDGNCVNQTDCSCEFGGEIYKTGDTMQSECQSCTC 809          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 63.929 bits (154), Expect = 5.891e-10
Identity = 65/217 (29.95%), Postives = 89/217 (41.01%), Query Frame = 2
Query:  560 TANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGL---------------VKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            T  CP    +   I  C+ TC +   L +K    H     V GC CP GT LD+ GKC++ T C CY+   G     GE ++    +   CT+  L               + +FD        C N         C+K+C     T  C   EC+PGC CP G   ++    CV    CPC++N  TY   E     C  C C  ++   CT+K C
Sbjct:  700 TITCPKSMTYQYHISTCQPTCRA---LNEKDVTCHVSFIPVDGCTCPKGTFLDDLGKCVQATSCPCYYK--GSTVPNGESVQDSG-AICTCTQGALTCIGGPAPTPVCDAPMIYFD--------CHNATPGDTGAGCQKSCHTLDMT--CYSSECVPGCVCPNG-LVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNCTC-ENRMWQCTDKPC 898          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 63.5438 bits (153), Expect = 7.988e-10
Identity = 65/211 (30.81%), Postives = 89/211 (42.18%), Query Frame = 2
Query:  560 TANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNN---------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            T  CP    +   I  C+ TC +   L +K    H     V GC CP GT LD+ GKC++ T C CY+   G     GE ++    +   CT+  L             CD      +C+N         C+K+C     T  C   EC+PGC CP G   ++    CV    CPC++N  TY   E     C  C C  ++   CT+K C
Sbjct:  699 TITCPKSMTYQYHISTCQPTCRA---LNEKDVTCHVSFIPVDGCTCPKGTFLDDLGKCVQATSCPCYYK--GSTVPNGESVQDSG-AICTCTQGALTCIGGPAPT--PVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMT--CYSSECVPGCVCPNG-LVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNCTC-ENRMWQCTDKPC 897          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 63.5438 bits (153), Expect = 7.988e-10
Identity = 65/211 (30.81%), Postives = 89/211 (42.18%), Query Frame = 2
Query:  560 TANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNN---------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            T  CP    +   I  C+ TC +   L +K    H     V GC CP GT LD+ GKC++ T C CY+   G     GE ++    +   CT+  L             CD      +C+N         C+K+C     T  C   EC+PGC CP G   ++    CV    CPC++N  TY   E     C  C C  ++   CT+K C
Sbjct:  699 TITCPKSMTYQYHISTCQPTCRA---LNEKDVTCHVSFIPVDGCTCPKGTFLDDLGKCVQATSCPCYYK--GSTVPNGESVQDSG-AICTCTQGALTCIGGPAPT--PVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMT--CYSSECVPGCVCPNG-LVADGNGGCVVTEDCPCVHNEATYRPGETIQVGCNNCTC-ENRMWQCTDKPC 897          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 62.7734 bits (151), Expect = 1.226e-9
Identity = 67/235 (28.51%), Postives = 95/235 (40.43%), Query Frame = 2
Query:  569 CPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYH---------SLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGR--EPCECNNCEKTCKHRKFT---ANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCC 1216
            CPP +V +TC  +C   CS        V+     + C  GC CP G +L NG CI    C C            L+ +  EL     L  NC++  C     +        +C+ C  G   +  +   CEKTC     T   +NC   +  PGC C  G Y+      CV    C C ++   +    +W +AC  C C   K +VC  + C    C +GE ++ E    G CC
Sbjct: 4805 CPPGQVLSTCATMCPSLCSHLWPGTICVR-----EPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFI----CSLTDCQECAPGEIWQHGKLGPCEKTCPEMNMTQAWSNCTEAQA-PGCVCQLG-YFRSQTGLCVPEDHCECWHHGSPHLPGSEWQEACESCRCLHGK-SVCI-RHCPELSCAQGEVIMQEP---GSCC 5023          

HSP 2 Score: 50.447 bits (119), Expect = 7.811e-6
Identity = 54/198 (27.27%), Postives = 79/198 (39.90%), Query Frame = 2
Query:  557 CTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCEC--------NNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSR--CPCMYNNRTYNVNEKWTDACRECEC 1111
            C  +CP  +V+  C  +C   C      K+          CV GC CP G + D  G+C+  + C C     G  Y +     + +CS+ +C E+GL  W       C      R+   C          C  TC   +   +C +     GC CP GT    +++ CVS   CPC +N + Y  N    + C  C C
Sbjct:  825 CPVSCPGGQVYQECAPVCGHHCGEPEDCKEL-------GICVAGCNCPPGLLWDLEGQCVPPSMCHC--QFGGHRYTI-NTTTVRDCSHCICQERGL--W------NCTAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSC-WAGSTDGCVCPPGTVL--LDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVC 1001          
BLAST of von Willebrand factor vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 62.7734 bits (151), Expect = 1.258e-9
Identity = 67/235 (28.51%), Postives = 95/235 (40.43%), Query Frame = 2
Query:  569 CPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYH---------SLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGR--EPCECNNCEKTCKHRKFT---ANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCC 1216
            CPP +V +TC  +C   CS        V+     + C  GC CP G +L NG CI    C C            L+ +  EL     L  NC++  C     +        +C+ C  G   +  +   CEKTC     T   +NC   +  PGC C  G Y+      CV    C C ++   +    +W +AC  C C   K +VC  + C    C +GE ++ E    G CC
Sbjct: 4814 CPPGQVLSTCATMCPSLCSHLWPGTICVR-----EPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFI----CSLTDCQECAPGEIWQHGKLGPCEKTCPEMNMTQAWSNCTEAQA-PGCVCQLG-YFRSQTGLCVPEDHCECWHHGSPHLPGSEWQEACESCRCLHGK-SVCI-RHCPELSCAQGEVIMQEP---GSCC 5032          

HSP 2 Score: 50.447 bits (119), Expect = 7.812e-6
Identity = 54/198 (27.27%), Postives = 79/198 (39.90%), Query Frame = 2
Query:  557 CTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCEC--------NNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSR--CPCMYNNRTYNVNEKWTDACRECEC 1111
            C  +CP  +V+  C  +C   C      K+          CV GC CP G + D  G+C+  + C C     G  Y +     + +CS+ +C E+GL  W       C      R+   C          C  TC   +   +C +     GC CP GT    +++ CVS   CPC +N + Y  N    + C  C C
Sbjct:  825 CPVSCPGGQVYQECAPVCGHHCGEPEDCKEL-------GICVAGCNCPPGLLWDLEGQCVPPSMCHC--QFGGHRYTI-NTTTVRDCSHCICQERGL--W------NCTAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSC-WAGSTDGCVCPPGTVL--LDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVC 1001          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|P98167|SSPO_BOVIN (SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 1.118e-12
Identity = 71/245 (28.98%), Postives = 105/245 (42.86%), Query Frame = 2
Query:  569 CPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYH---------SLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGR-----EPCECNNCEKTCKHRKFT---ANCNFKECIPGCCCPEGTYYSEIEEKC--VSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKP 1237
            CPP +V + C   C   CS        ++     + C  GC CP G +L NG C+   EC C           +L+ +  EL     L  NC++ +C        F     +C+ C  G       P E   CE+TC+    T    NC+ ++  PGC C  G + S+ E  C  V  C C ++ R +    +W  AC  C C V   ++CT+  C    C +GE+ V  +E  G C  C+ + P
Sbjct: 4816 CPPGQVLSACAVSCPRLCSHLQPGTPCMQ-----EPCQLGCDCPRGQLLHNGTCVPPAECPCTQLSLPWGLTLTLEEQHRELPPGTLLTQNCTHCICQGGA----FSCSLTDCQECPPGETWQQVAPGELGPCEQTCREPNATETQGNCSGRQA-PGCVCQRGHFRSQ-EGPCVPVDLCECWHHGRPHPPGSEWQKACESCRC-VSGESICTQH-CPPLTCAQGETAV--QEPGGCCPTCRQEAP 5045          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|Q6W4X9|MUC6_HUMAN (Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 4.797e-11
Identity = 65/229 (28.38%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  545 TIFGCTANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNC-------SYLLCTEKGLVKWFDTKS-KECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTE 1192
            ++  CT  C  +  F+  +  CE TC S   L D+  + H     V GC CP GT L+  G+C+R  +C C   L+G  + L E+  + N          L C ++  +     ++ K  K+C    E      C  TC+       C   +C PGC C EG  Y   + +CV    CPC ++  +Y    +    CR C C   +G    ++G H   CP   +L  E
Sbjct:  656 SVDNCTIPCTGNTTFSYNSQACERTCLS---LSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCI--LEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEG-LYENADGQCVPPEECPCEFSGVSYPGGAELHTDCRTCSC--SRGRWACQQGTH---CPSTCTLYGE 873          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|Q28833|VWF_PIG (von Willebrand factor (Fragment) OS=Sus scrofa OX=9823 GN=VWF PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.254e-10
Identity = 64/228 (28.07%), Postives = 92/228 (40.35%), Query Frame = 2
Query:  557 CTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYE----LGEKIKLGNC--SYLLCTEKG----------LVKWFDTKSKECKTC-----------DNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            C  +CPP +V+  C   C  TC S          + C + C+ GC CP G  LD +G C+   +C CYH  DG++++      +   +  C   ++ C+  G          L      +SK   +C           DN R   E   C KTC++  +   C    C+ GC CP G    E     + RCPC +  R Y   E     C  C C  D+   CT+  C
Sbjct:  322 CALSCPPGQVYLQCGTPCNLTCRSL-----SYPDEECAEDCLEGCFCPPGLYLDGSGDCVPKAQCPCYH--DGEIFQPEDIFSDHHTMCYCEDGFMHCSRAGAPGSLQPEVVLSSPLSHRSKRSLSCRPPMVKLVCPADNPRA--EGLECAKTCQN--YDLECVSTGCVSGCLCPPGMVRHENRCVALQRCPCFHQGREYAPGETVKVDCNTCVCR-DRKWSCTDHVC 537          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|Q7Z5P9|MUC19_HUMAN (Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 3.481e-10
Identity = 56/211 (26.54%), Postives = 91/211 (43.13%), Query Frame = 2
Query:  557 CTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNN------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGA-VCTEKGCH 1153
            C  +CP   VF   +  C  +C S   L ++ +     D  V GC CP     +N G C+  ++C CY  ++ +V + G+ I + + +  +C + G++          + C  G E  +C++        +TC  R          C  GC CPEG   +  +  CV  + CPC +  R Y+     +  C EC C   KG+  CT+  C 
Sbjct: 1073 CEHSCPSGLVFKYNVKACNSSCRS---LSERDRSCDVEDVPVDGCTCPDAMYQNNEGNCVLKSQCDCY--INDEVMQPGKLIHIDD-NKCVCRD-GILLCQIPIDLTLQNCSGGAEYVDCSDPKAQRRTNRTCSTRNIPVFDENLPCKRGCFCPEGMVRNS-KGICVFPNDCPCSFGGREYDEGSVTSVGCNECTCI--KGSWSCTQNECQ 1273          
BLAST of von Willebrand factor vs. UniProt/SwissProt
Match: sp|Q700K0|SSPO_RAT (SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.335e-10
Identity = 73/235 (31.06%), Postives = 101/235 (42.98%), Query Frame = 2
Query:  569 CPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYH---------SLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGR--EPCECNNCEKTCKHRKFT---ANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCC 1216
            CPP +V +TC  +C   CS        V+     + C  GC CP G +L +G CI    C C            L+ +  EL     L  NC++  CT +G V  F     +C+ C  G   +  E   CEKTC     T   +NC   + +PGC C  G + S     CV    C C ++   +    +W +AC  C C   K +VCT+  C    C +GE +V E    G CC
Sbjct: 4814 CPPGQVLSTCATLCPSFCSHLWPGTICVR-----EPCQLGCGCPGGQLLHSGTCIPPEACPCTRLSLPWGLTLPLEEQAQELPSGTVLTWNCTH--CTCQGGV--FTCSHTDCQECPPGEILQLGELRPCEKTCLEMNKTQAWSNCTEAQ-VPGCVCQLGHFRSHTG-LCVPEDHCECWHHGSPHLPGSEWQEACESCRCLHGK-SVCTQH-CPELSCAQGEVVVQEP---GSCC 5032          

HSP 2 Score: 54.6842 bits (130), Expect = 2.833e-6
Identity = 51/188 (27.13%), Postives = 72/188 (38.30%), Query Frame = 2
Query:  557 CTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSR--CPCMYNNRTYNVNEKWTDACRECEC 1111
            C+  CP  +V+  C     C  +    +  K+      CV GC CP G + D  G+C+  + C C   L G  Y       L +CS+ +C E+GL                         C  TC       +C       GC CP GT    +++ CVS   CPC +N + Y  N    + C  C C
Sbjct:  826 CSVPCPGGQVYQEC--APACGHYCGEPEDCKEL---GSCVAGCNCPPGLLWDLEGQCVPPSMCPC--QLGGHRYAFNTTTTLKDCSHCICQERGLWNCIAHHCPRQWALCPQELIYAPGACLLTCDSLGANHSC-LAGSTDGCVCPSGTVL--LDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVC 1003          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A1I8FZV2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 2.906e-68
Identity = 141/405 (34.81%), Postives = 213/405 (52.59%), Query Frame = 2
Query:  251 SSPISSAWGDIKTNIKPNFFFRFKDNVNVVSFQFG--NIENIATINVYLLKRS----NDQSPRVETFAVS-----FEKSVEILVNSE--DALIIEVFFIPRDKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCP--DKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENE 1417
            ++P S+ W    ++  P+   RF+D + +        NI +++ I+V    R      D S  +  + ++     +++    ++ ++  D L + +        +++  ++ ++GC   C    V T C C +TC           K  CP    C+ GC CP G V++ GKCI  TEC CY+++  +V ++GEKI    NC+ +LCT  GLV+  +T+   C  C  G E   C +C KTCKHRK +A C    C PGC CP+GTY  E   KCV  CPC      Y V +KWTD CR CEC ++KGAVC E GCH+  CP G  +  ++  DGKCC C P K +C   G ++ +DT+WSDGPC   ECRR     +++++++ ECP    C +    V K N+
Sbjct:  532 AAPTSTGWRSASSDSNPSLSVRFRDTIQLSHIDISPYNIRSVS-IDVSTDNRVFTPVKDASGAIRLWNMNDKFGEYQRIRLAMLKADLIDTLAVRINIQRIRSDLATGLNIRVYGCPPECKSPMVPTNCTCVKTCD----------KTECPTGSACLPGCTCPEGMVMNGGKCIARTECPCYYNVQSRVLKIGEKIPSAKNCTDVLCTASGLVREVNTERDGCHNCTGGMEWTPCKDCHKTCKHRKMSAAC-LATCKPGCACPKGTYMDEASGKCVPSCPCEMEGVKYPVGKKWTDKCRSCECTMEKGAVCKESGCHLSTCPSGYVMKNDDPADGKCCECVPIK-YCEYKGVKHPLDTVWSDGPCKSLECRRTSSGETRLVEKITECP--AKCANGMAPVVKGNK 921          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A267EXG4 (VWFC domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007621g1 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 3.146e-68
Identity = 128/316 (40.51%), Postives = 175/316 (55.38%), Query Frame = 2
Query:  479 DALIIEVFFIPRDKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCP--DKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENE 1417
            D L + +        +++  ++ ++GC   C    V T C C +TC           K  CP    C+ GC CP G V++ GKCI  TEC CY+S+  +V ++GEKI    NC+ +LCT  GLV+  +T+   C  C  G E   C +C KTCKHRK +A C    C PGC CP+GTY  E   KCV  CPC      Y V +KWTD CR CEC ++KGAVC E GCH+  CP G  +  ++  DGKCC C P K +C   G ++ +DT+WSDGPC   ECRR     +++++++ ECP    C +    V K N+
Sbjct:   22 DTLAVRINIQRIRSDLAAGLNIRVYGCPPECKSPMVPTNCTCVKTCD----------KTECPTGSACLPGCTCPEGMVMNGGKCIARTECPCYYSVQSRVLKIGEKIPSAKNCTDVLCTASGLVREVNTERDGCHNCTGGMEWTPCKDCHKTCKHRKMSAAC-LATCKPGCACPKGTYMDEASGKCVPSCPCEMEGVKYPVGKKWTDKCRSCECTMEKGAVCKESGCHLSTCPSGYVMKNDDPADGKCCECVPIK-YCEYKGVKHPLDTVWSDGPCKSLECRRTSSGETRLVEKITECP--AKCANGMAPVVKGNK 323          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A267GUZ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026350g1 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 3.683e-68
Identity = 141/405 (34.81%), Postives = 213/405 (52.59%), Query Frame = 2
Query:  251 SSPISSAWGDIKTNIKPNFFFRFKDNVNVVSFQFG--NIENIATINVYLLKRS----NDQSPRVETFAVS-----FEKSVEILVNSE--DALIIEVFFIPRDKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCP--DKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENE 1417
            ++P S+ W    ++  P+   RF+D + +        NI ++ +I+V    R      D S  +  + ++     +++    ++ ++  D L + +        +++  ++ ++GC   C    V T C C +TC           K  CP    C+ GC CP G V++ GKCI  TEC CY+++  +V ++GEKI    NC+ +LCT  GLV+  +T+   C  C  G E   C +C KTCKHRK +A C    C PGC CP+GTY  E   KCV  CPC      Y V +KWTD CR CEC ++KGAVC E GCH+  CP G  +  ++  DGKCC C P K +C   G ++ +DT+WSDGPC   ECRR     +++++++ ECP    C +    V K N+
Sbjct: 7375 AAPTSTGWRSASSDSNPSLSVRFRDTIQLSHIDISPYNIRSV-SIDVSTDNRVFTPVKDASGAIRLWNMNDKFGEYQRIRLAMLKADLIDTLAVRINIQRIRSDLATGLNIRVYGCPPECKSPMVPTNCTCVKTCD----------KTECPTGSACLPGCTCPEGMVMNGGKCIARTECPCYYNVQSRVLKIGEKIPSAKNCTDVLCTASGLVREVNTERDGCHNCTGGMEWTPCKDCHKTCKHRKMSAAC-LATCKPGCACPKGTYMDEASGKCVPSCPCEMEGVKYPVGKKWTDKCRSCECTMEKGAVCKESGCHLSTCPSGYVMKNDDPADGKCCECVPIK-YCEYKGVKHPLDTVWSDGPCKSLECRRTSSGETRLVEKITECP--AKCANGMAPVVKGNK 7764          
BLAST of von Willebrand factor vs. TrEMBL
Match: A0A267EXH0 (TIL domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031569g1 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.263e-34
Identity = 72/147 (48.98%), Postives = 91/147 (61.90%), Query Frame = 2
Query:  704 VLDNGKCIRVTECSCYHSLDGKVYELGEKIKLG-NCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTE 1141
            V++ GKCI  TEC CY+++  +V ++GEKI    NC+ +LCT  GLV+  +T+   C  C  G E   C +C KTCKHRK +A C    C PGC CP+GTY  E   KCV  CPC      Y V +KWTD CR CEC ++KGAVC E
Sbjct:    2 VMNGGKCIARTECPCYYNVQSRVLKIGEKIPSAKNCTDVLCTASGLVREVNTERDGCHNCTGGMEWTPCKDCHKTCKHRKMSAAC-LATCKPGCACPKGTYMDEASGKCVPSCPCEMEGVKYPVGKKWTDKCRSCECTMEKGAVCKE 147          
BLAST of von Willebrand factor vs. TrEMBL
Match: R7UR74 (F5/8 type C domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_217795 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.678e-24
Identity = 114/396 (28.79%), Postives = 177/396 (44.70%), Query Frame = 2
Query:  269 AWGDIKTNIKPNFFFRFKDNVNVVSF-----QFGNIENIATINVYLLKRSNDQSPRVETFAVSFEKSVEILVNSEDALIIEVFFIPRDKKISS------SADVTIF---GCT----ANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCPD----KCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGN--CSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSR--CPCMYNNRTYNVNEKW-TDACRECECFVDKGAVCTEKGCHIKEC--PEGESLVTEEELDGKCCYCKPDKPFCVV--NGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKEC 1363
             W     + KP    RFK  V V SF     + G +    +++    +   D+ P        F+ S   +  S   L +      R  K+++      +A + +F   GC       C  +RV TTC+C+ TC        +++   CP     +CV GC C  G V  NG+CI+  +C C +   G    +GE I L +  C +LLCT +GL+K  D      + C +GR    C  CE TC+ +     CN  EC PGC C E   +   ++KCV R  C C++++ T+   E      C  C C  +   VC E+    +E    E ++LV ++  D KCC+C   +P C    + K Y V+++W    C EY C    ++ +QI +   +C
Sbjct:  712 GWRANAEDDKPFMVVRFKSVVKVSSFKINPFRIGKLTMEFSVDGTTWELYKDEEPFSPVMDGIFDVS---MFTSTVKLTLSRIVQTRYVKLTAIVKTQVTAGLDMFEVDGCLDMDQPECAGNRVPTTCVCQYTCEDLALSDGEIE---CPATGSPECVEGCHCSEGMVSYNGQCIKKEQCPCLYM--GIFLSMGETIPLEDEKCQHLLCTAEGLIKQPDVNCALQEECTDGRVWQLC-ACESTCETQGHV--CNALECKPGCACGEDMVWD--DDKCVRREECSCVHDSITFENGENIDVGECTRCHC-TNGTKVCAERCALTEEMCKAEAKTLVNDDIDDFKCCHCATTEPMCFFAEDKKYYAVNSVWHTDACTEYVCTLVGDTQTQIDRTQIKC 1093          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 60.4622 bits (145), Expect = 5.562e-9
Identity = 51/190 (26.84%), Postives = 76/190 (40.00%), Query Frame = 2
Query:  557 CTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD--NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKE-CIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECEC 1111
            C+  CP    +  C+  C+  C SF         Q C D+C  GC CP GT        C++  EC C  S  G  Y  G+ I   +  ++      L        ++C    +G    +   C++TC+       C+  E C+PGC CP G      E      CPC++  + Y   +K +  C  C C
Sbjct:  671 CSVACPATMEYGLCVSSCQRRCLSFS------MPQSCGDECEEGCVCPQGTYYSTHTHSCVKRNECPC--SFLGTDYSPGDVIMTSSGVHMFFLSDKLCPPGQIY-EDCGNMVDGPSVSKGLACDRTCESYLLNLTCSTHEPCVPGCVCPTGLLKHGDECFEPVACPCLWKGKEYYPGDKVSSTCHLCVC 851          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:103041546])

HSP 1 Score: 60.077 bits (144), Expect = 7.280e-9
Identity = 57/211 (27.01%), Postives = 89/211 (42.18%), Query Frame = 2
Query:  557 CTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVL-DNGKCIRVTECSCYHSLDGKVYELGEKIKLGNC------SYLLCTEKGLVK------WFD----TKSKECKTCDNGREPCECNN-------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECEC 1111
            C   CP ++V+  C  +C +TC S  SL D      C   C  GC CP G  L D G+C+   +CSC++  DG++Y+  +     +         + C+   L        +FD    ++ +   +C    +   C +       C +TC++      C  + CI GC CP GT     E     +CPC +NN  Y+  +     C  C C
Sbjct:  640 CELTCPGNQVYEVCGSVCNQTCRSR-SLPDSA----CRSMCEEGCFCPRGLYLTDTGECVPPDQCSCHY--DGEIYQPNDMFADHHSICYCENGSMRCSSSELPASVLSDLFFDEPPLSRERRSVSCPAPLQQLRCESVRDVGIECARTCQNLDL--ECVSQGCISGCVCPPGTVRHRRECVPPDQCPCFHNNHAYSPGQSIKIDCNTCVC 841          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 59.6918 bits (143), Expect = 8.246e-9
Identity = 53/199 (26.63%), Postives = 79/199 (39.70%), Query Frame = 2
Query:  557 CTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD--NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSK---------ECKTCDNGREPCECNNCEKTCKHRKFTANCNFKE-CIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECEC 1111
            C+  CP    +  C+  C+  C SF         Q C D+C  GC CP GT        C++  EC C  S  G  Y  G+ I + +    +C +  +V       K         +C    +G    +   C++TC+       C+  E C+PGC CP G      E      CPC++  + Y   +K +  C  C C
Sbjct:  758 CSVACPATMEYGLCVSSCQRRCLSFS------MPQSCGDECEEGCVCPQGTYYSTHTHSCVKRNECPC--SFLGTDYSPGDVI-MTSSGVQICRDGQIVLQSTITDKLCPPGQIYEDCGNMVDGPSVSKGLACDRTCESYLLNLTCSTHEPCVPGCVCPTGLLKHGDECFEPVACPCLWKGKEYYPGDKVSSTCHLCVC 947          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: ENSAMXT00000019204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001825.1:10421:34530:-1 gene:ENSAMXG00000018303.2 transcript:ENSAMXT00000019204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.728e-8
Identity = 62/209 (29.67%), Postives = 88/209 (42.11%), Query Frame = 2
Query:  560 TANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVL-DNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLV--KWFDT-----KSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSR--CPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            T +CP  + F+  +  C+ TC S    +      + P   V GC CP G    +NG C+ + +CSCYH  +G+  + G+ I + N  + +CT   L    W  +       K    C           C KTC  +  T +C    C  GC CP G    +    CV +  CPC +N   Y    + TD C  C C   K   CTE+ C
Sbjct:  598 TEHCPATQTFSYKLQGCQRTCDSLSLERPACINTYLP---VDGCACPDGLYENENGVCVALDKCSCYH--NGERIKPGKSITIKN-EHCVCTNGKLHCHSWKPSVMDCPAPKVFFNCSEAGPEEHGLECAKTCAQK--TVDCFLTGCTSGCQCPSG-LLDDGRGHCVPQHNCPCKHNGHYYPPGSQITDQCNTCTCKQGKWK-CTEEKC 796          
BLAST of von Willebrand factor vs. Ensembl Cavefish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 58.151 bits (139), Expect = 2.667e-8
Identity = 50/150 (33.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  671 CVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVS--RCPCMYNNRTYNVNEKWTDACRECEC 1111
            CV GCQCP G + D+ G+C+ V  C C H   G V++ G  +++ NC+  +C  KG+    D    E + C  G       +C +TC     +      E I GC CPEGT    + ++CV+   CPC +N R +  N+  +  C  C C
Sbjct:  853 CVPGCQCPEGLMQDDQGQCVPVDMCPCVHG--GAVHQPGSSVQI-NCNTCVCG-KGVWNCSDDPCPEVRECP-GSLIFSPGSCLRTCSSLD-SPQALCTEPIYGCVCPEGTVL--LGDQCVTPDECPCHHNGRLFFTNDTISKDCNTCVC 994          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008652.1 (pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1 gene:ENSPMAG00000007836.1 transcript:ENSPMAT00000008652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 6.816e-9
Identity = 60/235 (25.53%), Postives = 98/235 (41.70%), Query Frame = 2
Query:  452 SVEILVNSEDALIIEVFFIPRDKKISSSADVTIFGCTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD--NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGR-------EPCECNNCEKTCKHRK--FTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECEC 1111
            +   L  +E     +  +I   + +  +    +  CT  CP D V+  C   C  TC+S  +++D      C ++C  GC CP G +LD     C+  ++C C +S     Y  G  +++G C    C   G   W    S E    D+G         PC+ ++C  TC +      ++C  + C  GC C  G  +     KCV  + CPC +  +++   +  T  C  C C
Sbjct:  129 TAGALTGAECKTFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASLSNIED------CHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYS--STNYAPGSILQMG-CKNCTCEYGGWSCW----SSEGCVDDSGLCPENMQWSPCK-SSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDG--SKCVQPANCPCYHGGQSFQTGQSITLDCNNCVC 347          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006699.1 (pep scaffold:Pmarinus_7.0:GL479302:347765:358687:1 gene:ENSPMAG00000006047.1 transcript:ENSPMAT00000006699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 4.221e-7
Identity = 34/99 (34.34%), Postives = 49/99 (49.49%), Query Frame = 2
Query:  548 IFGCTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGL 838
            + GC  +CPP  V++T    C  +C       D   +  C D    GC CP G + D   C+  +EC C  + +GK Y +G+    GNCS + CT +GL
Sbjct:   26 VTGCMHSCPPTSVYSTVASACPASCG------DGNAELGCGDPPREGCVCPAGRIWDKDSCVLPSECGC--TRNGKYYSVGDLYMDGNCS-VQCTCRGL 115          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010519.1 (pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 gene:ENSPMAG00000009527.1 transcript:ENSPMAT00000010519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 2.914e-6
Identity = 44/158 (27.85%), Postives = 67/158 (42.41%), Query Frame = 2
Query:  674 VTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNN--------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVS--RCPCMYNNRTYNVNEKWTDACRECECF 1114
            V GC C  G   D +G C+  ++C CY  + G +   G  + L + +  LCT  G +  F        TC+       C++        C++TC +    + C    C+ GC CP G         CVS  +C C +N R Y+  +  T  C +C C 
Sbjct:  651 VEGCVCGAGLYDDEHGVCVLKSDCPCYSEMSGDLIRAGVTVDLHD-TQCLCT-GGELHCFGLSPISGNTCEGLMTYHNCSDGSSEGSAACQRTCANPH--SICYSPGCVSGCVCPGGLIVDH-NGNCVSEEQCTCEHNGRHYDPGDTITQLCNKCTCM 803          
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008773.1 (pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1 gene:ENSPMAG00000007891.1 transcript:ENSPMAT00000008773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 4.894e-6
Identity = 58/211 (27.49%), Postives = 85/211 (40.28%), Query Frame = 2
Query:  560 TANCPPDRVFT--TCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGK-CIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNN---------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVS--RCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            T NCP  +V++     C  TC     L++   +       V GC CP GT    G  C+   EC CY+   G V  LG  ++ G   Y+     G +   + +    + C +      CN          C +TC  ++    C   EC  GC CP+G  YS+ +  C+    CPC +N +     E     C  C C V++   CT   C
Sbjct:  618 TENCPGSQVYSYNALPCVNTCRV---LQETGSQCFSSGVAVDGCTCPKGTYDSGGGFCMAPEECPCYYR--GNVLPLGNSVQQGK--YICECRAGTMLCMNPQGPTPQPCPHPMVYFNCNQSTANGNSFPCHQTCSLQE----CYNPECNSGCVCPKGLVYSD-DGTCIQPEACPCEHNGQKTAPGESIEVDCNTCTC-VNRKWECTNNTC 815          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: otog (otogelin [Source:NCBI gene;Acc:101158818])

HSP 1 Score: 64.6994 bits (156), Expect = 2.625e-10
Identity = 52/203 (25.62%), Postives = 89/203 (43.84%), Query Frame = 2
Query:  548 IFGCTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDN--GKCIRVTECSCYHSLDGKVYELGE---KIKLGNCSYLLCTEKGLVKWFDTK-------SKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKE-CIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECEC 1111
            I  C  +CP    +++C+  C+  CSS  +L      Q C ++C  GC CP G+  ++    C+  ++C C  SL G  YE G+   ++      +L C+  G   +   +        + C   D+   P     CE+TC+       C+  + C+ GC CP G      E    + CPC++  + Y   ++ +  C +C C
Sbjct:  765 IPDCAVSCPATMEYSSCVSSCQRRCSSLAAL------QRCGEECEEGCACPQGSFYNHRTHTCVHRSQCPC--SLFGADYEPGDLPAQLSWSLTGFLKCS--GFSFFLPERLCPAGQLYQNCSDGDDAFLPGRGVACERTCESHLLNIPCSSHDSCVSGCVCPHGLLKHGDECFEPAACPCLWKGKEYFPGDRVSSPCYQCAC 957          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:101162365])

HSP 1 Score: 55.8398 bits (133), Expect = 1.280e-7
Identity = 59/225 (26.22%), Postives = 93/225 (41.33%), Query Frame = 2
Query:  557 CTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLD-NGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVK-------------WFD-----TKSKECKTCDNGREPCECNN------CEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGC 1150
            C   C   +V+  C  +C+ TC S    +   + +     C  GC CP+G  L  +G+C+    C C H  DG++Y+  + +   + S   C E G ++             ++D     T+ +    C       EC +      C +TC++      C    CIPGC CP  T     +     +CPC +NNR Y   +  T  C  C C  ++   CT+K C
Sbjct:  640 CELECSGGQVYEACGTVCDRTCLSLSGAEAGCEGEKV---CEEGCFCPVGKYLSPSGQCVTADLCPCLH--DGQLYQPND-VYADHTSICYC-ENGSMRCSSSEVPSLLSDLFYDEDLGSTRERRSAHCPPPLVRTECGSGKKGLECARTCQNLDLP--CVSLSCIPGCLCPPDTVRHRRDCIAPEQCPCYHNNRPYAAGQTITTDCNTCVC-ENRKWRCTQKLC 854          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: scospondin (SCO-spondin [Source:NCBI gene;Acc:101172449])

HSP 1 Score: 55.8398 bits (133), Expect = 1.422e-7
Identity = 49/160 (30.63%), Postives = 73/160 (45.62%), Query Frame = 2
Query:  671 CVTGCQCPLGTVLDN-GKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDN--GREPCECNNCEKTC--------KHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCV--SRCPCMYNNRTYNVNEKWTDACRECEC 1111
            CV GCQCP G V D+ G+C+ V+ C C    D K+Y  G  ++  NC+  +C        F+   + CK+     G       +C  TC        +        + +E + GC CP+GT++    ++CV    CPC +N + Y  NE  T  C  C C
Sbjct:  690 CVPGCQCPTGLVQDHLGQCVPVSLCPCVQ--DDKIYSPGTILQ-NNCNTCVCKHGA----FNCTQEHCKSVQQCPGSLVYSPRSCMLTCSSLDHQGQQQSSSVTKPSCREPLSGCVCPQGTFFH--GDRCVLPDECPCHHNGQVYYTNETITKDCNTCVC 840          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 53.1434 bits (126), Expect = 8.776e-7
Identity = 39/134 (29.10%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  452 SVEILVNSEDALIIEVFFIPRDKKISSSADVTIFGCTANCPPDRVFTTCI--CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGNC-SYLLCTEKGLVK 844
            S EIL NS  A ++      ++  +      +   C A+CPP+  +  C   C  TC+SF      +++  C + C  GC+C  G V D  +C+ +  C C H  DG+   + + +   +C S  +C   GLVK
Sbjct: 2236 SKEILCNSVQAYVLAC----QNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASF------IQQLTCSESCFEGCECDAGFVFDGAQCVPLENCGCVH--DGRYLTVNQVVVDKDCQSRCVCEASGLVK 2357          
BLAST of von Willebrand factor vs. Ensembl Medaka
Match: ENSORLT00000035219.1 (pep primary_assembly:ASM223467v1:19:5082962:5086717:1 gene:ENSORLG00000005547.2 transcript:ENSORLT00000035219.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.576e-6
Identity = 42/156 (26.92%), Postives = 64/156 (41.03%), Query Frame = 2
Query:  455 VEILVNSEDA------LIIEVFFIPRDKKISSSADVTIFGCTANCPPDRVFTTC--ICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREP 898
            V+IL  SED       ++ +   + + + +S        GC A CP +  +  C   C  TC S            C   C  GCQC  G VL+  +C+  T C CYH  +G+ ++ G++   G     LC+  G+   F        TC    +P
Sbjct:  194 VDILRRSEDPESTLCEVLRDYALMCQQQGVSLGEWRNTTGCAATCPSNSHYELCGTSCPSTCPSLS------FPFSCDSPCQDGCQCNDGFVLNGNQCVPPTSCGCYH--EGRYWQSGQQFWDGEECQSLCSCNGVTGVFGCHPNPHGTCSASGDP 341          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000025545.1 (SMESG000025545.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.391e-71
Identity = 189/579 (32.64%), Postives = 272/579 (46.98%), Query Frame = 2
Query:   89 ESFETTPTIFTEHSISFNFSRVTP-----------SSTPRPGLCLDGLVELSKFDNGY-IVSIEYWSSPISSAWGDIKTNIKPNFFFRFKDNVNVVSFQFGNIENIATINVYLLKRSNDQSPRVETFAVSFEK---SVEILVNSEDALIIEVFFIPR-DKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGN-CSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENEXXXXXXXXXXXXXXXXXXXXXXXXXXSKKCEKKASNKNFTEYSKNCTPINPVTLYECEGTCESSQFINPITGAVEE-NNCNCCQPIIVEQNISINCEGKLLNKRI--QVIHHCSCSSCG 1765
            E F +   +    SI  N + +TP           ++T +P  C D  VEL+     + I+         +++W     +  P    +FK+ + + + +   + N+  +N++     + ++ R+      ++K   SV I       L  ++ F+ R +     S ++ ++GC   C P  V   C C++TC     L +      CP KC+ GCQCP G V +NGKCI+V+EC CY   +GK Y  G+KI+  + C  L+CT+  L +   T S    TC     PC C NC +TC      ANC    C  GCCCPEG  +SEI +KCV  CPC Y N+TY + + WT+ C +C C   KGA C EKGCH  +CP    +V +   D  CC C    P C  NGK Y V  IW+DGPC  ++C    +  S II    ECP I  C     L+    E       V    T       TT+     KC+ K SN    E  + C   NPV +  CEG C+S   I+ + G + +  +C CC P I    +   C G  L+K I  QVI  C+C+ C 
Sbjct: 6819 EVFRSGTLVTCAQSIDRNCASITPPGTTTTVSYPVTTTKKPSEC-DPEVELNTEKYVFEIIKSSNLGGNETNSWMTSINDYVPQLEMKFKNTMTLTNIKLFQMNNVLEMNIF--TSDDGKTYRMIKTFDGYQKNNASVSIKFEKTSILSFKLLFMKRFETSRQISLNLVVYGCGKVCLPPFVHVNCSCQQTC---DLLAENNGISKCPSKCIPGCQCPEGMVNNNGKCIKVSECPCY--FNGKTYAFGDKIQTNDPCKVLVCTKDSLQEL--TVSNCPSTCKETMIPCTCENCHRTCNKNNIEANCQLMGCKSGCCCPEGKVFSEILDKCVKTCPCSYLNKTYEIGQNWTNECLDCRCDEIKGAFCVEKGCHFDQCPPRHKMVNDNPNDNVCCKCVKVDPVCKYNGKEYSVGEIWNDGPCRNFKCTMK-DGESMIISSSTECPSI-KCLLTHTLMRVPGE--CCEKCVPNNVTTTTVRITTTSPQPPSKCQ-KVSNLTIVE-QETCVSRNPVDVGSCEGMCKSRTEISYVNGKLNQIRDCKCCFPTISTVEVEYKCPGN-LSKSISTQVISACNCAQCS 7380          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000025545.1 (SMESG000025545.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.794e-71
Identity = 189/579 (32.64%), Postives = 272/579 (46.98%), Query Frame = 2
Query:   89 ESFETTPTIFTEHSISFNFSRVTP-----------SSTPRPGLCLDGLVELSKFDNGY-IVSIEYWSSPISSAWGDIKTNIKPNFFFRFKDNVNVVSFQFGNIENIATINVYLLKRSNDQSPRVETFAVSFEK---SVEILVNSEDALIIEVFFIPR-DKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGN-CSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENEXXXXXXXXXXXXXXXXXXXXXXXXXXSKKCEKKASNKNFTEYSKNCTPINPVTLYECEGTCESSQFINPITGAVEE-NNCNCCQPIIVEQNISINCEGKLLNKRI--QVIHHCSCSSCG 1765
            E F +   +    SI  N + +TP           ++T +P  C D  VEL+     + I+         +++W     +  P    +FK+ + + + +   + N+  +N++     + ++ R+      ++K   SV I       L  ++ F+ R +     S ++ ++GC   C P  V   C C++TC     L +      CP KC+ GCQCP G V +NGKCI+V+EC CY   +GK Y  G+KI+  + C  L+CT+  L +   T S    TC     PC C NC +TC      ANC    C  GCCCPEG  +SEI +KCV  CPC Y N+TY + + WT+ C +C C   KGA C EKGCH  +CP    +V +   D  CC C    P C  NGK Y V  IW+DGPC  ++C    +  S II    ECP I  C     L+    E       V    T       TT+     KC+ K SN    E  + C   NPV +  CEG C+S   I+ + G + +  +C CC P I    +   C G  L+K I  QVI  C+C+ C 
Sbjct: 6798 EVFRSGTLVTCAQSIDRNCASITPPGTTTTVSYPVTTTKKPSEC-DPEVELNTEKYVFEIIKSSNLGGNETNSWMTSINDYVPQLEMKFKNTMTLTNIKLFQMNNVLEMNIF--TSDDGKTYRMIKTFDGYQKNNASVSIKFEKTSILSFKLLFMKRFETSRQISLNLVVYGCGKVCLPPFVHVNCSCQQTC---DLLAENNGISKCPSKCIPGCQCPEGMVNNNGKCIKVSECPCY--FNGKTYAFGDKIQTNDPCKVLVCTKDSLQEL--TVSNCPSTCKETMIPCTCENCHRTCNKNNIEANCQLMGCKSGCCCPEGKVFSEILDKCVKTCPCSYLNKTYEIGQNWTNECLDCRCDEIKGAFCVEKGCHFDQCPPRHKMVNDNPNDNVCCKCVKVDPVCKYNGKEYSVGEIWNDGPCRNFKCTMK-DGESMIISSSTECPSI-KCLLTHTLMRVPGE--CCEKCVPNNVTTTTVRITTTSPQPPSKCQ-KVSNLTIVE-QETCVSRNPVDVGSCEGMCKSRTEISYVNGKLNQIRDCKCCFPTISTVEVEYKCPGN-LSKSISTQVISACNCAQCS 7359          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000025545.1 (SMESG000025545.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.794e-71
Identity = 189/579 (32.64%), Postives = 272/579 (46.98%), Query Frame = 2
Query:   89 ESFETTPTIFTEHSISFNFSRVTP-----------SSTPRPGLCLDGLVELSKFDNGY-IVSIEYWSSPISSAWGDIKTNIKPNFFFRFKDNVNVVSFQFGNIENIATINVYLLKRSNDQSPRVETFAVSFEK---SVEILVNSEDALIIEVFFIPR-DKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGN-CSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENEXXXXXXXXXXXXXXXXXXXXXXXXXXSKKCEKKASNKNFTEYSKNCTPINPVTLYECEGTCESSQFINPITGAVEE-NNCNCCQPIIVEQNISINCEGKLLNKRI--QVIHHCSCSSCG 1765
            E F +   +    SI  N + +TP           ++T +P  C D  VEL+     + I+         +++W     +  P    +FK+ + + + +   + N+  +N++     + ++ R+      ++K   SV I       L  ++ F+ R +     S ++ ++GC   C P  V   C C++TC     L +      CP KC+ GCQCP G V +NGKCI+V+EC CY   +GK Y  G+KI+  + C  L+CT+  L +   T S    TC     PC C NC +TC      ANC    C  GCCCPEG  +SEI +KCV  CPC Y N+TY + + WT+ C +C C   KGA C EKGCH  +CP    +V +   D  CC C    P C  NGK Y V  IW+DGPC  ++C    +  S II    ECP I  C     L+    E       V    T       TT+     KC+ K SN    E  + C   NPV +  CEG C+S   I+ + G + +  +C CC P I    +   C G  L+K I  QVI  C+C+ C 
Sbjct: 6798 EVFRSGTLVTCAQSIDRNCASITPPGTTTTVSYPVTTTKKPSEC-DPEVELNTEKYVFEIIKSSNLGGNETNSWMTSINDYVPQLEMKFKNTMTLTNIKLFQMNNVLEMNIF--TSDDGKTYRMIKTFDGYQKNNASVSIKFEKTSILSFKLLFMKRFETSRQISLNLVVYGCGKVCLPPFVHVNCSCQQTC---DLLAENNGISKCPSKCIPGCQCPEGMVNNNGKCIKVSECPCY--FNGKTYAFGDKIQTNDPCKVLVCTKDSLQEL--TVSNCPSTCKETMIPCTCENCHRTCNKNNIEANCQLMGCKSGCCCPEGKVFSEILDKCVKTCPCSYLNKTYEIGQNWTNECLDCRCDEIKGAFCVEKGCHFDQCPPRHKMVNDNPNDNVCCKCVKVDPVCKYNGKEYSVGEIWNDGPCRNFKCTMK-DGESMIISSSTECPSI-KCLLTHTLMRVPGE--CCEKCVPNNVTTTTVRITTTSPQPPSKCQ-KVSNLTIVE-QETCVSRNPVDVGSCEGMCKSRTEISYVNGKLNQIRDCKCCFPTISTVEVEYKCPGN-LSKSISTQVISACNCAQCS 7359          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000025545.1 (SMESG000025545.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.811e-71
Identity = 189/579 (32.64%), Postives = 272/579 (46.98%), Query Frame = 2
Query:   89 ESFETTPTIFTEHSISFNFSRVTP-----------SSTPRPGLCLDGLVELSKFDNGY-IVSIEYWSSPISSAWGDIKTNIKPNFFFRFKDNVNVVSFQFGNIENIATINVYLLKRSNDQSPRVETFAVSFEK---SVEILVNSEDALIIEVFFIPR-DKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGN-CSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENEXXXXXXXXXXXXXXXXXXXXXXXXXXSKKCEKKASNKNFTEYSKNCTPINPVTLYECEGTCESSQFINPITGAVEE-NNCNCCQPIIVEQNISINCEGKLLNKRI--QVIHHCSCSSCG 1765
            E F +   +    SI  N + +TP           ++T +P  C D  VEL+     + I+         +++W     +  P    +FK+ + + + +   + N+  +N++     + ++ R+      ++K   SV I       L  ++ F+ R +     S ++ ++GC   C P  V   C C++TC     L +      CP KC+ GCQCP G V +NGKCI+V+EC CY   +GK Y  G+KI+  + C  L+CT+  L +   T S    TC     PC C NC +TC      ANC    C  GCCCPEG  +SEI +KCV  CPC Y N+TY + + WT+ C +C C   KGA C EKGCH  +CP    +V +   D  CC C    P C  NGK Y V  IW+DGPC  ++C    +  S II    ECP I  C     L+    E       V    T       TT+     KC+ K SN    E  + C   NPV +  CEG C+S   I+ + G + +  +C CC P I    +   C G  L+K I  QVI  C+C+ C 
Sbjct: 6800 EVFRSGTLVTCAQSIDRNCASITPPGTTTTVSYPVTTTKKPSEC-DPEVELNTEKYVFEIIKSSNLGGNETNSWMTSINDYVPQLEMKFKNTMTLTNIKLFQMNNVLEMNIF--TSDDGKTYRMIKTFDGYQKNNASVSIKFEKTSILSFKLLFMKRFETSRQISLNLVVYGCGKVCLPPFVHVNCSCQQTC---DLLAENNGISKCPSKCIPGCQCPEGMVNNNGKCIKVSECPCY--FNGKTYAFGDKIQTNDPCKVLVCTKDSLQEL--TVSNCPSTCKETMIPCTCENCHRTCNKNNIEANCQLMGCKSGCCCPEGKVFSEILDKCVKTCPCSYLNKTYEIGQNWTNECLDCRCDEIKGAFCVEKGCHFDQCPPRHKMVNDNPNDNVCCKCVKVDPVCKYNGKEYSVGEIWNDGPCRNFKCTMK-DGESMIISSSTECPSI-KCLLTHTLMRVPGE--CCEKCVPNNVTTTTVRITTTSPQPPSKCQ-KVSNLTIVE-QETCVSRNPVDVGSCEGMCKSRTEISYVNGKLNQIRDCKCCFPTISTVEVEYKCPGN-LSKSISTQVISACNCAQCS 7361          
BLAST of von Willebrand factor vs. Planmine SMEST
Match: SMESG000025545.1 (SMESG000025545.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.811e-71
Identity = 189/579 (32.64%), Postives = 272/579 (46.98%), Query Frame = 2
Query:   89 ESFETTPTIFTEHSISFNFSRVTP-----------SSTPRPGLCLDGLVELSKFDNGY-IVSIEYWSSPISSAWGDIKTNIKPNFFFRFKDNVNVVSFQFGNIENIATINVYLLKRSNDQSPRVETFAVSFEK---SVEILVNSEDALIIEVFFIPR-DKKISSSADVTIFGCTANCPPDRVFTTCICEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCYHSLDGKVYELGEKIKLGN-CSYLLCTEKGLVKWFDTKSKECKTCDNGREPCECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMYNNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEELDGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKRVKECPKITDCQSHQKLVSKENEXXXXXXXXXXXXXXXXXXXXXXXXXXSKKCEKKASNKNFTEYSKNCTPINPVTLYECEGTCESSQFINPITGAVEE-NNCNCCQPIIVEQNISINCEGKLLNKRI--QVIHHCSCSSCG 1765
            E F +   +    SI  N + +TP           ++T +P  C D  VEL+     + I+         +++W     +  P    +FK+ + + + +   + N+  +N++     + ++ R+      ++K   SV I       L  ++ F+ R +     S ++ ++GC   C P  V   C C++TC     L +      CP KC+ GCQCP G V +NGKCI+V+EC CY   +GK Y  G+KI+  + C  L+CT+  L +   T S    TC     PC C NC +TC      ANC    C  GCCCPEG  +SEI +KCV  CPC Y N+TY + + WT+ C +C C   KGA C EKGCH  +CP    +V +   D  CC C    P C  NGK Y V  IW+DGPC  ++C    +  S II    ECP I  C     L+    E       V    T       TT+     KC+ K SN    E  + C   NPV +  CEG C+S   I+ + G + +  +C CC P I    +   C G  L+K I  QVI  C+C+ C 
Sbjct: 6800 EVFRSGTLVTCAQSIDRNCASITPPGTTTTVSYPVTTTKKPSEC-DPEVELNTEKYVFEIIKSSNLGGNETNSWMTSINDYVPQLEMKFKNTMTLTNIKLFQMNNVLEMNIF--TSDDGKTYRMIKTFDGYQKNNASVSIKFEKTSILSFKLLFMKRFETSRQISLNLVVYGCGKVCLPPFVHVNCSCQQTC---DLLAENNGISKCPSKCIPGCQCPEGMVNNNGKCIKVSECPCY--FNGKTYAFGDKIQTNDPCKVLVCTKDSLQEL--TVSNCPSTCKETMIPCTCENCHRTCNKNNIEANCQLMGCKSGCCCPEGKVFSEILDKCVKTCPCSYLNKTYEIGQNWTNECLDCRCDEIKGAFCVEKGCHFDQCPPRHKMVNDNPNDNVCCKCVKVDPVCKYNGKEYSVGEIWNDGPCRNFKCTMK-DGESMIISSSTECPSI-KCLLTHTLMRVPGE--CCEKCVPNNVTTTTVRITTTSPQPPSKCQ-KVSNLTIVE-QETCVSRNPVDVGSCEGMCKSRTEISYVNGKLNQIRDCKCCFPTISTVEVEYKCPGN-LSKSISTQVISACNCAQCS 7361          
The following BLAST results are available for this feature:
BLAST of von Willebrand factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MUC66.802e-1428.69mucin 6, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC63.961e-1328.69mucin 6, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC69.990e-1228.38mucin 6, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC69.990e-1228.38mucin 6, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC69.990e-1228.38mucin 6, oligomeric mucus/gel-forming [Source:HGNC... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hml2.992e-828.21gene:FBgn0029167 transcript:FBtr0075753[more]
Hml3.149e-828.21gene:FBgn0029167 transcript:FBtr0333020[more]
back to top
BLAST of von Willebrand factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vwf1.025e-928.37von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
vwf3.388e-928.64von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
muc5.34.065e-930.39mucin 5.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1562][more]
otog3.331e-828.64otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
CR848794.27.518e-828.90pep chromosome:GRCz11:CHR_ALT_CTG5_1_42:41827381:4... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000018772.14.068e-930.19mucin-2-like [Source:NCBI gene;Acc:100495470][more]
ENSXETT00000033057.14.182e-930.19mucin-2-like [Source:NCBI gene;Acc:100495470][more]
ENSXETT00000018702.16.083e-930.14mucin-2-like [Source:NCBI gene;Acc:100495470][more]
ENSXETT00000033131.12.035e-831.09mucin-2-like [Source:NCBI gene;Acc:100495470][more]
pigo4.866e-830.05phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Muc5ac5.891e-1029.95mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac7.988e-1030.81mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac7.988e-1030.81mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Sspo1.226e-928.51SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo1.258e-928.51SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
back to top
BLAST of von Willebrand factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98167|SSPO_BOVIN1.118e-1228.98SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=... [more]
sp|Q6W4X9|MUC6_HUMAN4.797e-1128.38Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3[more]
sp|Q28833|VWF_PIG1.254e-1028.07von Willebrand factor (Fragment) OS=Sus scrofa OX=... [more]
sp|Q7Z5P9|MUC19_HUMAN3.481e-1026.54Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=... [more]
sp|Q700K0|SSPO_RAT9.335e-1031.06SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo ... [more]
back to top
BLAST of von Willebrand factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FZV22.906e-6834.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EXG43.146e-6840.51VWFC domain-containing protein OS=Macrostomum lign... [more]
A0A267GUZ73.683e-6834.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EXH01.263e-3448.98TIL domain-containing protein OS=Macrostomum ligna... [more]
R7UR747.678e-2428.79F5/8 type C domain-containing protein (Fragment) O... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otog5.562e-926.84otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
vwf7.280e-927.01von Willebrand factor [Source:NCBI gene;Acc:103041... [more]
otog8.246e-926.63otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
ENSAMXT00000019204.21.728e-829.67pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
scospondin2.667e-833.33subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008652.16.816e-925.53pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1... [more]
ENSPMAT00000006699.14.221e-734.34pep scaffold:Pmarinus_7.0:GL479302:347765:358687:1... [more]
ENSPMAT00000010519.12.914e-627.85pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 g... [more]
ENSPMAT00000008773.14.894e-627.49pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1... [more]
back to top
BLAST of von Willebrand factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otog2.625e-1025.62otogelin [Source:NCBI gene;Acc:101158818][more]
vwf1.280e-726.22von Willebrand factor [Source:NCBI gene;Acc:101162... [more]
scospondin1.422e-730.63SCO-spondin [Source:NCBI gene;Acc:101172449][more]
FCGBP8.776e-729.10Fc fragment of IgG binding protein [Source:NCBI ge... [more]
ENSORLT00000035219.11.576e-626.92pep primary_assembly:ASM223467v1:19:5082962:508671... [more]
back to top
BLAST of von Willebrand factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025545.11.391e-7132.64SMESG000025545.1[more]
SMESG000025545.11.794e-7132.64SMESG000025545.1[more]
SMESG000025545.11.794e-7132.64SMESG000025545.1[more]
SMESG000025545.11.811e-7132.64SMESG000025545.1[more]
SMESG000025545.11.811e-7132.64SMESG000025545.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009453 ID=SMED30009453|Name=von Willebrand factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1822bp
GAGTCAAGTTGTATCTGAAAAAGTTTCAACTACGTCATCTAGTGTTGTTT
CTGTAAGCTCTAGCATTACTCCTATAGTTATATTTCCTGAATCCTTTGAA
ACTACTCCCACTATTTTTACCGAACATAGCATTTCTTTTAACTTTTCCCG
TGTTACGCCTTCTTCAACGCCTCGTCCAGGTTTGTGTTTGGATGGTTTGG
TTGAACTCTCTAAGTTTGACAATGGCTATATTGTTAGTATTGAATATTGG
TCATCACCAATATCTAGTGCGTGGGGTGATATTAAAACGAATATTAAACC
AAACTTTTTCTTCCGTTTTAAAGACAATGTAAATGTCGTTTCATTCCAAT
TTGGGAATATCGAGAACATTGCCACCATTAATGTTTATCTCCTTAAACGA
TCCAATGATCAATCTCCTCGTGTTGAAACGTTTGCTGTTTCTTTTGAAAA
ATCGGTTGAAATTTTAGTAAACTCGGAAGATGCTTTAATAATTGAAGTGT
TTTTTATTCCTCGTGACAAAAAGATTTCTTCTTCTGCAGATGTTACTATA
TTTGGTTGTACCGCTAATTGCCCTCCTGATCGTGTGTTTACAACTTGCAT
TTGTGAAGAAACCTGCTCATCTTTTGGTTCACTTAAAGATAAGGTCAAGA
AGCAGCATTGTCCAGACAAATGTGTCACTGGTTGTCAATGTCCATTAGGA
ACCGTTCTAGACAATGGGAAATGTATTAGGGTTACTGAATGTTCTTGCTA
TCATTCTTTGGATGGAAAAGTTTATGAACTGGGAGAGAAAATAAAATTGG
GAAATTGTTCCTATTTGCTGTGTACGGAAAAAGGCTTAGTGAAATGGTTC
GATACAAAATCTAAAGAGTGCAAAACTTGTGACAACGGAAGAGAGCCGTG
TGAGTGCAATAACTGTGAGAAAACGTGCAAACACAGGAAATTTACCGCTA
ATTGCAATTTCAAGGAATGTATTCCTGGCTGTTGCTGCCCTGAAGGCACT
TATTATTCGGAAATCGAAGAGAAATGTGTCAGCCGTTGTCCATGTATGTA
TAATAACAGAACATATAATGTCAACGAAAAATGGACCGATGCATGTCGAG
AATGTGAATGCTTCGTAGACAAAGGTGCTGTTTGTACTGAGAAAGGGTGC
CATATCAAAGAATGTCCAGAAGGTGAATCATTAGTCACGGAAGAAGAACT
TGATGGTAAATGTTGTTATTGTAAACCAGATAAACCGTTTTGTGTTGTGA
ACGGAAAGCGATATGTTGTCGATACAATTTGGTCTGACGGTCCTTGTGTG
GAATATGAGTGTCGCAGAAATATTGAGTCTGGATCACAAATTATCAAGCG
AGTGAAAGAGTGCCCTAAAATCACCGACTGTCAGTCTCATCAGAAGTTGG
TGAGCAAAGAAAATGAATGTTGCCCAACCTGTGTTAATGTCACCACTCCA
ACTACGCAAGCACAGACAACTCCTATCACGACAACTCTATTGATTTCGAA
AAAATGCGAAAAGAAAGCGTCAAATAAGAACTTTACTGAATACTCTAAAA
ATTGCACGCCAATCAACCCAGTCACCTTGTATGAATGCGAAGGAACTTGT
GAAAGCAGCCAGTTTATCAACCCAATCACTGGAGCCGTCGAGGAGAACAA
TTGCAACTGTTGTCAGCCGATAATTGTCGAACAGAATATTTCAATAAATT
GCGAAGGAAAATTGTTGAATAAAAGGATACAGGTCATTCACCATTGTTCT
TGCTCTTCATGTGGGAAATAAATTATTCATAACGAAACCTTATTTGATTC
AATAAATATATCTATCAATGTC
back to top

protein sequence of SMED30009453-orf-1

>SMED30009453-orf-1 ID=SMED30009453-orf-1|Name=SMED30009453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=590bp
SQVVSEKVSTTSSSVVSVSSSITPIVIFPESFETTPTIFTEHSISFNFSR
VTPSSTPRPGLCLDGLVELSKFDNGYIVSIEYWSSPISSAWGDIKTNIKP
NFFFRFKDNVNVVSFQFGNIENIATINVYLLKRSNDQSPRVETFAVSFEK
SVEILVNSEDALIIEVFFIPRDKKISSSADVTIFGCTANCPPDRVFTTCI
CEETCSSFGSLKDKVKKQHCPDKCVTGCQCPLGTVLDNGKCIRVTECSCY
HSLDGKVYELGEKIKLGNCSYLLCTEKGLVKWFDTKSKECKTCDNGREPC
ECNNCEKTCKHRKFTANCNFKECIPGCCCPEGTYYSEIEEKCVSRCPCMY
NNRTYNVNEKWTDACRECECFVDKGAVCTEKGCHIKECPEGESLVTEEEL
DGKCCYCKPDKPFCVVNGKRYVVDTIWSDGPCVEYECRRNIESGSQIIKR
VKECPKITDCQSHQKLVSKENECCPTCVNVTTPTTQAQTTPITTTLLISK
KCEKKASNKNFTEYSKNCTPINPVTLYECEGTCESSQFINPITGAVEENN
CNCCQPIIVEQNISINCEGKLLNKRIQVIHHCSCSSCGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0002020protease binding
GO:0005178integrin binding
GO:0005518collagen binding
GO:0019865immunoglobulin binding
GO:0042802identical protein binding
GO:0047485protein N-terminus binding
GO:0051087chaperone binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0033093Weibel-Palade body
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
Vocabulary: biological process
TermDefinition
GO:0007599hemostasis
GO:0030168platelet activation
GO:0031589cell-substrate adhesion
GO:0007155cell adhesion
GO:0007596blood coagulation
Vocabulary: INTERPRO
TermDefinition
IPR036084Ser_inhib-like_sf
IPR001007VWF_dom
IPR006207Cys_knot_C
IPR002919TIL_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006207Cystine knot, C-terminalSMARTSM00041CT_3coord: 506..588
e-value: 0.0012
score: 20.9
IPR006207Cystine knot, C-terminalPROSITEPS01225CTCK_2coord: 502..588
score: 8.745
IPR001007VWFC domainSMARTSM00214vwccoord: 348..407
e-value: 3.2E-5
score: 33.4
coord: 414..477
e-value: 0.065
score: 22.4
IPR001007VWFC domainPROSITEPS50184VWFC_2coord: 348..415
score: 8.515
IPR002919Trypsin Inhibitor-like, cysteine rich domainPFAMPF01826TILcoord: 190..247
e-value: 4.0E-8
score: 33.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 179..286
e-value: 6.1E-12
score: 47.8
coord: 287..384
e-value: 2.0E-8
score: 36.5
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 186..370
NoneNo IPR availableSUPERFAMILYSSF57603FnI-like domaincoord: 404..480
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 186..249