TIR domain-containing protein

Overview
NameTIR domain-containing protein
Smed IDSMED30009450
Length (bp)2350
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIR domain-containing protein (SMED30009450) t-SNE clustered cells

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30009450) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIR domain-containing protein (SMED30009450) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30009450) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009450

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009450SMESG000008937.1 dd_Smed_v4_9242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009450SMESG000008937.1 dd_Smed_v4_9242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009450SMESG000008937.1 dd_Smed_v4_9242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009450SMESG000008937.1 dd_Smed_v4_9242_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A210PZ21 (Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23907 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.366e-47
Identity = 174/698 (24.93%), Postives = 332/698 (47.56%), Query Frame = 1
Query:  103 TIDEINLKICSEAEDIINKVKSL--QKFITDLQPQE-SSEFQQIVKAINSKYFSLNKFNVKLEDVKRLRLSNANVLIKLDIFNIYYTILVQILHNVFGKNYSEEIDNKFHSAIKNLIDIFFNYTDASSDFGKEFCKNDKLLHLYYKIISEFKENCLNKSLSKN--ITDLLRICIST----LYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNK--ILIQKEFR--NKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFE-------------------DAXXXXXXXXXXXXAGNVQKKIDEIDHIDPVH--VKNQSKNNQD-ITKWANERCKNWFDE--IGIKRIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDL 2085
            T +EI  KI    ED ++  + L  Q  + D +  + S+ F++I       +F +  F++ ++D    +     +++  ++   +  ++V IL + + +     +D +    + N   +  N+TD   +       + + L      ++E  +  +N  L+ +    D +R+ IS+     +N  + D N N   ++ + F+DL+   +   + K + +A+  +A I DE +S++ ++D+  + ++   L +++  +  R  G S +EL++ + ++++ND NK+ LVE GILP L    E +D   Q  A+G +W+L+FD++N+  +++  E +  +  + LK   DK+ +                        K+CN      G L + +                  EN  +    S NYK+I +  T    +   V +++++    EV ++ HIM+SY W+N  I+ KI D L   GFK+W+D      E + +++MA+A++N+  V++  SQ YK+SDNCRAEA+YA  KKK VIP+ ++  Y PDGWLG       + DF G+Y+FE                   D +++         A   ++ + E  +  P H  V + +    + + KW ++    W  +  +  +++   K  TG E+ FL  +     + FY++  + LKIT+L
Sbjct:  144 TEEEIKEKINKTFEDALHTWEPLSDQSRLVDAETGKCSAAFRRISNNTFLYHFRMKAFSLSIQD--EFKSDYYRLMVTENVVPKFCDMVVYILKHGY-EAEDGTMDAEMFKPLSNTFGLLTNFTDNKIERADIVADHPEFLMC----LAENFKKWMNPYLAGDQIREDQIRVAISSPLSIFHNIAMQDRNINR--MRSLGFVDLLTPFVSSPKEKTRLSAVATLADIVDEKQSEIIRTDVGVMKFIKNSLARAMKEKSRRIFGWSPQELARTVRRIARNDANKRALVEQGILPPLVKLAESEDMEEQREAVGAMWTLSFDKENQKDMILDTECKPVDTFIRLKNSPDKEVR------------------------KTCN------GALWTMR------------------ENLAQ----SENYKDIRERYTSPQPSPAHVATERRQ----EVKSEGHIMISYQWANQAILKKIRDNLRANGFKVWMD--IDDMEGSTLDAMARAVENADVVLVCYSQKYKDSDNCRAEAEYAFQKKKKVIPLKMELNYIPDGWLGFICGAKLFFDFGGKYSFESRVEGLVKELWSKMSKDVVDGVVVPESATVVYSAPVAKENVAEPVYSAPPHGGVSHVTMTTVELVKKWKDQDVDKWMAKHSLSTQQV---KKMTGVEVAFLMLLKTESPDFFYKVLTDTLKITNL 771          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A1S3HGA3 (uncharacterized protein LOC106155047 OS=Lingula unguis OX=7574 GN=LOC106155047 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 6.226e-47
Identity = 143/553 (25.86%), Postives = 258/553 (46.65%), Query Frame = 1
Query:  448 IFFNYTDASSDFGKEFCKNDKLLHLYYKIISEFKENCLNKSL---SKNITDLLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFE-DAXXXXXXXXXXXXAGNVQKKIDEIDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDL 2094
            IF+NY+DAS  F +    +  L ++   +     +  +  S+    +  +  L+  I  ++N     V+    I  EMK +D +K  +   E + K  A++  AYI ++ ++ +  ++     ++I+LLK++L +   R++G S  E++KG+G +++ND+NK L+ E G +P L   L  +D+   E AL  LW L FD+ NK  IQ+E               C           +V  L  H      K+ N +  ++         N +S +D L  + + D  +                          ++ K   T     A   H+M+SY+W +  +++K+ D L  +GF +W+D        + +++MA+A++N+  V+I +S  YK+S NCR EA+Y+    K ++P+M+Q  Y+PDGWLG+ +    + DF+G+YNFE     L  +   R K G +   + E   + P          ++ + W  E    W ++  + R+      TG ++ FL+ I     E F+    +++ I  L+DL
Sbjct:  153 IFWNYSDASLKFAESVGLSGYLEYMMNDL-DAIDKGVIAGSIDTEEEGTSLALKSAIGCVHNCA--KVDTLRPIFHEMKVVDRLKPYLHTAETENKAVAIMTEAYIINDEQNDILATEDGIFEFIIDLLKQALESDDHRAEGFSAWEMAKGLGAMARNDQNKTLIAEKGAIPFLAAMLASEDEEEVEEALSTLWKLGFDQNNKRKIQEE-------------PNCF---------ERVKGLTKHKNSRITKAANGVVWILSQ-------NQLSSEDVLQSQARTDSAS--------------------------LREKSASTAAGGKA--GHVMISYNWGDQKVLLKVKDELRRRGFNIWMD--VEQMGGSTLQAMAEAVENAAVVLICMSDRYKDSPNCRTEAEYSFKLNKDIVPLMMQRNYKPDGWLGMILGSKLFFDFSGKYNFECKVDELAKELGNRGKTGGIVPVMTETAALAPSF----GSGKKNPSHWNKEDVAQWLEKNNLNRMPKFTKLTGEQIAFLKEIHTNAPEFFFCYMTDKMGIVQLQDL 639          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: C3YBW8 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_130981 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 7.587e-43
Identity = 148/570 (25.96%), Postives = 273/570 (47.89%), Query Frame = 1
Query:  385 GKNYSEEIDNKFHSAIKNLIDIFFNYTDASSDFGKEFCKNDKLLHLYYKIISEFKENCLNKSLSKNITD--LLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDAXXX--XXXXXXXXXAGNVQK-KIDEIDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKIT 2079
            G  + +E   + + AI+N     ++++DAS +F K   K      L+  +I + K+    K+   N     L+R  +  L+N     V EN  I++ +  +D +   +   + ++K   ++ +AYI  E ++ +  +D   IS+++ + ++++++   RSQG S  E++ GI +L++ND+NK ++V+ G LP+L   +E  D+  QE     +W L F + NK  I+ E R  + +LK   D K Q   T   A   +  L   + E +AK             S++D+   S    +    Q+D     + + +                    KS++   E+ +  +  HIM+SY W +   ++K+ D L + G+++W+D        + +++MA+A++NS  V+I +SQ YK S NCR EA+Y    +K ++P+M++ KY+PDGWLG  +    Y DF+ ++ FED++         +   A  VQK +  E+       +         +  W      NW  E  +++    +  TG +L FL+++    GE+ +    N  K T
Sbjct:  145 GNMFDDETVWECYYAIRNCC---WSFSDASFNFAKRLGKAG----LFPMLIEDLKQ--YKKTFQTNQAHNWLVRCSLGILHNCA--KVMENRAILRPLGLIDQLLPWINTSDEELKTVTVMTLAYIVGEEDNDLIMADDSVISFIMTVFEEAVDSELMRSQGFSAMEMAMGISQLAQNDDNKVMIVKKGALPLLVQLMETGDEEEQEQGANAVWQLAFHDDNKDKIRAEPR-LMYQLKRLKDSKNQE--TAKAANGALWVLDKQAREEKAKEL----SEKSEESSREDLQEGSGPHIM-ISYQWDHQKTLVKEKAKELS---------------EKSEESSIEDLQEGSGPHIMISYQWDHQKTLVKVKDRLQSYGYRVWMD--LEQMGGSTLQAMAEAVENSVVVLICMSQKYKESPNCRTEAEYTFQLRKQIVPLMMEGKYKPDGWLGAILGAKLYFDFSAQHKFEDSIGKLIKELGQRGRSAQLVQKVQAVEVGAGGAGALPIMPPAKPRVLDWKQAEVDNWIAENQLEKNFL-RELTGPQLHFLQSLR---GEIGFYAPSNHSKST 674          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: V4AY29 (TIR domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_230877 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.629e-42
Identity = 147/525 (28.00%), Postives = 253/525 (48.19%), Query Frame = 1
Query:  616 LYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSL--NTRFSR-SQGL--STEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTK---LDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTW--TLTNLEEVKSKKQ-ETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFE---DAXXXXXXXXXXXXAGNV-----QKKIDEIDHID----PVH-------VKNQSKNNQDITKWANERCKNWFDEIGIK--RIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDL 2094
            ++N  + D N    +++E+KF  ++K+ +      IK  A+L +A I  E ES   +++   I +L+   K++L  ++R ++   G+     EL+KGIG+L+ ND NK+LLVE G LP+L    + DD   Q+ AL  +W+L F+E+N        ++KI+EL      LD K + G +                                     D  S  Y       T+  ++++        +K I D L    T++  +    K + ET E++   K H+M+SY W + +I+ ++ D +     K+W+D      E + +++MA A++N+  V+I +S+ YK+S NCRAEA+YA   +K VIP++++  Y+PDGWLG+ +    + DF+G+Y FE   + L+  + Q   +  G V      K +D +D  D    PV         K       ++  W   + K+W  + G+   R+   +  TG E+ FL+ +     E +Y   K +L I  L D+
Sbjct:    3 IHNVAMTDAN--IPLLQELKFAPVLKNYLSFTNDTIKLTAILGLADIMTEEESHYVETNNEVIIFLLMTFKRALFASSRTAKDGNGMIWGVLELAKGIGRLASNDGNKKLLVEKGSLPLLLKLAKSDDLEEQKEALKSMWALAFNEEN--------QDKIIELPGLIEFLDDKNRTGFS-------------------------------------DTRSTCYGILWTMRTKLQQSSQ--------FKAIGDRLVVKKTMSPSKTFTEKGELETSEKDSKNKGHVMISYQWGDQEILKRVRDKIRGSKKKVWMD--IDDMEGSTLQAMADAVENADIVLICMSRKYKDSPNCRAEAEYAHQLRKTVIPLIMERSYKPDGWLGMILGAKLFYDFSGKYPFESKIEGLLREISQKLNLGDGAVAGPTGSKGVDVVDGPDQKIVPVQNDMVYAPYKAPPPKLGEVKSWNAAQVKDWLKKYGLSGTRV---EKLTGREIAFLQKLQASTPEYYYMTVKTDLGIKTLTDM 467          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XMC6 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.395e-39
Identity = 125/435 (28.74%), Postives = 209/435 (48.05%), Query Frame = 1
Query:  484 GKEFCKNDKLLHLYYKIISEFKENCLNKSLSKNITDLLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKMF-KSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFED 1785
            G  + K   ++ L Y I+ E +E  L +   K  T L     + L+N  L     N  + +E K ++ ++  ++ +   +K  +++ +AYI +E + ++  +   ++I YL+E+LK + N++  R QGLS EE++  +G+L+ +D NK  +VE G LP++   L  +    QE +   +W+L F +     + ++ R+         +  C   L           L T S    AK+ N    VI     KKD+   + DD                                 T L    S+KQ           HIMLSY W    +V+K+ D L   G+ +W+D        + +++MA+AI+N+ A+V+ +S+ YK S NCR EA+YA   +K +IPVM++E Y+PDGWLGI +    Y DF+GR + E+
Sbjct:    7 GDPYLKAVSMMTLAY-IVEEGQEEILAE---KGTTSL-----NILHN--LAKAPGNKHVYREEKVVESMEPFLEGDP-YLKAVSMMTLAYIVEEGQEEILAEKGTNTIEYLVEILKDAQNSKDKRCQGLSVEEVTAALGRLAVHDNNKYKIVEAGGLPLMISMLHDESVETQEASAHAVWNLAFSDD----VSEKLRS---------NTDCMMALQ---------DLSTSSSSEVAKAANGALWVINKEGEKKDLVKENEDD---------------------------------TGLGHSLSRKQ----------PHIMLSYQWGCQPLVLKMRDVLAKAGYNIWVD--VDCMYGSTLQAMAEAIENACAIVMCMSERYKESPNCRTEAEYAFQLRKRIIPVMMEEYYQPDGWLGIILGAKFYMDFSGRLDIEE 362          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 108.612 bits (270), Expect = 2.255e-24
Identity = 73/260 (28.08%), Postives = 133/260 (51.15%), Query Frame = 1
Query: 1348 GLTWTLTNLEEVKSKKQETEEEEVAT---KDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNF--EDAXXXXXXXXXXXXAGN---VQKKIDEIDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIK---RIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDL 2094
            G+ W      E++ K+  T +E  A    ++H+M+SY W     ++++   L   G+++W+D        + +++MA A++N+  V++ +SQ YK S NCR+EA+YA   +K ++P+M+++ YRPDGWLG+ +    + DF+ +     +D+   L K+I     G    V+ K+  + H D V V  +     DI+KW+ +   NW +  G++         H +G  L  L  +     E FY   K +     L+++
Sbjct:  572 GVLW------EIEGKESHTVKESTADEPLRNHVMISYQWDVQPTMIQVKSKLQAAGYRVWMD--LEQMGGSTLQAMANAVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKSYRPDGWLGMIMGAKLWIDFSDKQTLRVDDSFEKLQKEIGMRGRGRGNVVESKLVAVQH-DVVDVFPKI----DISKWSKDDVMNWMNGFGLRLGNDSTIASHLSGKLLQRLAKLRSESPEFFYSSVKQDFGFAHLQEV 818          

HSP 2 Score: 70.4774 bits (171), Expect = 1.710e-12
Identity = 55/201 (27.36%), Postives = 103/201 (51.24%), Query Frame = 1
Query:  607 ISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKC---EEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALG--VLWSLTFDEKNK--ILIQKEFRNKILELKTKLD---KKCQAGLTHDTAGSQVPTLQTHSVE 1179
            ++T   TM H+++      +  K  D +K L+     E  +    ALL +AY+ DE+ + +  +    I +LI +L KS ++  +R  G +  EL++G+ +++ ND NK+L+ + G +P+L + +  + K +++   G   LW L FD +NK  IL        + EL+   D   KK  AG+  +  G +  T++  + +
Sbjct:  393 LNTAMGTM-HNLSRRIPCRQYFKKADTVKVLLPMLNDEVSQFAAKALLILAYLTDESNNSLIMASEEPIQFLIHILSKSCSSNSNRYLGFTNSELAEGLSQIAVNDSNKKLIGQHGAIPIL-VDMLANAKNDEQRRCGAEALWVLAFDNENKEAILTTPNAVELLKELQHSEDDSVKKAAAGVLWEIEGKESHTVKESTAD 591          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 105.531 bits (262), Expect = 3.112e-23
Identity = 48/110 (43.64%), Postives = 76/110 (69.09%), Query Frame = 1
Query: 1432 HIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDF 1761
            H+MLSY W   D+V+K+ D L   G+K+WID      E + +E+MA A++N+ AV++ +S+ YK S NCR+EA+Y+   +K +IP+M++ +Y+PDGWLGI +    + DF
Sbjct:  554 HVMLSYQWGYQDVVLKVRDELRAAGYKVWID--VEQMEGSTLEAMASAVENAAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEPQYKPDGWLGIIVGAKLWMDF 661          

HSP 2 Score: 103.605 bits (257), Expect = 1.424e-22
Identity = 64/229 (27.95%), Postives = 119/229 (51.97%), Query Frame = 1
Query: 1423 TKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDAXXXXXXXXXXXXAGNVQKKIDEI------------DHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRI-VWPKHYTGNELDFLRTISQVPGEVFYQISKNEL 2070
            ++ HIM+SY W N   ++ +   L   G K+W+D        + +E+MA+A++N+  ++I +SQ Y++S NCR+EA+YA  ++K ++P+M+++ YRPDGWLG+ +    + DF  R + +  ++ L+K+++  +   +Q+  D +            D  D         +  D++KW  E    W  +IG+       K   G+ L  L  + Q   E +Y   K ++
Sbjct: 1010 SQQHIMISYQWDNQKAMLAVNKRLKEAGHKVWMD--VEQMGGSTLEAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQDYRPDGWLGMILGAKLWMDF--RESVDTGIVHLMKELQYNQTAALQQPHDPVTVDTTTVISSPPDKEDGPPGPTDVVDRPDVSKWKKEDVAKWLSDIGLSSSNKVRKKLDGSMLILLYRLKQESPEFYYASVKKDM 1234          

HSP 3 Score: 58.151 bits (139), Expect = 1.151e-8
Identity = 37/125 (29.60%), Postives = 70/125 (56.00%), Query Frame = 1
Query:  697 LMKCEEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGV--LWSLTFDEKNKILIQKE 1065
             MKC        ALL +AY+ DE  + +  +D   I++L+ +L  +++    +  G +  E++ GIG+++ ND+NK+L+     + +L   L K+ K + E   G+  L+ L+FD +NK ++ K+
Sbjct:  846 FMKCGVTYFVMNALLCLAYLVDERNNDLIMADEEPITFLLRMLSSAISDSRRQHLGFAAWEIACGIGRVASNDKNKRLIGRHDGVSILST-LVKEAKNDAERVYGLQALYMLSFDGENKKILCKD 969          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO39316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI7])

HSP 1 Score: 80.8777 bits (198), Expect = 1.464e-16
Identity = 43/123 (34.96%), Postives = 67/123 (54.47%), Query Frame = 1
Query: 1432 HIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKP----VIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDA 1788
            H+MLSY W   D+V K+YD L   G ++W+D +      ++  SMA+ +  +  +  F+S  Y  S NC+ E  YA  K       ++PVM ++ ++  GWLGI   GL + DF    NFE++
Sbjct:    3 HVMLSYQWDIQDLVKKVYDGLRAYGIRVWMDIH-GGIRGDINGSMAKGVDGAAILCCFMSTKYSESKNCKKELSYADGKTGCEEVIIVPVMCEKGFKAKGWLGIITAGLLWIDFRDEANFENS 124          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG5])

HSP 1 Score: 72.7886 bits (177), Expect = 4.703e-16
Identity = 30/66 (45.45%), Postives = 49/66 (74.24%), Query Frame = 1
Query: 1567 AQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFA 1764
            A A++NS  V++  S+ YK+S N R+EA+YA ++KKP++P+M++  Y+PDGWLG+ +    Y +FA
Sbjct:   10 ANAVENSAVVLMCASRKYKDSVNYRSEAEYAYTQKKPIVPLMMENGYKPDGWLGMIMGSKLYFNFA 75          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST59])

HSP 1 Score: 56.225 bits (134), Expect = 4.358e-8
Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 1
Query: 1435 IMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVI 1683
            IMLSY+W     V ++Y  L  + F+ W+D +   +        A A++NS  +V F+++ Y+ S NC  E +YA  K+KP+I
Sbjct:  413 IMLSYNWGIQSFVREVYMELSQQTFQTWMDIWGGMQGNINEAM-ATAVENSTMLVAFLTEKYQQSVNCNLELKYATMKEKPII 494          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000008937.1 (SMESG000008937.1)

HSP 1 Score: 1322.38 bits (3421), Expect = 0.000e+0
Identity = 676/691 (97.83%), Postives = 683/691 (98.84%), Query Frame = 1
Query:   25 MQATSKPQKRKVVGEEIVSKPITRKLTIDEINLKICSEAEDIINKVKSLQKFITDLQPQESSEFQQIVKAINSKYFSLNKFNVKLEDVKRLRLSNANVLIKLDIFNIYYTILVQILHNVFGKNYSEEIDNKFHSAIKNLIDIFFNYTDASSDFGKEFCKNDKLLHLYYKIISEFKENCLNKSLSKNITDLLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDAXXXXXXXXXXXXAGNVQKKIDEIDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDLR 2097
            MQATSKPQK+KVVGEEIVSKPITRKLTIDEINLKICS AEDIINKVKSLQKFITDLQPQESSEFQQIVKAINSKYFSLNKFNVKLEDVKRLRLSNANVLIKLDIFNIYYTILVQILHNVFGKNYSEEIDNKFHSAIKNLIDIFFNYTDA+SDFGKEFCKNDKLLHLYYKIISEFKENCLNKSLSKN+TDLLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIA ETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHD  GSQVPTLQTHSVES A +CNRIP++IGNLESKKDMNSVSYDD LCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYNMSEEENLMESMAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDALILLLKQIKRIKAGNVQKKIDEIDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIK IVWPKHYTGNELDFLRTISQVPGEVFYQI+KNELKITDLKDLR
Sbjct:    1 MQATSKPQKQKVVGEEIVSKPITRKLTIDEINLKICSVAEDIINKVKSLQKFITDLQPQESSEFQQIVKAINSKYFSLNKFNVKLEDVKRLRLSNANVLIKLDIFNIYYTILVQILHNVFGKNYSEEIDNKFHSAIKNLIDIFFNYTDANSDFGKEFCKNDKLLHLYYKIISEFKENCLNKSLSKNLTDLLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIAGETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDITGSQVPTLQTHSVESPAINCNRIPEIIGNLESKKDMNSVSYDDVLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYNMSEEENLMESMAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDALILLLKQIKRIKAGNVQKKIDEIDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIKSIVWPKHYTGNELDFLRTISQVPGEVFYQITKNELKITDLKDLR 691          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000008941.1 (SMESG000008941.1)

HSP 1 Score: 334.724 bits (857), Expect = 4.934e-104
Identity = 218/600 (36.33%), Postives = 350/600 (58.33%), Query Frame = 1
Query:  349 YTILVQILHNVFGKNYSEEIDNKFHSAIKNLIDIFFNYTDASSDFGKEFCKNDKLLHLYYKIISEFKENCLNKSLSKNITDLLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNT-RFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQ---FDENTEEI---SKNSFNYKNILDGLTWTLTNL--EEVKSKKQE--TEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDAXXXXXXXXXXXXAGNVQKKIDE------IDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDLR 2097
            Y  L ++ + +   + S+E+ N    +   L+DIF   ++ + +FG E CK + L+  +  II E+K  C+N SLS+    +L + I  LY+T+++D   N   + ++K  + ++   KC    IK    L VAYI++E +S  F  D+ SI  +I++L  S+ T  +S  Q     EL K + +LSKND+NK+ +VEMGILP+LK  LE +  + + ++L +L++L++DE+NK  I ++F   + +L+          L       Q+P      + +  K  N + K   N   K ++ +  Y      E++      N  +I    ++S + K  L+GL   LTN   E + S   +  ++    + + H+M+SY   NAD  +K+YD L  + FKLWIDK++M   +NLME+MAQA++NS+AV+I IS  YKNS++CRAEAQYA   KKP+IP+++QEKYRPDGWLGICI G+QY +F+G+Y+ E+++ +L+KQ+++ K  N Q+K +        DH +         N   ++ W+N +  NWF +IGIK+  W  HYTG+EL+FL++IS   GE   +  ++EL+I DLKD+R
Sbjct:   82 YLSLTKLFNEIKENHTSKEVGNNLPRSFTVLLDIFARCSETNQEFGDEICKRENLIQFFVMIIKEYKLPCINGSLSETELKILELSIRNLYSTLIYDSEVNIHKLHKLKVWESLQYFEKCPNQDIKIRLALLVAYISEEKDSSGFVVDISSIPIIIKVLSDSVKTAEYSSKQEYPILELIKAVERLSKNDKNKRKMVEMGILPILKTLLETNFTKYRHISLSILFNLSYDERNKSEIAEKFLQILFDLQ---------HLKTLKPKEQLP------ISTMNKPDNHLDKNALNQNIKGEIGTTFYIQPPAKESERALSQSNNPQIYGSQQDSASQK--LNGLMSILTNYQKENIPSPPSDNNSQTNPSSNQKHVMISYCHENADFALKLYDELKARNFKLWIDKHDMRANQNLMEAMAQAVENSWAVIICISHCYKNSESCRAEAQYAKDNKKPLIPIIIQEKYRPDGWLGICITGIQYLNFSGKYSSEESMGMLVKQLEQFK--NEQQKSEPTKPQIITDHSNLEQSNENQSNGIKLSDWSNSKVINWFRQIGIKKFAWKSHYTGSELEFLKSIS---GEKLLEFCQSELEIYDLKDIR 659          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000008947.1 (SMESG000008947.1)

HSP 1 Score: 270.396 bits (690), Expect = 2.414e-79
Identity = 181/508 (35.63%), Postives = 289/508 (56.89%), Query Frame = 1
Query:  592 LLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKM---FKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEE-EVATKD-HIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDAXXXXXXXXXXXXAGNVQKKIDEIDHI-DPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDLR 2097
            +L   I+  Y   ++   E   ++  MKF++LI+D +     +IK  +LL +A+++ E+  K+    +     +SYL +LL K +     +++  S  EL++GI KLSK DENK++LV+ GILPVL + ++    R ++++L +LW+L F++KN+ +I   F + I + +                                   +R P + G L +K D      D  L   T+    TE++ + +  Y N+LDGL W L +       +   E+  E++ ++ H M+SYS SNA IVM IY  L  +GFK+WIDKYN++++EN+ME+MAQA++NS AV+IF+S  YKNS+ CR+EAQYA    KP+IPV+V+++Y PDGWLG+CI GLQY DF  +  F+ ++ LL  QI  IK     K  ++ D   +P    N S NN     W +E  K W  +IG+++I W  +Y G ++ FL+++S+   E F  I + + K++DLK++R
Sbjct:  262 ILNDTITIPYTISINGNPEQIAVLHSMKFVELIQDFLLSPYERIKLNSLLLIAHLSSESHFKLEIIQEKRPEYLSYLTQLLNKYMTDYHGQTRAYSILELARGIEKLSKVDENKRILVKCGILPVLMLLIKNKSMRYKKISLSILWNLAFNKKNRQVINSMFSDIISDFRR----------------------------------DRFPLLYGTL-TKNDKRKTQNDLELRNVTENLNETEKMPRKT--YINVLDGLKWILQDHRNNSKTRDACEDSNEISERETHFMISYSHSNAKIVMDIYQILQKQGFKVWIDKYNINDDENMMEAMAQAVENSIAVIIFLSTKYKNSEYCRSEAQYAFKLNKPLIPVVVEKEYHPDGWLGLCISGLQYFDFTSKTPFKKSMALLTDQISTIKNRRFSKIFEKSDFPKEPSVPSNPSPNN-----WTHEEVKTWLKKIGVRKIKWKANYAGQDIMFLKSLSK---EKFLDICRIDFKMSDLKEMR 724          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000008947.1 (SMESG000008947.1)

HSP 1 Score: 270.396 bits (690), Expect = 3.777e-79
Identity = 181/508 (35.63%), Postives = 289/508 (56.89%), Query Frame = 1
Query:  592 LLRICISTLYNTMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETESKM---FKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEE-EVATKD-HIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDAXXXXXXXXXXXXAGNVQKKIDEIDHI-DPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRIVWPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDLR 2097
            +L   I+  Y   ++   E   ++  MKF++LI+D +     +IK  +LL +A+++ E+  K+    +     +SYL +LL K +     +++  S  EL++GI KLSK DENK++LV+ GILPVL + ++    R ++++L +LW+L F++KN+ +I   F + I + +                                   +R P + G L +K D      D  L   T+    TE++ + +  Y N+LDGL W L +       +   E+  E++ ++ H M+SYS SNA IVM IY  L  +GFK+WIDKYN++++EN+ME+MAQA++NS AV+IF+S  YKNS+ CR+EAQYA    KP+IPV+V+++Y PDGWLG+CI GLQY DF  +  F+ ++ LL  QI  IK     K  ++ D   +P    N S NN     W +E  K W  +IG+++I W  +Y G ++ FL+++S+   E F  I + + K++DLK++R
Sbjct:  282 ILNDTITIPYTISINGNPEQIAVLHSMKFVELIQDFLLSPYERIKLNSLLLIAHLSSESHFKLEIIQEKRPEYLSYLTQLLNKYMTDYHGQTRAYSILELARGIEKLSKVDENKRILVKCGILPVLMLLIKNKSMRYKKISLSILWNLAFNKKNRQVINSMFSDIISDFRR----------------------------------DRFPLLYGTL-TKNDKRKTQNDLELRNVTENLNETEKMPRKT--YINVLDGLKWILQDHRNNSKTRDACEDSNEISERETHFMISYSHSNAKIVMDIYQILQKQGFKVWIDKYNINDDENMMEAMAQAVENSIAVIIFLSTKYKNSEYCRSEAQYAFKLNKPLIPVVVEKEYHPDGWLGLCISGLQYFDFTSKTPFKKSMALLTDQISTIKNRRFSKIFEKSDFPKEPSVPSNPSPNN-----WTHEEVKTWLKKIGVRKIKWKANYAGQDIMFLKSLSK---EKFLDICRIDFKMSDLKEMR 744          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000035587.1 (SMESG000035587.1)

HSP 1 Score: 110.538 bits (275), Expect = 7.078e-25
Identity = 131/516 (25.39%), Postives = 220/516 (42.64%), Query Frame = 1
Query:  607 ISTLYNTMLHDVNENYTIIKEMK--FLDLIKDLMKCEE--GKIKRAALLFVAYIADETESKMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENKQLL-VEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRNKILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGNLESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNLEEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWIDKYXXXXXXXXXXXXAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKKPVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDAXXXXXXXXXXXXAGNVQKKIDEID-HID-PVHV----------KNQSKNNQDIT------KWANERCKNWFDEIGIKRIVWPKHYTGNELDFLRTISQV---PGEVFYQISKNELKI 2076
            I+ ++N   H +++    + E+K  FL+++   + C++  G I   +L+ ++Y+ DE E  +F    + +  LI+ +K  +N    RS+G + +EL  G+ +LS NDE K ++  E GI  ++ +    +++   E  L V+  L F+                ++K KL       + H   G  +     HS    AK C                                                 +G+ W L N  +++S  +   E+     D  M SYSW+N D V++I   L +    +WID+       + +E+MA  I+NS  VVI  S  YKNS NCR EA+YA   KKP+IP++++ KY+P  WLGI      Y +F+ R N  +                VQ+ I  I  H++ PV +          KN+S +   I        W+ E   +W D+ GI  +   + + G +   +  +  +    G+ F    KNE K+
Sbjct:  157 ITIIHNFASHKLDKINYRVDEIKKTFLNIVN--LNCDDYYGLI---SLVTLSYLIDENEINLFDGHENIVKELIKKIK-LINENKLRSEGFTIKELIHGLRRLSANDEIKTIIDTENGIQVLIDILNSTNNENVIEPTLDVIKQLCFNN---------------DIKIKL-------INHYKIGETLTKFSNHS---NAKICQH----------------------------------------------YNGILWILDN--KLESLPKGNTEKTAIVFDAFM-SYSWANKDKVLEICSILKSYNVNVWIDQ--EEMISSTLEAMATGIENSKVVVIAASTAYKNSSNCRLEAEYAQKIKKPIIPLVMEHKYKPSNWLGILFGTKVYIEFSDRRNANEQ---------------VQQLIKNIKFHLNRPVKLAEKIDLNAGEKNRSNSRTRIVLVDEVKNWSCENVGDWLDKFGIGYL--KEKFIGVDGSMIEVMLDIRINSGDYFNNCLKNEFKM 573          
The following BLAST results are available for this feature:
BLAST of TIR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PZ211.366e-4724.93Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6... [more]
A0A1S3HGA36.226e-4725.86uncharacterized protein LOC106155047 OS=Lingula un... [more]
C3YBW87.587e-4325.96Uncharacterized protein OS=Branchiostoma floridae ... [more]
V4AY291.629e-4228.00TIR domain-containing protein OS=Lottia gigantea O... [more]
W4XMC61.395e-3928.74TIR domain-containing protein OS=Strongylocentrotu... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450302.255e-2428.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410083.112e-2343.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393161.464e-1634.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337204.703e-1645.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331054.358e-834.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008937.10.000e+097.83SMESG000008937.1[more]
SMESG000008941.14.934e-10436.33SMESG000008941.1[more]
SMESG000008947.12.414e-7935.63SMESG000008947.1[more]
SMESG000008947.13.777e-7935.63SMESG000008947.1[more]
SMESG000035587.17.078e-2525.39SMESG000035587.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009450 ID=SMED30009450|Name=TIR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2350bp
ACAATATCCAAGCTTATTTGACTTATGCAAGCAACATCTAAACCTCAAAA
ACGAAAAGTTGTTGGCGAAGAAATAGTTAGCAAGCCAATTACTCGCAAAT
TAACGATTGACGAAATCAATTTAAAAATTTGTTCAGAGGCGGAAGATATA
ATAAATAAAGTTAAAAGTCTACAAAAATTTATAACAGATCTACAACCTCA
GGAATCAAGTGAATTTCAACAAATTGTTAAAGCTATCAATTCTAAATATT
TTTCTCTTAATAAATTTAATGTGAAGTTGGAGGATGTTAAGAGATTAAGA
TTATCAAATGCAAATGTTCTAATTAAGCTGGACATTTTCAATATATATTA
CACAATACTTGTACAAATACTTCATAATGTATTTGGAAAGAATTATTCTG
AAGAGATTGATAATAAATTTCATTCCGCAATTAAAAATTTAATAGATATT
TTTTTCAATTATACCGATGCAAGTTCAGATTTCGGCAAGGAATTCTGCAA
GAATGATAAACTTCTACATCTTTATTATAAAATCATTAGTGAATTCAAAG
AAAATTGTTTGAATAAATCACTATCAAAGAATATAACTGATTTATTGCGA
ATATGTATCTCTACGTTGTATAATACGATGCTTCACGACGTCAATGAAAA
TTATACTATTATAAAAGAAATGAAGTTTTTAGATCTAATTAAAGATTTGA
TGAAATGTGAAGAAGGAAAAATCAAGAGAGCGGCACTATTATTTGTTGCT
TACATCGCCGATGAAACCGAATCTAAAATGTTTAAAAGTGATTTACATTC
AATTAGCTATTTAATCGAACTTCTAAAGAAATCTTTGAACACCCGGTTCA
GCCGATCTCAGGGCTTATCCACTGAAGAATTATCAAAGGGTATCGGAAAA
CTTTCCAAAAACGATGAAAACAAGCAATTGTTAGTAGAAATGGGTATTTT
ACCAGTTCTAAAAATGCAATTAGAAAAGGATGACAAAAGGAATCAAGAAC
TTGCATTAGGTGTTCTATGGAGTTTAACATTTGATGAAAAAAATAAAATT
TTAATACAGAAGGAATTTAGAAATAAAATCCTAGAACTGAAAACAAAACT
AGATAAAAAATGCCAAGCCGGATTAACGCATGACACTGCTGGTTCACAGG
TGCCGACGTTACAAACTCATTCTGTAGAATCACGTGCTAAAAGTTGTAAC
CGAATACCGAAAGTTATAGGAAATCTTGAATCAAAGAAAGATATGAATTC
CGTTAGCTATGATGACTTTCTCTGTTTTGAAACTCAATTTGATGAGAATA
CCGAGGAAATTTCAAAAAATAGTTTCAATTACAAAAACATATTGGATGGA
CTGACATGGACACTGACAAATTTGGAAGAGGTGAAATCGAAAAAACAAGA
AACGGAAGAAGAAGAAGTAGCAACCAAAGATCACATAATGCTTAGCTACA
GTTGGTCAAATGCAGATATTGTTATGAAAATCTATGATTGCTTGGTTAAC
AAAGGCTTTAAACTATGGATAGACAAATACAATATGAGTGAAGAGGAAAA
TCTAATGGAATCCATGGCTCAAGCAATTCAAAATTCATATGCTGTCGTTA
TATTTATCTCGCAAAATTATAAAAACAGCGACAATTGCCGGGCTGAAGCT
CAATATGCTATATCAAAAAAGAAACCTGTAATTCCAGTTATGGTCCAAGA
AAAATATAGGCCAGATGGCTGGCTTGGGATTTGTATAATCGGACTTCAAT
ATTGCGACTTTGCTGGGAGATATAATTTTGAAGATGCTCTTATTTTATTA
TTGAAGCAGATCAAAAGAATTAAAGCAGGAAATGTACAAAAAAAAATTGA
CGAAATCGACCACATCGATCCGGTCCATGTGAAGAATCAATCAAAAAACA
ACCAAGATATTACAAAATGGGCAAATGAAAGGTGTAAGAACTGGTTTGAT
GAGATTGGGATTAAAAGAATTGTCTGGCCCAAACATTACACCGGAAATGA
ATTGGATTTCCTCAGAACAATTTCTCAAGTACCCGGAGAAGTATTTTATC
AAATTTCCAAAAATGAACTGAAAATAACAGATTTAAAAGATTTGAGAATT
TTATTTCAAAATTTACAGATATTGTAAATATTTTGAATTTTTATATTTTT
TTGAATACTACTCGAATTTATTATTTATTTAGTGTTTTTACATATAAATA
ATGTGCTCAGAGGTCATTTGTGTATTCAAGTAGTCTTTCGATCAGCACTT
TATTGGAATTTGTAATTTTTATGCCTTTAGTTTTATATGCTAGTTAGATA
AGTGATTTAGATTCATACAATTTCAAATAAACTCGTTATTTTTGTTAAAA
back to top

protein sequence of SMED30009450-orf-1

>SMED30009450-orf-1 ID=SMED30009450-orf-1|Name=SMED30009450-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=701bp
MQATSKPQKRKVVGEEIVSKPITRKLTIDEINLKICSEAEDIINKVKSLQ
KFITDLQPQESSEFQQIVKAINSKYFSLNKFNVKLEDVKRLRLSNANVLI
KLDIFNIYYTILVQILHNVFGKNYSEEIDNKFHSAIKNLIDIFFNYTDAS
SDFGKEFCKNDKLLHLYYKIISEFKENCLNKSLSKNITDLLRICISTLYN
TMLHDVNENYTIIKEMKFLDLIKDLMKCEEGKIKRAALLFVAYIADETES
KMFKSDLHSISYLIELLKKSLNTRFSRSQGLSTEELSKGIGKLSKNDENK
QLLVEMGILPVLKMQLEKDDKRNQELALGVLWSLTFDEKNKILIQKEFRN
KILELKTKLDKKCQAGLTHDTAGSQVPTLQTHSVESRAKSCNRIPKVIGN
LESKKDMNSVSYDDFLCFETQFDENTEEISKNSFNYKNILDGLTWTLTNL
EEVKSKKQETEEEEVATKDHIMLSYSWSNADIVMKIYDCLVNKGFKLWID
KYNMSEEENLMESMAQAIQNSYAVVIFISQNYKNSDNCRAEAQYAISKKK
PVIPVMVQEKYRPDGWLGICIIGLQYCDFAGRYNFEDALILLLKQIKRIK
AGNVQKKIDEIDHIDPVHVKNQSKNNQDITKWANERCKNWFDEIGIKRIV
WPKHYTGNELDFLRTISQVPGEVFYQISKNELKITDLKDLRILFQNLQIL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR000157TIR_dom
IPR000225Armadillo
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 687..700
NoneNo IPR availableCOILSCoilCoilcoord: 450..470
NoneNo IPR availablePANTHERPTHR46270FAMILY NOT NAMEDcoord: 10..698
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 443..564
e-value: 5.4E-22
score: 80.0
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 470..582
IPR000225ArmadilloPFAMPF00514Armcoord: 296..335
e-value: 1.5E-4
score: 21.7
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 471..589
e-value: 1.5E-25
score: 90.1
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPROSITEPS50104TIRcoord: 494..546
score: 9.186
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 164..365
e-value: 3.5E-11
score: 44.4
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 185..346