Cubilin

Overview
NameCubilin
Smed IDSMED30009444
Length (bp)3776
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cubilin (SMED30009444) t-SNE clustered cells

Violin plots show distribution of expression levels for Cubilin (SMED30009444) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cubilin (SMED30009444) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cubilin (SMED30009444) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009444

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009444SMESG000058235.1 SmedASXL_017437SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30009444SMESG000058235.1 dd_Smed_v4_11447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009444SMESG000058235.1 dd_Smed_v4_11447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009444SMESG000058235.1 dd_Smed_v4_11447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009444SMESG000058235.1 dd_Smed_v4_11447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009444SMESG000058235.1 dd_Smed_v4_11447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009444SMESG000058235.1 dd_Smed_v6_11447_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30009444SMESG000058235.1 OX_Smed_1.0.02023ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cubilin vs. Ensembl Human
Match: CUBN (cubilin [Source:HGNC Symbol;Acc:HGNC:2548])

HSP 1 Score: 128.257 bits (321), Expect = 7.136e-29
Identity = 172/725 (23.72%), Postives = 276/725 (38.07%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQ-QSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW------SEILQRLPDGSCPGF 2666
            F SP FP +YPPN  C +         + +    F++E     CN D L++Y          F++  + + C       P  V S  N + + F +D++   + +N        G  G F+    AP                     G I SP YP  Y S+ +CS+++  ++  R+ L F D DL  Q D CI      YDG + +   + +    E+    I+S+ N L +RF +G     SR              Q +GF   +R          +    HI+ +  D            + SP +P   P N+ C++ +      N +  +   F+                 S    R F   L+   +   L        CGTD      IT     + LR  + ++ S+G  GF    T                C   + ++    G+ NSP +  +YP N  C ++I+ +  +R+++ F  F L +            +  C  DFV + +    G ++ +       CG+S P    S    +++ + FISD   S +GF A +  I   D        NI+     G + S  +P  Y  N   QW+V   ++S+ +     +   E   Q+C    LRIYDG S  A      CGT +   +F ST N++   F +     G KGF L W        +L  +  G+C GF
Sbjct: 1402 FSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVE-YHSRCNFDVLEIY------GGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASWQAVTGGCGGIFQ----AP--------------------SGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ-DSCI----MAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGP----SR--------------QNRGFRAQFR----------QACGGHILTSSFDT-----------VSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFEL--------------ERSTTCARDFVEILDGGHEDAPLRGR----YCGTDMPH--PITSFSSALTLRFVSDSSISAG--GFHTTVT-----------ASVSACGGTFYMAE---GIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLED------------SQDCSRDFVEIREGNATGHLVGR------YCGNSFP-LNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGND--------NIVG--THGKVASPFWPENYPHNSNYQWTVNV-NASHVVHGRILEMDIE-EIQNCYYDKLRIYDGPSIHARLIGAYCGTQTE--SFSSTGNSLTFHFYSDSSISG-KGFLLEWFAVDAPDGVLPTIAPGACGGF 1981          

HSP 2 Score: 116.316 bits (290), Expect = 3.106e-25
Identity = 179/735 (24.35%), Postives = 279/735 (37.96%), Query Frame = 3
Query:  438 LTNY-VVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI--ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNIS---STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFK 2612
            L NY  + A    +  Y+D +G      F SPNFP  YP N  C Y+   ++ + + ++F +F++E  +     DFL++       +     +  LG F G  L   P  ++S  N + L F SD I+T+  ++        G  G                              G   SP YP  Y     C + L  +      L F+D  L H   +C  D++ +YDG + +S ++ Q  CG EKP L I S+ + + I+          R + G          Q +GF   YR + + V I N+                    T GIL+S GYP    +N+ C + +      N +    L F   +        CST  L +Y                   D P Q+   CG D       T     VLL        + G+G        +R+ G + +        FVY      S  +G  +SP F   YP N  C + I  +    I++   +F +        +YH    S C  D    + +I  GP    P         S   P+   S  N +++ F +D   +  GF A +        +   CG   I +   G I S  YP  YRSN  C W ++  D ++R++++F DF  E       +S +  YDG S   S  +  CG +      +S+ N++ L F + P     +GF+
Sbjct: 1036 LINYEAISAATACLQDYTDDLGT-----FTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIGNYYTDFLEI------RDGGYEKSPLLGIFYGSNL---PPTIISHSNKLWLKFKSDQIDTRSGFSAYWDGSSTGCGGNLT------------------------TSSGTFISPNYPMPYYHSSECYWWLKSSHGSAFELEFKDFHLEHH-PNCTLDYLAVYDGPSSNSHLLTQ-LCGDEKPPL-IRSSGDSMFIKL---------RTDEGQ---------QGRGFKAEYRQTCENVVIVNQ--------------------TYGILESIGYPNPYSENQHCNWTIRAT-TGNTVNYTFLAFDLEH-----HINCSTDYLELY-------------------DGPRQMGRYCGVDLPPPGSTTSSKLQVLL-------LTDGVG--------RREKGFQMQW-------FVYGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDV--------EYH----SRCNFD----VLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASW------QAVTGGCGG--IFQAPSGEIHSPNYPSPYRSNTDCSWVIRV-DRNHRVLLNFTDFDLEPQ-----DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQ-NRGFR 1613          

HSP 3 Score: 114.39 bits (285), Expect = 1.102e-24
Identity = 168/706 (23.80%), Postives = 265/706 (37.54%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFS-SGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQD-----IINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
             SPN+P  Y  N  C +        +V++NF  F++E       +D     +    L ST+     L R CG   + + N +VS  N + L F S  + Q            GF   F+              ++C  +I +   +  ++SP +P  YP++ NCS+++        I L F   +L  ++  C  D V I DG  E +P+ G+ +CG      I S  + L +RF++      S + +G             GF+     SV     T  M +                   GI  SPGYP   P N  C +                     NI  +P N+                 L++      L DS D   C  D+ EI+E    G LV      S   + S I G  ++  F  D    G   +        N +   + G + SPF+ + YP N+  Q+ +  N +H +     E  + E  ++   Y  L+              I  GP I   +  ++ CG+         S  NS++  F SDS  S  GF  ++  +   D     I    CG  + +      + S  +P  Y + + C W ++A DS+  + I   D     SH++CA   L I DGD+   Q  + LCG +  IP  I ++        TS  +  + GF
Sbjct: 1522 HSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLE------PQD--SCIMAYDGLSSTM---SRLARTCGR--EQLANPIVSSGNSLFLRFQSGPSRQNR----------GFRAQFR--------------QACGGHILTSSFD-TVSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFEL-ERSTTCARDFVEILDGGHEDAPLRGR-YCGTDMPHPITSFSSALTLRFVS-----DSSISAG-------------GFHTTVTASVSACGGTFYMAE-------------------GIFNSPGYPDIYPPNVECVW---------------------NIVSSPGNR-----------------LQLSFISFQLEDSQD---CSRDFVEIREGNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTHGKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEE--IQNCYYDKLR--------------IYDGPSIHARLIGAY-CGTQTES---FSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGGFLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIE---SHRTCAYDSLVIRDGDNNLAQQLAVLCGRE--IPGPIRSTGEYMFIRFTSDSSVTRAGF 2084          

HSP 4 Score: 100.138 bits (248), Expect = 2.638e-20
Identity = 171/792 (21.59%), Postives = 283/792 (35.73%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLLQKKGFNVV-YRFSV-------------------------------DYVKITNEMEKNHIIGTECDMWIKSSEKTS--------------------------------------GILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY-SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL--YPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +R +  SP +P+ YP N+ C +  + +S   + ++FE  F I      CN+ D+L L          L      G FCG    H  + + +  N + + F SD + +            GF   ++          K      + YI      GY+TSP +P  YP H +C ++L    + RI+L F D        +C  +++ + DG    +PI+ + FCG        S+  ++ +RF +       G   K S  + G  +     +++  G   + YR ++                               D+V+I +     +I+G  C   I  S  TS                                      G   SP YP   P  ++C + +     R       L F  L +   P   C+   + ++  IR    +LE    KL            +      EI   G  + +   T    S   GGF   YT   D    G +             +T  G   SP ++ +  Y  N  C++ +   N  N  I I+F++F L              +  C+ D +        GP++ +      LCG S P  PL+     + + + F+++    H GF+A+Y F          CG   I +   G ITS  YP  Y S   C   ++A    + I + F DF  E  H +CA   + + +G S ++    + CG  +  P  I + +   +    S  +    GF   W
Sbjct: 2099 DRGIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCG---SHASSTLFTSDNQMFVQFISDHSNEGQ----------GFKIKYE---------AKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPILSK-FCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRVPGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDNHTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSIGTFTSPNYPNPNPHGRICEWRITAPEGRR----ITLMFNNLRLATHP--SCNNEHVIVFNGIRSNSPQLE----KLC-----------SSVNVSNEIKSSGNTMKVIFFTDG--SRPYGGFTASYTSSEDAVCGGSL------------PNTPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLE------------SHQDCQFDVLEFRVGDADGPLMWR------LCGPSKPTLPLVIP--YSQVWIHFVTNERVEHIGFHAKYSFT--------DCGGIQIGD--SGVITSPNYPNAYDSLTHCSSLLEA-PQGHTITLTFSDFDIE-PHTTCAWDSVTVRNGGSPESPIIGQYCGNSN--PRTIQSGSNQLVVTFNSDHSLQGGGFYATW 2798          

HSP 5 Score: 97.0561 bits (240), Expect = 2.247e-19
Identity = 175/756 (23.15%), Postives = 303/756 (40.08%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRD-LDLNHQNDDCIE-DHVTIYDGDTESSPIIGQP-----FCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAV-LKFQT-LNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIE--GKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWSE--------ILQRLPDG--SCPGFECLKTKHCISRQLECD 2714
            SP +P  Y   + C +  +      V +N    +IE     C  D L +     +L      A+ L   CG     +P  + S    + + F SD +  ++          GFN +F               +SC  Y+ + +  G ITSP YP  YPS+LNCS+ ++      I + F     + + +  C + D++ + +G    SP +G P     FCG      + ++ N + ++FI+      S    G +IK   K L   G                            +++I  ++ ++G + SP +P   P +  C + L         ET + L+F+   +I  TP+  C++              LE+R    V  D+P     CGT     +  +  G ++ LR  + N+          +  FK  Y I   G  V PG           +SGV+ S     L Y  N  C++ + G + H + I F++F+L              +S CE DFV +      G I+ +       CG+++P  +  D+ SN+  + F++D   + SGF  +++          +CG ++   I  G  TS  YP       IC+W + A     RI + F++ +   +H SC N  + +++G    +    +LC + +      S+ NT+ + F T   + YG  GF   ++          L   P+G  + PG++ ++     SR L C+
Sbjct: 1993 SPGWPDSYSNRVDCTW-LIQAPDSTVELNILSLDIESHRT-CAYDSLVIRDGDNNL------AQQLAVLCGR---EIPGPIRSTGEYMFIRFTSDSSVTRA----------GFNASFH--------------KSCGGYLHADR--GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFIS----DHSNEGQGFKIKYEAKSLACGG----------------------------NVYIHDAD-SAGYVTSPNHPHNYPPHADCIWILAA-----PPETRIQLQFEDRFDIEVTPN--CTSN------------YLELR--DGVDSDAPILSKFCGTSLPSSQWSS--GEVMYLRFRSDNS--------PTHVGFKAKYSIAQCGGRV-PG-----------QSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQ------------NSSGCEKDFVEIWDNHTSGNILGR------YCGNTIPDSI--DTSSNTAVVRFVTDGSVTASGFRLRFE------SSMEECGGDLQGSI--GTFTSPNYPNPNPHGRICEWRITA-PEGRRITLMFNN-LRLATHPSCNNEHVIVFNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYG--GFTASYTSSEDAVCGGSLPNTPEGNFTSPGYDGVRN---YSRNLNCE 2600          

HSP 6 Score: 90.1225 bits (222), Expect = 2.634e-17
Identity = 158/715 (22.10%), Postives = 276/715 (38.60%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDS-KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREI-KEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTC-EGDFVRVIQKIPKGPIISQPIETSF-----LCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENII--SEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            +F SP +P  YPPN+ C +  V+    ++ ++F  F +E     C++DF    +E++   +T      +GR+CG++     N+   + + + + F SD +   +          GF  TF  I                F  D+     G + SP +P  YP + N  + +  N    +     ++D+  +  +C  D + IYDG +  + +IG  +CG + +    ST N L   F +   I                    KGF ++  F+VD      +     I    C  ++++ +     L SPG+P        CT+ +       +   + ++   L++       C+  SL I              Q+L        ++CG   REI   I   G  + +R  + ++ +    GF    +F +  G        G  H          G+I SP + + YPSN  C + ++  +   I ++F++     +G          +S+C +GD++     +  GP I  P           CGS     L +    N + + FISD      GF  +Y+   +       CG N+        G +TS  +P  Y  +  C W + A     RI + F D        +C ++ L + DG    A   S+ CGT  ++P+   +S  V      S  +    GFK  +S
Sbjct: 1748 IFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQ-DCSRDF----VEIREGNAT---GHLVGRYCGNSFPL--NYSSIVGHTLWVRFISDGSGSGT----------GFQATFMKI----------------FGNDNIVGTHGKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDI-EEIQNCYYDKLRIYDGPSIHARLIGA-YCGTQTE-SFSSTGNSLTFHFYSDSSIS------------------GKGF-LLEWFAVD----APDGVLPTIAPGACGGFLRTGDAPV-FLFSPGWPDSYSNRVDCTWLI-------QAPDSTVELNILSLDIESHRTCAYDSLVIRDGDNNLA------QQLA-------VLCG---REIPGPIRSTGEYMFIRFTSDSSVTR--AGFNA--SFHKSCG--------GYLH-------ADRGIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNG----------DSSCNQGDYL----VLRNGPDICSPPLGPPGGNGHFCGSHASSTLFTS--DNQMFVQFISDHSNEGQGFKIKYEAKSL------ACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIW-ILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPILSKFCGT--SLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYS 2332          

HSP 7 Score: 89.7373 bits (221), Expect = 3.198e-17
Identity = 160/721 (22.19%), Postives = 263/721 (36.48%), Query Frame = 3
Query:  459 ALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQN---DDCIEDHVTIYDGDTESSPIIGQPF---CGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY----SIRPFFVKL--EIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTD-SAIPAFISTSNTVHLEF 2573
             L C  I++SD          +SP++PQ +P N RC +  +    + + I+F++ F I      C   F+ ++   + ++  L     L   CG+     P  V++  N     F S     Q ++               F+     N T                 GYI SP YP  Y +++NC+Y++  N    + L F    L  ++     C+ D V I  G +    ++  PF   CG++     L+    +L+ F + + I           K + +++   G   V+ FS                              SGI+ SP Y      N +   +   + +   +E   LKF   ++   P   CS   L+IY    +  P   K     RP  +   ++   ++  TD  +    T KG  +  R         G GG++         G       P           + S        N +Y  N  C + II   N  I + F  F+L E    RQ+        C  D+V    K+  G   +  +  +F CGS+VP P IS    N +++ FISD      GF A Y       I++  CG    +     NI+S           IC W +   DS     +    +  + + Q C  + L++ D      +S  + CG + SA+P F S+ +T  + F
Sbjct: 2802 TLGCGGIFHSDN------GTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKAL-----LATGCGNV---APGPVITPSNTFTAVFQSQEAPAQGFSA-------------SFVSRCGSNFTGP--------------SGYIISPNYPKQYDNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYS----VMSTPFATVCGDEMPAP-LTIAGPVLLNFYSNEQITDFGF------KFSYRIISCGG---VFNFS------------------------------SGIITSPAYSYADYPNDMHCLYTITVSDDKVIE---LKFSDFDV--VPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPNVKSSNNSMLLVFKTDSFQ----TAKGWKMSFRQTLGP--QQGCGGYLT--------GSNNTFASP----------DSDS--------NGMYDKNLNCVWIIIAPVNKVIHLTFNTFAL-EAASTRQR--------CLYDYV----KLYDGDSENANLAGTF-CGSTVPAPFISSG--NFLTVQFISDLTLEREGFNATY------TIMDMPCGGTYNATWTPQNISSPNSSDPDVPFSICTWVI---DSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASAVPVFYSSMSTAMVIF 3375          

HSP 8 Score: 89.3521 bits (220), Expect = 4.480e-17
Identity = 157/704 (22.30%), Postives = 265/704 (37.64%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQND-DCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY--DFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGS--HQSCANSILRIYDGDSFQA--SSELCGTDSAIPA-FISTSNTVHLEFIT 2579
            I + +  +  SPN+P  Y     C     A     + + F  F+IE     C  D + +     S ES +     +G++CG++    P  + S  N +V+ F SD + Q            GF  T+             Q   C     S  + G I SP +P  +P +  CS+  + ++ + + + F +  L    D  C    V ++ G  E    +    CG      +++  N     F         + +       +   + + G N                                    SG + SP YP +   N  CTY +      N +   +L F + ++        S  +  ++ IR + V             +P   +CG +      +T  GP VLL   ++   +         + FK  Y I         C  V+N S   SG+I SP ++   YP++  C Y I  +++  I + F +F +            + +++C  D++ +      G   S P+   F CGS  P P +  S +NS+ L F +DS Q+  G+   +     P Q    +  G N  +     +  SN     Y  NL C W + A   +  I + F+ F  E +   Q C    +++YDGDS  A  +   CG  S +PA FIS+ N + ++FI+
Sbjct: 2692 IQIGDSGVITSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTT-CAWDSVTVR-NGGSPESPI-----IGQYCGNS---NPRTIQSGSNQLVVTFNSDHSLQGG----------GFYATWN-----------TQTLGCGGIFHS--DNGTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLATGCGNVAPGPVITPSNTFTAVF---------QSQEAPAQGFSASFVSRCGSNFT--------------------------------GPSGYIISPNYPKQYDNNMNCTYVI----EANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVM-----------STPFATVCGDEMP--APLTIAGP-VLLNFYSNEQITD--------FGFKFSYRIIS-------CGGVFNFS---SGIITSPAYSYADYPNDMHCLYTITVSDDKVIELKFSDFDV------------VPSTSCSHDYLAIY----DGANTSDPLLGKF-CGSKRP-PNVKSS-NNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSN--NTFASPDSDSNGM---YDKNLNCVWIIIA-PVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCG--STVPAPFISSGNFLTVQFIS 3258          

HSP 9 Score: 81.6481 bits (200), Expect = 8.988e-15
Identity = 166/724 (22.93%), Postives = 268/724 (37.02%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI---ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSV-QSHSGFYAQYDFIPIQDIINHKCGENIISEIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAI-PAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            QSP  P  YP  I C +  + +    + + FE F++E     C  D+L++Y +  S  S       LGR+CG +   +P  + S  N ++L F +D +          +   GF   ++ I  A          +C    D   + G  TSP +P  YP++  C Y +     + I + F +  L     +   D + I DG  E SP++G  F G      I+S  N L ++F +     RS                  GF+  +  S                 T C   + +S   SG   SP YP+    +  C ++L   H         L+F+  ++   P+  C+   L++Y                  P S   +   +CG +         K PL+          SSG   F+   T +   G   K      C  V  ++ T  G++ S  +   Y  N  C + I     + +   F  F L          H +    C  D++ +            P +    CG  +P P    + S+ + +  ++D V +   GF  Q+ F+       + CG     E+ G  G+ +S  +P  Y  N  C W ++  D  + I +  HDF  E  H  C   +L IY G  F +   ++LC   S   P  + ST N + + F T     G +GF   W  +      G C G
Sbjct:  944 QSPGHPNVYPHGINCTWHILVQPNHLIHLMFETFHLE-FHYNCTNDYLEVY-DTDSETS-------LGRYCGKS---IPPSLTSSGNSLMLVFVTDSD----------LAYEGFLINYEAISAA---------TAC--LQDYTDDLGTFTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGI-FYGSNLPPTIISHSNKLWLKFKSDQIDTRS------------------GFSAYWDGS----------------STGCGGNLTTS---SGTFISPNYPMPYYHSSECYWWLKSSHG----SAFELEFKDFHLEHHPN--CTLDYLAVYD----------------GPSSNSHLLTQLCGDE---------KPPLIR---------SSGDSMFIKLRTDEGQQGRGFKAEYRQTCENVVIVNQTY-GILESIGYPNPYSENQHCNWTIRATTGNTVNYTFLAFDLE---------HHIN---CSTDYLELYDG---------PRQMGRYCGVDLPPP--GSTTSSKLQVLLLTDGVGRREKGFQMQW-FV-------YGCG----GELSGATGSFSSPGFPNRYPPNKECIWYIRT-DPGSSIQLTIHDFDVE-YHSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSING-RGFNASWQAVT-----GGCGG 1512          

HSP 10 Score: 78.5666 bits (192), Expect = 8.454e-14
Identity = 64/245 (26.12%), Postives = 105/245 (42.86%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLK-ILSTRNMLLIRFITGDFIKR 1247
             +SP +P  Y  +  C     A     + + F    IE  +  C  DFL++     S      N+  LG++CG  L   PN V S +N + L F SD + + + Y         G  GT                           + G  TSP YPG YP++  C ++LV      + + F  + ++   D C+++++T+YDG   SSP  G P+CG    +   +++ N + I+F   D+ +R
Sbjct: 3406 LRSPGWPDNYDNDKDCTVTLTAPQNHTISLFFHSLGIENSVE-CRNDFLEVRNGSNS------NSPLLGKYCGTLL---PNPVFSQNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLY------------------------GDRGSFTSPGYPGTYPNNTYCEWVLVAPAGRLVTINFYFISIDDPGD-CVQNYLTLYDGPNASSPSSG-PYCGGDTSIAPFVASSNQVFIKF-HADYARR 3613          

HSP 11 Score: 78.1814 bits (191), Expect = 1.215e-13
Identity = 61/244 (25.00%), Postives = 110/244 (45.08%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            +    + +SP FP  YP    C++       + +++NF  F I G    C  D    Y+E+ S  S++  +    ++CG     +P+F+ S++N + + F    +T+            GF   F   ++A      E               G I SP +P +YP  +NC++ ++      I L+F    L  H N  C  D++ +YD D+E+S  +G+ +CG+     + S+ N L++ F+T
Sbjct:  821 LTGEGVIRSPFFPNVYPGERTCRWTIHQPQSQVILLNFTVFEI-GSSAHCETD----YVEIGS--SSILGSPENKKYCG---TDIPSFITSVYNFLYVTFVKSSSTENH----------GFMAKFSAEDLACGEILTEST-------------GTIQSPGHPNVYPHGINCTWHILVQPNHLIHLMFETFHLEFHYN--CTNDYLEVYDTDSETS--LGR-YCGKSIPPSLTSSGNSLMLVFVT 1026          

HSP 12 Score: 77.7962 bits (190), Expect = 1.450e-13
Identity = 81/286 (28.32%), Postives = 127/286 (44.41%), Query Frame = 3
Query: 1788 IYYTFKRDYGIEGKMVEPGVCHFVYNISS----TKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWSEI 2630
            ++  FK D  +E           VY ++     T  GVI SPFF  +YP   TC++ I    +  I + F  F +              ++ CE D+V    +I    I+  P E    CG+ +P  +   S  N + +TF+  S   + GF A++     +D+    CGE I++E   G I S  +P  Y   + C W +     ++ I + F  F  E  H +C N  L +YD DS  +    CG  S  P+  S+ N++ L F+T S  AY  +GF + +  I
Sbjct:  794 VWIRFKIDASVEKASFRA-----VYQVACGDELTGEGVIRSPFFPNVYPGERTCRWTIHQPQSQVILLNFTVFEIG------------SSAHCETDYV----EIGSSSILGSP-ENKKYCGTDIPSFIT--SVYNFLYVTFVKSSSTENHGFMAKFS---AEDL---ACGE-ILTE-STGTIQSPGHPNVYPHGINCTWHILV-QPNHLIHLMFETFHLE-FHYNCTNDYLEVYDTDSETSLGRYCG-KSIPPSLTSSGNSLMLVFVTDSDLAY--EGFLINYEAI 1042          

HSP 13 Score: 75.0998 bits (183), Expect = 8.870e-13
Identity = 67/248 (27.02%), Postives = 113/248 (45.56%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            G + SP +   Y ++  C   +    NH I ++F    + E+ V+           C  DF+ V      G   + P+   + CG+ +P P+ S  ++N + L F SDSV S  G+   +   P        CG  +  +   G+ TS  YP  Y +N  C+W + A  +   + I+F+ F++      C  + L +YDG   S  +S   CG D++I  F+++SN V ++F  +  A     F+L W
Sbjct: 3404 GNLRSPGWPDNYDNDKDCTVTLTAPQNHTISLFFHSLGI-ENSVE-----------CRNDFLEV----RNGSNSNSPLLGKY-CGTLLPNPVFS--QNNELYLRFKSDSVTSDRGYEIIWTSSP------SGCGGTLYGDR--GSFTSPGYPGTYPNNTYCEWVLVA-PAGRLVTINFY-FISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSNQVFIKF-HADYARRPSAFRLTW 3621          

HSP 14 Score: 63.1586 bits (152), Expect = 4.655e-9
Identity = 59/223 (26.46%), Postives = 98/223 (43.95%), Query Frame = 3
Query:  498 GVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFC 1166
            G+N    ++SP+    Y  ++ C +    +  + + I F  F +E +   C  +FL +Y    S      +A  LGRFCG +L   P+ ++S  N +    YS+           H+   G   T ++         + Q+  C   +      G I SP YPG YP   +C +++V +    +   F  L L H  DDC +D++ I DG     P++G+ FC
Sbjct:  480 GINGSFSYRSPDV--GYVHDVNCFWVIKTEMGKVLRITFTFFRLESM-DNCPHEFLQVYDGDSS------SAFQLGRFCGSSL---PHELLSSDNALYFHLYSE-----------HL-RNGRGFTVRW---------ETQQPECGGILTGPY--GSIKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHH-DDCNKDYLEIRDGPLYQDPLLGK-FC 665          
BLAST of Cubilin vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 111.694 bits (278), Expect = 4.786e-24
Identity = 73/273 (26.74%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQ----SYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKE-------------EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKL 1292
            +P +P++YPPN  C +Q VA +Q ++ + FE F +EG    C  D+++++  + S       +K  G+FCG     VP  + S  N + ++F SD    +    ++   D       NG  +   +  + S   Q  +     D+K +              G ITSP +P  YPS   C++ +      RI+L F + ++  Q+ +C  DH+ ++DG+TE SPI+G+  CG K    +++T N + +RF++   ++R   ++    +   +L
Sbjct:  654 TPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEV-CKYDYVEIWSGLSS------ESKLHGKFCGA---EVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEI-EQHQECAYDHLEVFDGETEKSPILGR-LCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRL 914          

HSP 2 Score: 85.1149 bits (209), Expect = 6.459e-16
Identity = 132/639 (20.66%), Postives = 237/639 (37.09%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIE-----GLLPGCNKDFLDLY--IE---------MKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------YNQDDHMG----------LLGFNGTFKFIEIAPINSTKEQKESCHFYIDS--KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVD----YVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIG-GFVIYYTFKRDYGIEGKMVEP---GVCHFVYNISSTKSGVIN-SPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            N    QSPN+P  Y P   C ++        V + F+ F  E     G+     +  + ++  IE         ++  + T  N+  +GRFCG+     P  + S  N + + F SD    ++      + ++D              L   G+++     P       + SC         K  G IT+P +P  YP + NC + +V   + RI + F   +L   N+ C  D+V I+ G +  S + G+ FCG +    I S  N + I F + + + +   ++      DE   +    Q +  N +  +       +V   N   K+     EC+  I S    SG++ SP +P + P  K CT+                      I  TP ++          I+  F + EI   +           C  D+ E+ +   +   +L RL  +      +  G  ++  F  D  ++ K  +      C       S    + + + F +  YP    C++ ++     R+ + FQ F + E+            + C  D+V +   +      S  +     CGS  P  +   S  +S+ + F +D   +  GF+ +Y  I   D  + K
Sbjct:  469 NEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYD---KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQ-CACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFEL-EGNEVCKYDYVEIWSGLSSESKLHGK-FCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDN---KHDCKEAECEQKIHSP---SGLITSPNWPDKYPSRKECTW---------------------EISATPGHR----------IKLAFSEFEIEQHQE----------CAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEE------------ADCGYDYVELFDGLD-----STAVGLGRFCGSGPPEEIY--SIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTK 1035          

HSP 3 Score: 83.1889 bits (204), Expect = 2.558e-15
Identity = 79/354 (22.32%), Postives = 137/354 (38.70%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQ----------------------NDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE---CDMWIKS-SEKTSGILKSPGYPVRTPKNKLCTY 1484
              SP FP  YP    C ++      EK+V+NF   ++        K  L  Y  ++  +     +  LGRFCG   D +P  + S  + + ++F S  N              GF   ++ I    I                +K EG I SP YP  Y     C + +  ++   + L F+  +  HQ                      +D+C  D++ + DG +E+SP+IG+ FCG      I ST N L ++F++   + ++        E  +  K +    +++  N +  +           E  + +G +   C+        K +G + +PG+P   P NK C +
Sbjct:  360 LSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL-------YKSSLCWYDYIEVRDGYWRKSPLLGRFCG---DKLPEVLTSTDSRMWIEFRSSSNWVGK----------GFAAVYEAICGGEI----------------RKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGR-FCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQC-------ACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVW 669          

HSP 4 Score: 68.9366 bits (167), Expect = 6.227e-11
Identity = 69/266 (25.94%), Postives = 115/266 (43.23%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG-DSFQAS-SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD 2648
            SG+I SP +   YPS   C ++I     HRI++ F EF + +            +  C  D + V   +  K PI+ +      LCG+ +P PL+  +  N + + F+SD+     GF A +         + +CG  + +E +  ++ S      N YP      + C+W + + +  +R+ + F  F  E     C    + ++DG DS        CG  S  P  I S  ++V + F T      +KGF + +  I  R PD
Sbjct:  805 SGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQ------------HQECAYDHLEVFDGETEKSPILGR------LCGNKIPDPLV--ATGNKMFVRFVSDASVQRKGFQATH---------STECGGRLKAESKPRDLYSHAQFGDNNYP----GQVDCEWLLVS-ERGSRLELSFQTFEVE-EEADCGYDYVELFDGLDSTAVGLGRFCG--SGPPEEIYSIGDSVLIHFHTD-DTINKKGFHIRYKSI--RYPD 1030          

HSP 5 Score: 56.225 bits (134), Expect = 4.973e-7
Identity = 37/132 (28.03%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  948 KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF------ITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYR 1325
            ++  G ++SP +P  YPS+ +C + +     E+I L F  +DL +++  C  D++ + DG    SP++G+ FCG+K    + ST + + I F      +   F        G EI+ N   +Q   +   YR
Sbjct:  354 QESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL-YKSSLCWYDYIEVRDGYWRKSPLLGR-FCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYR 483          

HSP 6 Score: 54.299 bits (129), Expect = 1.713e-6
Identity = 67/292 (22.95%), Postives = 116/292 (39.73%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSED---GVKRQKYHSL--------KNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQ----------------------------------YDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTS-NTVHLEFITSPKAYGQKGFK 2612
            G I SP +   Y     C + I  + ++ + + FQ F        G+  +   SL        ++  C  D++ V     +  P+I +       CG   P  +   S SN++ + F+SD   + +GF A                                   Y+  P +      CG  +++++ G  IT+  +P+EY  N  C W V A  +  RI + F  F  EG ++ C    + I+ G S ++    + CG +  +P  I++  N + +EF  S     +KGFK
Sbjct:  471 GQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGR------FCGYDKPEDI--RSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACG-GLLTKLNG-TITTPGWPKEYPPNKNCVWQVVA-PTQYRISVKFEFFELEG-NEVCKYDYVEIWSGLSSESKLHGKFCGAE--VPEVITSQFNNMRIEF-KSDNTVSKKGFK 747          

HSP 7 Score: 53.5286 bits (127), Expect = 3.179e-6
Identity = 71/262 (27.10%), Postives = 102/262 (38.93%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGS----------------------HQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            +G ++SP F   YPS T C + +      +I + F    L             K+S C  D++ V      K P++ +       CG  +P  L S DSR   + + F S S     GF A Y+ I         CG     EIR   G I S  YP +YR    C W +   +S + + + F  F  E                        H +CA   L + DG S  +      CG D   P  I STSNT+ ++F++
Sbjct:  357 NGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL------------YKSSLCWYDYIEVRDGYWRKSPLLGR------FCGDKLPEVLTSTDSR---MWIEFRSSSNWVGKGFAAVYEAI---------CG----GEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYH-VGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDK--PEDIRSTSNTLWMKFVS 581          
BLAST of Cubilin vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 111.309 bits (277), Expect = 5.515e-24
Identity = 73/273 (26.74%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQ----SYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKE-------------EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKL 1292
            +P +P++YPPN  C +Q VA +Q ++ + FE F +EG    C  D+++++  + S       +K  G+FCG     VP  + S  N + ++F SD    +    ++   D       NG  +   +  + S   Q  +     D+K +              G ITSP +P  YPS   C++ +      RI+L F + ++  Q+ +C  DH+ ++DG+TE SPI+G+  CG K    +++T N + +RF++   ++R   ++    +   +L
Sbjct:  631 TPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEV-CKYDYVEIWSGLSS------ESKLHGKFCGA---EVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEI-EQHQECAYDHLEVFDGETEKSPILGR-LCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRL 891          

HSP 2 Score: 93.5893 bits (231), Expect = 1.822e-18
Identity = 133/623 (21.35%), Postives = 234/623 (37.56%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------YNQDDHMG----------LLGFNGTFKFIEIAPINSTKEQKESCHFYIDS--KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVD----YVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIG-GFVIYYTFKRDYGIEGKMVEP---GVCHFVYNISSTKSGVIN-SPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            N    QSPN+P  Y P   C ++        V + F+ F IE     C  D+L++       + T  N+  +GRFCG+     P  + S  N + + F SD    ++      + ++D              L   G+++     P       + SC         K  G IT+P +P  YP + NC + +V   + RI + F   +L   N+ C  D+V I+ G +  S + G+ FCG +    I S  N + I F + + + +   ++      DE   +    Q +  N +  +       +V   N   K+     EC+  I S    SG++ SP +P + P  K CT+                      I  TP ++          I+  F + EI   +           C  D+ E+ +   +   +L RL  +      +  G  ++  F  D  ++ K  +      C       S    + + + F +  YP    C++ ++     R+ + FQ F + E+            + C  D+V +   +      S  +     CGS  P  +   S  +S+ + F +D   +  GF+ +Y  I   D  + K
Sbjct:  469 NEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEIE-RHDNCAYDYLEV------RDGTSENSPLIGRFCGYD---KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQ-CACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFEL-EGNEVCKYDYVEIWSGLSSESKLHGK-FCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDN---KHDCKEAECEQKIHSP---SGLITSPNWPDKYPSRKECTW---------------------EISATPGHR----------IKLAFSEFEIEQHQE----------CAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEE------------ADCGYDYVELFDGLD-----STAVGLGRFCGSGPPEEIY--SIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTK 1012          

HSP 3 Score: 88.1965 bits (217), Expect = 7.752e-17
Identity = 77/332 (23.19%), Postives = 137/332 (41.27%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE---CDMWIKS-SEKTSGILKSPGYPVRTPKNKLCTY 1484
              SP FP  YP    C ++      EK+V+NF   ++        K  L  Y  ++  +     +  LGRFCG   D +P  + S  + + ++F S  N              GF   ++ I    I                +K EG I SP YP  Y     C + +  ++   + L F+  ++  ++D+C  D++ + DG +E+SP+IG+ FCG      I ST N L ++F++   + ++        E  +  K +    +++  N +  +           E  + +G +   C+        K +G + +PG+P   P NK C +
Sbjct:  360 LSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL-------YKSSLCWYDYIEVRDGYWRKSPLLGRFCG---DKLPEVLTSTDSRMWIEFRSSSNWVGK----------GFAAVYEAICGGEI----------------RKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEI-ERHDNCAYDYLEVRDGTSENSPLIGR-FCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQC-------ACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVW 646          

HSP 4 Score: 68.9366 bits (167), Expect = 6.496e-11
Identity = 69/266 (25.94%), Postives = 115/266 (43.23%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG-DSFQAS-SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD 2648
            SG+I SP +   YPS   C ++I     HRI++ F EF + +            +  C  D + V   +  K PI+ +      LCG+ +P PL+  +  N + + F+SD+     GF A +         + +CG  + +E +  ++ S      N YP      + C+W + + +  +R+ + F  F  E     C    + ++DG DS        CG  S  P  I S  ++V + F T      +KGF + +  I  R PD
Sbjct:  782 SGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQ------------HQECAYDHLEVFDGETEKSPILGR------LCGNKIPDPLV--ATGNKMFVRFVSDASVQRKGFQATH---------STECGGRLKAESKPRDLYSHAQFGDNNYP----GQVDCEWLLVS-ERGSRLELSFQTFEVE-EEADCGYDYVELFDGLDSTAVGLGRFCG--SGPPEEIYSIGDSVLIHFHTD-DTINKKGFHIRYKSI--RYPD 1007          

HSP 5 Score: 62.3882 bits (150), Expect = 6.071e-9
Identity = 71/240 (29.58%), Postives = 102/240 (42.50%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            +G ++SP F   YPS T C + +      +I + F    L             K+S C  D++ V      K P++ +       CG  +P  L S DSR   + + F S S     GF A Y+ I         CG     EIR   G I S  YP +YR    C W +   +S + + + F  F  E  H +CA   L + DG S  +      CG D   P  I STSNT+ ++F++
Sbjct:  357 NGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL------------YKSSLCWYDYIEVRDGYWRKSPLLGR------FCGDKLPEVLTSTDSR---MWIEFRSSSNWVGKGFAAVYEAI---------CG----GEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYH-VGLTFQSFEIE-RHDNCAYDYLEVRDGTSENSPLIGRFCGYDK--PEDIRSTSNTLWMKFVS 558          

HSP 6 Score: 56.225 bits (134), Expect = 5.112e-7
Identity = 37/132 (28.03%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  948 KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF------ITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYR 1325
            ++  G ++SP +P  YPS+ +C + +     E+I L F  +DL +++  C  D++ + DG    SP++G+ FCG+K    + ST + + I F      +   F        G EI+ N   +Q   +   YR
Sbjct:  354 QESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL-YKSSLCWYDYIEVRDGYWRKSPLLGR-FCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYR 483          

HSP 7 Score: 54.299 bits (129), Expect = 1.885e-6
Identity = 64/281 (22.78%), Postives = 112/281 (39.86%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQ----------------------------------YDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTS-NTVHLEFITSPKAYGQKGFK 2612
            G I SP +   Y     C + I  + ++ + + FQ F +             ++  C  D++ V     +  P+I +       CG   P  +   S SN++ + F+SD   + +GF A                                   Y+  P +      CG  +++++ G  IT+  +P+EY  N  C W V A  +  RI + F  F  EG ++ C    + I+ G S ++    + CG +  +P  I++  N + +EF  S     +KGFK
Sbjct:  471 GQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEIE------------RHDNCAYDYLEVRDGTSENSPLIGR------FCGYDKPEDI--RSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACG-GLLTKLNG-TITTPGWPKEYPPNKNCVWQVVA-PTQYRISVKFEFFELEG-NEVCKYDYVEIWSGLSSESKLHGKFCGAE--VPEVITSQFNNMRIEF-KSDNTVSKKGFK 724          
BLAST of Cubilin vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 104.375 bits (259), Expect = 8.035e-22
Identity = 87/369 (23.58%), Postives = 159/369 (43.09%), Query Frame = 3
Query:  435 CLTNYVVYALDCDIIYYSDKIGVNNRRM--------------FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQ----SYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKE-------------EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGI 1430
            CL     Y   CD  Y   ++  + RR                 SP +P++YPPN  C +Q VA +Q ++ + F+ F  EG    C  DF+++   + +      ++K  G+FCG      P  + S +N + ++F SD    +    ++   D       NG  +   +    S + Q  S     D+K +              G ITSP +P  YPS   C++ +      R++L F ++D+  Q  +C  DH+ ++DG    +P++G+ FCG K    +L+T + + +RF + + ++R         E G +++ + K             + D        + N+  G +C+ W+  +E+  G+
Sbjct:  563 CLNTLGSYKCSCDPGY---ELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGN-DVCKYDFVEVRSGLTA------DSKLHGKFCG---SEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQ-PECAYDHLEVFDGRDAKAPVLGR-FCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHATECGGQVRADVK-------------TKDLYSHAQFGDNNYPGGVDCE-WVIVAEEGYGV 902          

HSP 2 Score: 102.449 bits (254), Expect = 3.335e-21
Identity = 143/618 (23.14%), Postives = 244/618 (39.48%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------YNQDDHMG----------LLGFNGTFKF-----IEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVD----YVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIE-GKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            QSPN+P  Y P+  C ++        V + F+ F IE     C  D+L++  +  S  STL     +GR+CG+     P+ + S  + + L F SD +  ++      + + D              L   G++K       E+AP    +  + +C  ++   K  G ITSP +P  YP + NC + LV   + RI L F D      ND C  D V +  G T  S + G+ FCG EKP++ I S  N + + F + + + +   ++      DE   +    Q+   N    +       +V   N   K+      CD  + S   TSG + SP +P + P  K CT+ +    +        L F  ++I   P+  C+   L ++  R     +  R              CG+  ++ + +   G  + LR  + N+        V    F+  +  E G  V   V         TK    ++ F +  YP    C++ I+    + + + FQ F + E+            + C  D++ +          S        CGS  P  +   S  +S+ + F SD   +  GF+ +Y     QD ++ +
Sbjct:  447 QSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIE-RHDSCAYDYLEVR-DGHSESSTL-----IGRYCGY---EKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAP--DKRRCEAACGGFL--TKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQF-DFFETEGNDVCKYDFVEVRSGLTADSKLHGK-FCGSEKPEV-ITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDN---KHDCKEAGCDHKVTS---TSGTITSPNWPDKYPSKKECTWAI----SSTPGHRVKLTFMEMDIESQPE--CAYDHLEVFDGRDAKAPVLGR-------------FCGS--KKPEPVLATGSRMFLRFYSDNS--------VQRKGFQASHATECGGQVRADV--------KTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEE------------TDCGYDYMELFDGYD-----STAPRLGRYCGSGPPEEVY--SAGDSVLVKFHSDDTITKKGFHLRYTSTKFQDTLHSR 985          

HSP 3 Score: 78.9518 bits (193), Expect = 5.492e-14
Identity = 74/330 (22.42%), Postives = 135/330 (40.91%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFL 1490
            F SP +P  Y  ++ C ++      EK+++NF   ++        +  L  Y  ++  +     A   GRFCG  L   P  +VS  + + ++F S  N              GF   ++ I                   D KK+ G+I SP YP  Y     C + +  ++   + L F+  ++  ++D C  D++ + DG +ESS +IG+ +CG +    I ST + L ++F++   I ++        E  +  + N    +++  N +  +                    C  ++    K +G + SPG+P   P NK C + L
Sbjct:  333 FSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDL-------YRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKL---PEPIVSTDSRLWVEFRSSSNWVGK----------GFFAVYEAICGG----------------DVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEI-ERHDSCAYDYLEVRDGHSESSTLIGR-YCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLT---KLNGSITSPGWPKEYPPNKNCIWQL 621          

HSP 4 Score: 60.4622 bits (145), Expect = 2.259e-8
Identity = 64/237 (27.00%), Postives = 105/237 (44.30%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            +G  +SP +   Y ++  C + I      +I + F    L             ++  C  D+V V      G     P+   F CGS +P P++S DSR   + + F S S     GF+A Y+ I         CG ++  +   G+I S  YP +YR + +C W ++  +  + + + F  F  E  H SCA   L + DG S  ++     CG +   P  I STS+ + L+F++
Sbjct:  330 TGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDL------------YRSRLCWYDYVEVRD----GFWRKAPLRGRF-CGSKLPEPIVSTDSR---LWVEFRSSSNWVGKGFFAVYEAI---------CGGDVKKDY--GHIQSPNYPDDYRPSKVCIWRIQVSEGFH-VGLTFQSFEIE-RHDSCAYDYLEVRDGHSESSTLIGRYCGYEK--PDDIKSTSSRLWLKFVS 531          

HSP 5 Score: 54.299 bits (129), Expect = 1.566e-6
Identity = 31/88 (35.23%), Postives = 49/88 (55.68%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            G  +SP YP  Y +H++C + +     E+I L F  LDL +++  C  D+V + DG    +P+ G+ FCG K    I+ST + L + F
Sbjct:  331 GNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDL-YRSRLCWYDYVEVRDGFWRKAPLRGR-FCGSKLPEPIVSTDSRLWVEF 416          

HSP 6 Score: 54.299 bits (129), Expect = 1.903e-6
Identity = 59/264 (22.35%), Postives = 103/264 (39.02%), Query Frame = 3
Query: 1860 YNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            + ++ST SG I SP +   YPS   C + I     HR+++ F E  +                 C  D + V   +  K P++ +       CGS  P P++  +  + + L F SD+     GF A +           +CG  + ++++  ++ S      N YP      + C+W + A +    + + F  F  E     C    + ++DG    A      CG  S  P  + ++    L    S     +KGF L ++
Sbjct:  749 HKVTST-SGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIE------------SQPECAYDHLEVFDGRDAKAPVLGR------FCGSKKPEPVL--ATGSRMFLRFYSDNSVQRKGFQASH---------ATECGGQVRADVKTKDLYSHAQFGDNNYP----GGVDCEWVIVA-EEGYGVELVFQTFEVE-EETDCGYDYMELFDGYDSTAPRLGRYCG--SGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYT 974          
BLAST of Cubilin vs. Ensembl Human
Match: TLL2 (tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844])

HSP 1 Score: 94.3597 bits (233), Expect = 8.202e-19
Identity = 71/265 (26.79%), Postives = 123/265 (46.42%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQ----SYNQDDHMGLLGFNGTFKFIEIAPI---------------NSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES 1262
            SP +P++YP N  C +Q VA +Q ++ + FE F +EG    C  DF    +E++S  S   +AK  GRFCG      P  + S  N + ++F SD    +    ++   D       NG  +   +                  N    ++  C   I S   EG + SP +P  YPS   C++ +      R++L F + ++  Q+ +C  DH+ +YDG    +PI+G+ FCG K     +++ + + +RF +   ++R   ++
Sbjct:  633 SPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-CKYDF----VEVRSGLSP--DAKLHGRFCG---SETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSV--EGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIE-QHQECAYDHLEMYDGPDSLAPILGR-FCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQA 883          

HSP 2 Score: 92.0485 bits (227), Expect = 4.979e-18
Identity = 74/243 (30.45%), Postives = 107/243 (44.03%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
              SPN+P KYP    C +   + +  +V + F  F IE     C  D L++Y    SL      A  LGRFCG      P+  V+  + + L FYSD + Q+   Q  H    G  G  K  E+     TKE      F  ++               YPS   C +++V      + L FR  ++  +  DC  D++  YDG   S+P +G+ FCG  P  +I S  + L+IRF T D I +
Sbjct:  787 LASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQE-CAYDHLEMYDGPDSL------APILGRFCG---SKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECG--GRLK-AEV----QTKELYSHAQFGDNN---------------YPSEARCDWVIVAEDGYGVELTFRTFEVEEEA-DCGYDYMEAYDGYDSSAPRLGR-FCGSGPLEEIYSAGDSLMIRFRTDDTINK 995          

HSP 3 Score: 88.1965 bits (217), Expect = 8.029e-17
Identity = 137/617 (22.20%), Postives = 230/617 (37.28%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------------YNQDDHMG----LLGFNGTFKFIEIAPINSTKEQKESCHFYIDS--KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIG-TECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI------ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            QSPN+P  Y P+  C ++        V + F+ F IE     C  D+L++  +  + ES L     +G FCG+     P  V S  N + + F SD +  ++             +  DH G     +   G++K     P       K+ C         K  G ITSP +P  YP++ NC + +V   + RI L F   +L   ND C  D V +  G +  + + G+ FCG +    I S  N + + F + + + +    +      DE   +    Q +  N    +           E  H      C   I S E   G L SP +P + P  + CT+ +    +        L F    I      +C+   L +Y                   D PD +       CG+  ++       G  + LR  +  +      GF   ++ +    ++ ++              TK    ++ F +  YPS   C + I+  + + + + F+ F + E+            + C  D++        G   S P    F CGS   GPL    S  +S+ + F +D   +  GF+A+Y     QD ++ K
Sbjct:  476 QSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIE-RHDSCAYDYLEVR-DGPTEESAL-----IGHFCGY---EKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYK-CACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELE-GNDVCKYDFVEVRSGLSPDAKLHGR-FCGSETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVE---GTLASPNWPDKYPSRRECTWNI----SSTAGHRVKLTFNEFEI--EQHQECAYDHLEMY-------------------DGPDSLAPILGRFCGS--KKPDPTVASGSSMFLRFYSDASVQR--KGFQAVHSTECGGRLKAEV-------------QTKELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRTFEVEEE------------ADCGYDYMEAYD----GYDSSAPRLGRF-CGS---GPLEEIYSAGDSLMIRFRTDDTINKKGFHARYTSTKFQDALHMK 1014          

HSP 4 Score: 63.5438 bits (153), Expect = 2.558e-9
Identity = 66/266 (24.81%), Postives = 104/266 (39.10%), Query Frame = 3
Query: 1836 EPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
            E G  H +    S+  G + SP +   YPS   C ++I     HR+++ F EF + +            +  C  D + +      GP    PI   F CGS  P P ++    +S+ L F SD+     GF         Q + + +CG  + +E++   + S      N YP E R    C W + A D    + + F  F  E     C    +  YDG    A      CG+   +    S  +++ + F T      +KGF
Sbjct:  773 EAGCAHKI----SSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQ------------HQECAYDHLEMYD----GPDSLAPILGRF-CGSKKPDPTVAS--GSSMFLRFYSDASVQRKGF---------QAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSEAR----CDWVIVAEDGYG-VELTFRTFEVE-EEADCGYDYMEAYDGYDSSAPRLGRFCGS-GPLEEIYSAGDSLMIRFRTD-DTINKKGF 998          

HSP 5 Score: 60.8474 bits (146), Expect = 1.829e-8
Identity = 62/238 (26.05%), Postives = 103/238 (43.28%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            +G  ++P F   YPS + C + I      +I + F    L             K+  C  D+V V      K P++ +       CG  +P PL+S DSR   + + F S S     GF+A Y+           CG ++  +   G I S  YP +YR +  C W +   +  + + + F  F  E  H SCA   L + DG + +++     CG +   P  + S+SN + ++F++
Sbjct:  359 TGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDL------------FKSRLCWYDYVEVRDGYWRKAPLLGR------FCGDKIPEPLVSTDSR---LWVEFRSSSNILGKGFFAAYEAT---------CGGDMNKD--AGQIQSPNYPDDYRPSKECVWRITVSEGFH-VGLTFQAFEIE-RHDSCAYDYLEVRDGPTEESALIGHFCGYEK--PEDVKSSSNRLWMKFVS 560          

HSP 6 Score: 52.373 bits (124), Expect = 7.194e-6
Identity = 37/145 (25.52%), Postives = 67/145 (46.21%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF------ITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHI 1376
            G  ++P +P  YPS+ +C + +     E+I L F  +DL  ++  C  D+V + DG    +P++G+ FCG+K    ++ST + L + F      +   F        G ++  +   +Q   +   YR S + V      E  H+
Sbjct:  360 GNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDL-FKSRLCWYDYVEVRDGYWRKAPLLGR-FCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHV 502          
BLAST of Cubilin vs. Ensembl Celegans
Match: lev-10 (LEV-10B [Source:UniProtKB/TrEMBL;Acc:G5EER3])

HSP 1 Score: 291.582 bits (745), Expect = 2.556e-83
Identity = 233/813 (28.66%), Postives = 380/813 (46.74%), Query Frame = 3
Query:  498 GVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLG---FNGTFKFIEIAPINSTKEQKESCHFYIDSKKEE-GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEK----NHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQT---LNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRP--QKLVLPDSPDQIICGTDYREI-------KEITCKGPLVLLRLNTSNAFSSGIG--GFVIYYTFKRDYGIEGK-MVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPI--QDIIN---------HKCGE--NIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEG----SHQSCANSILRIYDGDSFQASSELCGTDSA-IPAFISTSNTVHLEFITSP-KAYGQKGFKLIWSEI--LQRLPDGSCPG---FECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEH 2795
            GVNN +        Q+Y  N++C Y FVA S+++V + F+HF + G    C+ +++D+Y E++S++  + ++   GR+CG    HV    +SL  ++ L  +S     +S N +D+ G      F    KFI   P+   K     C F IDS   + G + SPTYPG YP +++CSYL+   + ERIRL F D D+    + C  D VTI+DG T +SPII +  CG + ++++ S  N LLI F T                 +P     +GF + Y FS  +V I   + K     HI GTECD+ ++S+ +T   + SP YP   P N  CTY ++G+     +E  +L F +   L+   +P     +  +   +    +V + I     K V+  + D     T    I            +GP ++++  ++      I   GF     FK D+G+ G+ +     C F +   ++ +G  NSP +   YP +T C Y I+G     I ++F++F+LS +           ++ C  D++ V     K        +  + C  + PGP +S   S+ + + F S S  + +GF A ++      +D+           ++CG   N  SE   G I S  YP +Y  ++ C W +       ++++       EG    +  SC  +++R+  G      SE CGT      A++S SN+V + F+T+P K  G KGF L W+E+  L    +  C     + C  +K CI  +L C+G+ +CG   G Q        DD+DE+H
Sbjct:   54 GVNNSKP------EQQY--NLQCVYTFVAGSRQRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVR---ISLRRVMKLVLHS-----RSTNHEDNHGFRAKYSFIPEDKFIAGEPVGGKK-----CSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDSVTIFDGPTPASPII-RKVCGLQQRMEVYSMGNSLLIHFNT----------------THPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETFHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSADIDDIACPSAWVGIAIGEGNMKAVMSSTDDSTFDVTLCERIPPNSPLLGPYISEGPRMVMQFGSTETRDDNISPIGFKATIEFKTDFGVTGESLGTSNECKFRF---TSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSGN----------TDNNCN-DYLDVYDVFVKNGKEELRRKERY-CADTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINSTSEKPNGLIISPNYPVKYNKDVHCDWQINV-KEGYQVLLKMEAIDVEGEMTSNGASCQKAVIRVDGG----PRSEYCGTKREFFEAYLSPSNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDENVCKSDSLYLCTYSKLCIDAKLRCNGLDNCG--YGVQ--------DDTDEQH 798          
BLAST of Cubilin vs. Ensembl Celegans
Match: lev-10 (LEV-10B [Source:UniProtKB/TrEMBL;Acc:G5EER3])

HSP 1 Score: 291.582 bits (745), Expect = 8.390e-83
Identity = 233/813 (28.66%), Postives = 380/813 (46.74%), Query Frame = 3
Query:  498 GVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLG---FNGTFKFIEIAPINSTKEQKESCHFYIDSKKEE-GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEK----NHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQT---LNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRP--QKLVLPDSPDQIICGTDYREI-------KEITCKGPLVLLRLNTSNAFSSGIG--GFVIYYTFKRDYGIEGK-MVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPI--QDIIN---------HKCGE--NIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEG----SHQSCANSILRIYDGDSFQASSELCGTDSA-IPAFISTSNTVHLEFITSP-KAYGQKGFKLIWSEI--LQRLPDGSCPG---FECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEH 2795
            GVNN +        Q+Y  N++C Y FVA S+++V + F+HF + G    C+ +++D+Y E++S++  + ++   GR+CG    HV    +SL  ++ L  +S     +S N +D+ G      F    KFI   P+   K     C F IDS   + G + SPTYPG YP +++CSYL+   + ERIRL F D D+    + C  D VTI+DG T +SPII +  CG + ++++ S  N LLI F T                 +P     +GF + Y FS  +V I   + K     HI GTECD+ ++S+ +T   + SP YP   P N  CTY ++G+     +E  +L F +   L+   +P     +  +   +    +V + I     K V+  + D     T    I            +GP ++++  ++      I   GF     FK D+G+ G+ +     C F +   ++ +G  NSP +   YP +T C Y I+G     I ++F++F+LS +           ++ C  D++ V     K        +  + C  + PGP +S   S+ + + F S S  + +GF A ++      +D+           ++CG   N  SE   G I S  YP +Y  ++ C W +       ++++       EG    +  SC  +++R+  G      SE CGT      A++S SN+V + F+T+P K  G KGF L W+E+  L    +  C     + C  +K CI  +L C+G+ +CG   G Q        DD+DE+H
Sbjct:   54 GVNNSKP------EQQY--NLQCVYTFVAGSRQRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVR---ISLRRVMKLVLHS-----RSTNHEDNHGFRAKYSFIPEDKFIAGEPVGGKK-----CSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDSVTIFDGPTPASPII-RKVCGLQQRMEVYSMGNSLLIHFNT----------------THPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETFHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSADIDDIACPSAWVGIAIGEGNMKAVMSSTDDSTFDVTLCERIPPNSPLLGPYISEGPRMVMQFGSTETRDDNISPIGFKATIEFKTDFGVTGESLGTSNECKFRF---TSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSGN----------TDNNCN-DYLDVYDVFVKNGKEELRRKERY-CADTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINSTSEKPNGLIISPNYPVKYNKDVHCDWQINV-KEGYQVLLKMEAIDVEGEMTSNGASCQKAVIRVDGG----PRSEYCGTKREFFEAYLSPSNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDENVCKSDSLYLCTYSKLCIDAKLRCNGLDNCG--YGVQ--------DDTDEQH 798          
BLAST of Cubilin vs. Ensembl Celegans
Match: lev-10 (LEV-10B [Source:UniProtKB/TrEMBL;Acc:G5EER3])

HSP 1 Score: 164.851 bits (416), Expect = 4.659e-44
Identity = 113/330 (34.24%), Postives = 172/330 (52.12%), Query Frame = 3
Query:  498 GVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLG---FNGTFKFIEIAPINSTKEQKESCHFYIDSKKEE-GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEK----NHIIGTECDMWIKSSEKTSGILKSPGYPVRTP 1463
            GVNN +    P   Q+Y  N++C Y FVA S+++V + F+HF + G    C+ +++D+Y E++S++  + ++   GR+CG    HV    +SL  ++ L  +S     +S N +D+ G      F    KFI   P+   K     C F IDS   + G + SPTYPG YP +++CSYL+   + ERIRL F D D+    + C  D VTI+DG T +SPII +  CG + ++++ S  N LLI F T                 +P     +GF + Y FS  +V I   + K     HI GTECD+ ++S+ +T   + SP     TP
Sbjct:   54 GVNNSK----PE--QQY--NLQCVYTFVAGSRQRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHV---RISLRRVMKLVLHS-----RSTNHEDNHGFRAKYSFIPEDKFIAGEPVGGKK-----CSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDSVTIFDGPTPASPII-RKVCGLQQRMEVYSMGNSLLIHFNT----------------THPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETFHTISSPNSIQPTP 345          

HSP 2 Score: 62.003 bits (149), Expect = 1.221e-9
Identity = 89/348 (25.57%), Postives = 141/348 (40.52%), Query Frame = 3
Query:  879 FIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYP-------GIYPS------HLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------DGDTESSPIIGQPFCGE-KPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSP-DQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMV--EPGVCH 1853
            F+  A  NS K   + C  + D  + EG I  P+ P       G+  S      +L C Y  V   ++R+RL F    L+  +++C  ++V IY      D D  SS + G+ +CG   P ++I   R M L+          SR  + ++           GF   Y F  +   I  E     + G +C   I SS++  G L SP YP   P N  C+Y +       + E   L F   +I    ++ C   S++I+                  P SP  + +CG   R   E+   G  +L+  NT++   S   GF++ Y F   +    K++  + GV H
Sbjct:   12 FVSKADGNSRKTIFQ-CDQHFDESQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQCVYTFVAGSRQRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGR-YCGTVAPHVRISLRRVMKLV--------LHSRSTNHED---------NHGFRAKYSFIPEDKFIAGEP----VGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKA----GRGERIRLFFTDFDIFFGGEH-CPYDSVTIFD--------------GPTPASPIIRKVCGLQQR--MEVYSMGNSLLIHFNTTHPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTH 315          

HSP 3 Score: 59.3066 bits (142), Expect = 9.401e-9
Identity = 62/242 (25.62%), Postives = 100/242 (41.32%), Query Frame = 3
Query: 1926 NTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFL----CGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDII------NHKCGENIISEIRG-GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEF-ITSPKAYGQKGF 2609
            N  C Y  +  +  R+R+ F  F LS             +  C+ ++V +  ++     + + I +S L    CG+  P   IS  R   + L   S + + + GF A+Y FIP    I        KC   I S  R  G + S  YP  Y  N+ C + +KA     RI + F DF      + C    + I+DG +  +    ++CG    +  + S  N++ + F  T P     +GF
Sbjct:   65 NLQCVYTFVAGSRQRVRLEFDHFLLSG-----------SSENCDIEYVDIYSEVES---VDEDILSSALGGRYCGTVAPHVRISLRRVMKLVLHSRSTNHEDNHGFRAKYSFIPEDKFIAGEPVGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKA-GRGERIRLFFTDFDIFFGGEHCPYDSVTIFDGPTPASPIIRKVCGLQQRMEVY-SMGNSLLIHFNTTHPAKSDPRGF 290          
BLAST of Cubilin vs. Ensembl Celegans
Match: nas-39 (Zinc metalloproteinase nas-39 [Source:UniProtKB/Swiss-Prot;Acc:Q20176])

HSP 1 Score: 81.2629 bits (199), Expect = 3.944e-15
Identity = 112/447 (25.06%), Postives = 171/447 (38.26%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS-----------YNQDDHMG--------LLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHII--GTECDMWIKSSEKTSGIL--KSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYY 1796
            SPNFP+ YP +  C ++  A     + +NF  FN+EG+   C  D    Y+++   E          + CG    H      +  N + ++F SD + ++              Q+D+ G        L  +  T     I   +    ++ SC F +++    G I SP YP  YP   NCS+  V     R+ L F    +  ++  C  D V++YDG   S+ + G  FCG  P   +LS+ N L + F +   + R                  +GF   Y  S+   ++T E    HI    T  D     ++  S I+  KSPG  VR                        ++F T NI    +  C    + IY         E   ++LV         CG    E+  IT  GP +LL ++T NA      GFV  Y
Sbjct:  555 SPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYD----YVKIGDSE----------KLCGEY--HEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPA--GDINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFSSFQVE-EHAQCKYDAVSVYDGGDGSAQLAGV-FCGLAPPPLLLSSSNELYLTFSSDASVSR------------------RGFQAHYT-SLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVR------------------------IQFSTFNI--ESEEGCQYDYIEIYD------GPEATLERLV------GRFCGDTSPEV--ITSTGPELLLIMHTDNAEEE--KGFVAEY 920          

HSP 2 Score: 70.4774 bits (171), Expect = 6.977e-12
Identity = 74/267 (27.72%), Postives = 107/267 (40.07%), Query Frame = 3
Query: 1842 GVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRY--PREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSF---QASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
            G C F  N     +G INSP +   YP    C +  +    HR+ + F  F + E            ++ C+ D V V      G   S  +   F CG + P  L+S   SN + LTF SD+  S  GF A Y  +         CG  + +E   G+I S+      +Y  N  C W V+A      + I F  F  E S + C    + IYDG      +     CG  S  P  I+++    L  + +  A  +KGF   + E
Sbjct:  690 GSCFFEVN---APAGDINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFSSFQVEE------------HAQCKYDAVSVYD----GGDGSAQLAGVF-CGLAPPPLLLSS--SNELYLTFSSDASVSRRGFQAHYTSL---------CGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIE-SEEGCQYDYIEIYDGPEATLERLVGRFCGDTS--PEVITSTGPELLLIMHTDNAEEEKGFVAEYRE 922          

HSP 3 Score: 67.3958 bits (163), Expect = 6.031e-11
Identity = 137/618 (22.17%), Postives = 233/618 (37.70%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGR-----FCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFI-EIAPINSTKEQKESCH---------FYIDS------KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILST-RNMLLIRFITGDFIKRSRLESG-----DEIKMNPKLLQKKGFNVV--YRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEP---GVCHFVYNISSTKSGVIN-SPFFNQLYPSNTTCQYDIIGNNNHR-IRIYFQEFSL-SEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIP 2255
            N  +  SP +P+ YPPN  C++        +V I F +F++E      +K+   +Y  +   E    N+K  G+     FCG         +VS  N I L F+SD + Q++  +      L    T K I     +N+    K +C          F  DS      K   G I+SP +P +YP+   C + +       I L F   ++     +C  D+V I  GD+E         CGE  +  + +T RN + I F +   ++R    +      DE + +    +    N +  Y  + +   I  E + N   G+ C   + +    +G + SP YP   PK + C++          M    L F +  +      +C   ++S+Y       +L               + CG             P  LL L++SN          +Y TF  D  +  +  +     +C       ST   + + + F +  Y  N  C + +   +  R +RI F  F++ SE+G             C+ D++    +I  GP  +        CG +   P +  S    + L   +D+ +   GF A+Y   P
Sbjct:  389 NEGVIHSPKYPESYPPNSDCQWTIHVDENSQVAIEFVYFHLEQ-----HKEC--IYDRLILTEGISKNSKKDGKEMSETFCGLIEKKT---IVSKTNQISLRFFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDSTCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDYVKI--GDSEK-------LCGEYHEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGS-CFFEVNAP---AGDINSPNYPNDYPKGQNCSWHFVTTPGHRLM----LTFSSFQV--EEHAQCKYDAVSVYDGGDGSAQLA-------------GVFCGL-----------APPPLL-LSSSNE---------LYLTFSSDASVSRRGFQAHYTSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESEEG-------------CQYDYI----EIYDGPEATLERLVGRFCGDT--SPEVITSTGPELLLIMHTDNAEEEKGFVAEYREAP 924          

HSP 4 Score: 61.6178 bits (148), Expect = 3.699e-9
Identity = 67/273 (24.54%), Postives = 114/273 (41.76%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY-----DFIPIQDIINHKC-------------GENIIS-------------EIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
            GVI+SP + + YP N+ CQ+ I  + N ++ I F  F L +            +  C  D + + + I K         +   CG      ++  S++N ISL F SD+    +GF  ++     +    ++I +H C             G ++ S             +   G+I+S  +P  Y ++  C W ++A D  + I ++F  F  EG    CA   ++I D      S +LCG       F +  N V +EF +S  +  + GF
Sbjct:  391 GVIHSPKYPESYPPNSDCQWTIHVDENSQVAIEFVYFHLEQ------------HKECIYDRLILTEGISKNSKKDGKEMSETFCGLIEKKTIV--SKTNQISLRFFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDSTCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYH-IFLNFTKFNVEGMKTECAYDYVKIGD------SEKLCGEYHEALLFTTPRNRVRIEF-SSDSSVERDGF 641          
BLAST of Cubilin vs. Ensembl Celegans
Match: ZC116.3 (Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc:Q20911])

HSP 1 Score: 77.411 bits (189), Expect = 8.216e-14
Identity = 161/762 (21.13%), Postives = 292/762 (38.32%), Query Frame = 3
Query:  450 VVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVV-INFEHFNIE------GLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYI---TSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYD-GDTESSPIIGQPFCG---EKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPP--TPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRV-----IQKIPKGPIISQPIETSF--LCGSSVPGPLISDSRSNSI--SLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTE---GSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD 2648
            V +  +C  IY        N  +  SP +P  YP +I C Y      Q  V+ I F  F++       G  P C  D+L + I+  +        + L  FC    + +P   +     I L F SD    +SY   +     G  G+  F     IN        C   I+ ++  G+I   TSP +P  Y   L+C + +  +   ++ + F ++ L   + DC  D++  +D  D  ++  +G+ FCG   + P+ +I+++   LLI   T DF   S    G ++ +   L QK+G       +  +  +T+  +++                              P   LC + + G + ++ ++    +  + L  PP   P  +C   +L+IY  + FF  L           + D    GT   +I   + +   +    +      +G G  + Y     D G   K            I+S  +  +N    +Q       C++ I G     + + FQ+F++             K   C   FV +     +Q+        +P +     LCG+ VP   +S++ +  I  S   + +  QS      +Y+   I D  N     N    I+ G +TS  YP+ Y  N  C  ++++  S+ ++++ F+DF  E     +++C    L + +GDS    +  CG  S +P  + TS       + S  +    G+   +  ++    D
Sbjct: 3249 VNWEAECGAIYRL------NHGVITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAP-CEDDYLQI-IDTGT-------DRVLHTFCAS--EPMPKDALVFKGAIGLKFVSD----KSYYWMEEDNKYGRKGSKGFQLAYSIN-------KCGDNIELREGTGFITTVTSPAFPLPYTKDLDCVWNITTDPNRQLNIRFEEMKLEAFH-DCSADYIEFFDSSDIMANKTLGK-FCGTMDKIPQYRIVTSGPNLLIHMRT-DFNVNS---GGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDG---------------------------NYPPALLCGWTISGPVDSQLQIRIDGVDTEQLEYPPGDRPSPEC-IDALAIYDGQEFFSPLL----------AGDICTSGTPLPKILYTSHRHAFITFETDRD---GTGRGFNISYSIVDSDCGGWLKATNEIKTLVYKGITSDDNKEMNKERSHQ------RCRFMIQGPKTEPVIVNFQQFNIPS-----------KAGDCSDSFVEIRDVGSLQECKHPACAREPNQRKITKLCGTHVPTSHVSNTNTIQIIVSADIMPNKNQSRPSLKFEYN---ILDSCNRTIDTNT---IKSGRLTSPNYPQVYSENSTCVTNLQS--SNQKMLLVFNDFTLEEPNNVNKNCDYDYLMLKEGDS--NGTYYCG--STLPKALMTSGKDLTALLKSDHSLNHAGYDASYYTVVSERDD 3906          

HSP 2 Score: 65.4698 bits (158), Expect = 3.024e-10
Identity = 69/275 (25.09%), Postives = 118/275 (42.91%), Query Frame = 3
Query: 1869 SSTKSGVINSPFF-NQLYPSNTTCQYDIIGNNNHRIRIYFQEFSL--SEDGVKRQ----KYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDF-----VTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAY-----------GQKGFKLIWS 2624
            +S  SG I +P F ++ Y ++  C +DI     + I + F++F +  +E+  K Q    + HS + ++  GD+  + Q   K        ET  LCG  +  P   +S SN + L F +DS  +  GF   ++          +CG   I  +  G ITS  YP  Y +++ C + +   D ++ I I F DF      T      C +  L+I D  + +     C ++      +     + L+F++    Y           G KGF+L +S
Sbjct: 3131 TSGMSGTIYTPMFGDKDYENDLECVWDIQVPLGYHINLKFKDFDVETAENCAKDQLLISQEHSTRANSPNGDYYFLFQDEEK--------ETP-LCG--IEHPKDFESESNRVRLNFTTDSQTTARGFRVNWE---------AECGA--IYRLNHGVITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAPCEDDYLQIIDTGTDRVLHTFCASEPMPKDALVFKGAIGLKFVSDKSYYWMEEDNKYGRKGSKGFQLAYS 3383          

HSP 3 Score: 64.3142 bits (155), Expect = 6.451e-10
Identity = 77/330 (23.33%), Postives = 141/330 (42.73%), Query Frame = 3
Query:  513 RMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINF--EHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEK--PKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYV--KITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY 1484
            R+  SP FPQ+ P ++ C+Y   A +  ++++ F  E+F+I+G    C  D LD YIE++  +    +++ +G +CG   +  P+ + S  N +    Y  ++T +       +   G         IA    T   +E+            +ITSP++P  + + + C + +       I      + L + N +C  + + I DG++ ++P+IG P C  +  P +   S  N + ++F +     R     G +   N    +K GF+V    S +    +ITN      +IGT               L  PGYP +   +  C +
Sbjct: 2481 RVLNSPEFPQRIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNC--DLLD-YIEIR--DGPTVHSEVIGIYCG---NQAPSTIFSTTNFL----YMKLHTSEYGKSRRFVATYG---------IATCGGTVMVRENV---------TTHITSPSFPYPFATPVQCQWNVKSPNTHMIEAKVDHVWLFY-NPNCTMEQLMIRDGNSTANPLIG-PVCVPRHAPDVFTRSASNQITVQFTSNSTTTR----GGRQYCSN----KKCGFDVAVTMSGEKCGGRITN------LIGT---------------LTPPGYPGKLLSHVKCIW 2749          

HSP 4 Score: 58.9214 bits (141), Expect = 2.850e-8
Identity = 77/352 (21.88%), Postives = 145/352 (41.19%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG--CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIY-PSHL---NCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTR--NMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKG--FNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLN 1550
            SPN+P+KY P++ C Y       + V + F+ F++E + P   C  D +++Y    S  +   + + LG+FCG     +P  + S  N + + F SD +              G+N  F+ +          +K +C F          +T+P+   I+ P  L    C+Y +  ++ +RI +   ++ L      C +  +   +G +E+SP    PF    P+ +I + +   M +IR  +            + + +  K +  +G  FN+ Y                  I + C   +   +  +GI+ +P YP+   KN  C + +  +   NK+  A+     LN
Sbjct: 1078 SPNYPEKYQPHMHCVYNLYVSWSKTVKLTFDVFDLE-VTPAKSCEYDRVEIYT---SYHNETVHGELLGKFCGAM---IPPSIYSTTNTMAVVFVSDRSVAGP----------GWNAKFEAV---------SRKTTCDF---------TLTAPSNNLIFDPQQLKFDKCTYHIAVHENQRILIKMNNMSL-----PCDKSSLMFRNGPSETSP----PFSSLPPESEICTPKVNYMPVIRSFS------------NRVTIVYKSINSEGSFFNLTYE----------------TITSGCGGRV---DGLTGIVSAPQYPLGDKKNLKCDWTV-AVALGNKVRFALTALDDLN 1353          
BLAST of Cubilin vs. Ensembl Fly
Match: CG42613 (gene:FBgn0261262 transcript:FBtr0304687)

HSP 1 Score: 321.242 bits (822), Expect = 5.595e-92
Identity = 249/849 (29.33%), Postives = 387/849 (45.58%), Query Frame = 3
Query:  399 FVKMDFFLLSIYCLTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGL---------LPGCNKDFLDLYIEMKSLE-STLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIA------PINSTKEQKESCHFYID---SKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKI--TNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPT-----PDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLP-DSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGI---GGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVR--VIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYR------SNLICQWSVKAFDSSNRIMIHFHDFVTEG--SHQSCANSILRIY-DGDSFQASSELCGTDSAIPA--FISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKH-------CISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEH 2795
            F +  F L+ I+ L    ++  +CD  + S +IG      F +P        + +C Y F+A   ++V + F+ FN+ G          LP C  +++D+Y E++S E + L N+   GR+CG      P   +S++  + + F+S+ N               F GTF+FI  +      PI  +      C + I    S  + G + SPTYPG YP  ++C+Y  +G   +R+RL FRD DL      C  D+V +YDG   SS +IG  +CG++  L + S+ + L + F T      SR  +           Q +GF  +Y FS  +VK+    E +  HI G+ECD  I S ++++G + SP YP       +C YF+YG+ +   +E   L+F   NIP        ++ C+ G L IY          ++ Q+     D  D  +CG    E + +  +GP + +       FSSG     GF   YTF+ +Y I G     G C F Y  SS K G +NSP +   YPS+T C Y  +   + ++ I F  F +  D        +  +  C  D++   V+ +     ++ +       CG + PGP+ S   +  + +T  +D     SGF A+Y F   +      CG N  S    G ITS  +P  Y+      ++  C W +KA     ++ IHF  F  EG  +++ C  ++LR++ + DS Q   ELCG    +    + ST  T  + F TS K  G +GF+++W+EI    P     G  C  T H       CIS +L CDGV +CG              DD+DE H
Sbjct:  217 FARSIFPLVIIFNL--LPLFYAECDQTFVS-RIGGPQNGSFSAPLLHNHRNHSRQCLYTFLAGPGQRVEVVFKSFNLRGSPPDGSAVGELPSCVHEYMDIYSEVQSSEPAELINSPFGGRYCGTI---PPRRRISMYRAVAISFFSNKNVTTDL----------FEGTFRFINASEYEIGIPIAGSP-----CSYTITPSMSVNKTGALISPTYPGAYPKDMSCTYQFLGESNQRVRLEFRDFDLFFGGPHCPFDYVKVYDGPDNSSALIGT-YCGQQRNLVLYSSESSLFVHFYT-----LSRTAN----------TQNRGFKGIYEFSESFVKLDFIRENDGIHIRGSECDQKILSKKESTGFVLSPNYPYPYIPKTVCRYFIYGMQDAQHLERVRLEFNAFNIPKVEHKDKSESNCTDGYLKIY----------LKGQETADAYDKFDYELCGN---ETQRVISEGPRLAM------VFSSGELQGRGFKGKYTFETEYKIPGTAAPDGTCSFTYVSSSKKRGELNSPRYPSNYPSDTNCSYLFLAEADEQVTIVFDHFKIKADNNANATAGAYGSGACFEDWLEMYVVYRDNNDRLLGR------YCGQTAPGPVESPRGAVGLRITLHTDQESVASGFKARYFFESAKSDAG-DCGGN-FSNQDSGLITSPNWPAGYKAPGRGMASNACNWVMKA-RPGYKLSIHFEQFGLEGDPANRGCPAAVLRLWMNVDSDQPPLELCGEKPPVEQWHYTSTGQTARISFTTSDKTVGAQGFRIVWTEIQDSGPGPPSVGLHCESTYHFQCGAGYCISDKLRCDGVKNCGP------------GDDTDELH 988          
BLAST of Cubilin vs. Ensembl Fly
Match: CG42613 (gene:FBgn0261262 transcript:FBtr0304688)

HSP 1 Score: 321.242 bits (822), Expect = 2.109e-91
Identity = 249/849 (29.33%), Postives = 387/849 (45.58%), Query Frame = 3
Query:  399 FVKMDFFLLSIYCLTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGL---------LPGCNKDFLDLYIEMKSLE-STLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIA------PINSTKEQKESCHFYID---SKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKI--TNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPT-----PDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLP-DSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGI---GGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVR--VIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYR------SNLICQWSVKAFDSSNRIMIHFHDFVTEG--SHQSCANSILRIY-DGDSFQASSELCGTDSAIPA--FISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKH-------CISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEH 2795
            F +  F L+ I+ L    ++  +CD  + S +IG      F +P        + +C Y F+A   ++V + F+ FN+ G          LP C  +++D+Y E++S E + L N+   GR+CG      P   +S++  + + F+S+ N               F GTF+FI  +      PI  +      C + I    S  + G + SPTYPG YP  ++C+Y  +G   +R+RL FRD DL      C  D+V +YDG   SS +IG  +CG++  L + S+ + L + F T      SR  +           Q +GF  +Y FS  +VK+    E +  HI G+ECD  I S ++++G + SP YP       +C YF+YG+ +   +E   L+F   NIP        ++ C+ G L IY          ++ Q+     D  D  +CG    E + +  +GP + +       FSSG     GF   YTF+ +Y I G     G C F Y  SS K G +NSP +   YPS+T C Y  +   + ++ I F  F +  D        +  +  C  D++   V+ +     ++ +       CG + PGP+ S   +  + +T  +D     SGF A+Y F   +      CG N  S    G ITS  +P  Y+      ++  C W +KA     ++ IHF  F  EG  +++ C  ++LR++ + DS Q   ELCG    +    + ST  T  + F TS K  G +GF+++W+EI    P     G  C  T H       CIS +L CDGV +CG              DD+DE H
Sbjct:  217 FARSIFPLVIIFNL--LPLFYAECDQTFVS-RIGGPQNGSFSAPLLHNHRNHSRQCLYTFLAGPGQRVEVVFKSFNLRGSPPDGSAVGELPSCVHEYMDIYSEVQSSEPAELINSPFGGRYCGTI---PPRRRISMYRAVAISFFSNKNVTTDL----------FEGTFRFINASEYEIGIPIAGSP-----CSYTITPSMSVNKTGALISPTYPGAYPKDMSCTYQFLGESNQRVRLEFRDFDLFFGGPHCPFDYVKVYDGPDNSSALIGT-YCGQQRNLVLYSSESSLFVHFYT-----LSRTAN----------TQNRGFKGIYEFSESFVKLDFIRENDGIHIRGSECDQKILSKKESTGFVLSPNYPYPYIPKTVCRYFIYGMQDAQHLERVRLEFNAFNIPKVEHKDKSESNCTDGYLKIY----------LKGQETADAYDKFDYELCGN---ETQRVISEGPRLAM------VFSSGELQGRGFKGKYTFETEYKIPGTAAPDGTCSFTYVSSSKKRGELNSPRYPSNYPSDTNCSYLFLAEADEQVTIVFDHFKIKADNNANATAGAYGSGACFEDWLEMYVVYRDNNDRLLGR------YCGQTAPGPVESPRGAVGLRITLHTDQESVASGFKARYFFESAKSDAG-DCGGN-FSNQDSGLITSPNWPAGYKAPGRGMASNACNWVMKA-RPGYKLSIHFEQFGLEGDPANRGCPAAVLRLWMNVDSDQPPLELCGEKPPVEQWHYTSTGQTARISFTTSDKTVGAQGFRIVWTEIQDSGPGPPSVGLHCESTYHFQCGAGYCISDKLRCDGVKNCGP------------GDDTDELH 988          
BLAST of Cubilin vs. Ensembl Fly
Match: CG42613 (gene:FBgn0261262 transcript:FBtr0304685)

HSP 1 Score: 319.701 bits (818), Expect = 1.128e-90
Identity = 244/826 (29.54%), Postives = 376/826 (45.52%), Query Frame = 3
Query:  468 CDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGL---------LPGCNKDFLDLYIEMKSLE-STLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIA------PINSTKEQKESCHFYID---SKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKI--TNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPT-----PDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLP-DSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGI---GGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVR--VIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYR------SNLICQWSVKAFDSSNRIMIHFHDFVTEG--SHQSCANSILRIY-DGDSFQASSELCGTDSAIPA--FISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKH-------CISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEH 2795
            CD  + S +IG      F +P        + +C Y F+A   ++V + F+ FN+ G          LP C  +++D+Y E++S E + L N+   GR+CG      P   +S++  + + F+S+ N               F GTF+FI  +      PI  +      C + I    S  + G + SPTYPG YP  ++C+Y  +G   +R+RL FRD DL      C  D+V +YDG   SS +IG  +CG++  L + S+ + L + F T      SR  +           Q +GF  +Y FS  +VK+    E +  HI G+ECD  I S ++++G + SP YP       +C YF+YG+ +   +E   L+F   NIP        ++ C+ G L IY          ++ Q+     D  D  +CG    E + +  +GP + +       FSSG     GF   YTF+ +Y I G     G C F Y  SS K G +NSP +   YPS+T C Y  +   + ++ I F  F +  D        +  +  C  D++   V+ +     ++ +       CG + PGP+ S   +  + +T  +D     SGF A+Y F   +      CG N  S    G ITS  +P  Y+      ++  C W +KA     ++ IHF  F  EG  +++ C  ++LR++ + DS Q   ELCG    +    + ST  T  + F TS K  G +GF+++W+EI    P     G  C  T H       CIS +L CDGV +CG              DD+DE H
Sbjct:  271 CDQTFVS-RIGGPQNGSFSAPLLHNHRNHSRQCLYTFLAGPGQRVEVVFKSFNLRGSPPDGSAVGELPSCVHEYMDIYSEVQSSEPAELINSPFGGRYCGTI---PPRRRISMYRAVAISFFSNKNVTTDL----------FEGTFRFINASEYEIGIPIAGSP-----CSYTITPSMSVNKTGALISPTYPGAYPKDMSCTYQFLGESNQRVRLEFRDFDLFFGGPHCPFDYVKVYDGPDNSSALIGT-YCGQQRNLVLYSSESSLFVHFYT-----LSRTAN----------TQNRGFKGIYEFSESFVKLDFIRENDGIHIRGSECDQKILSKKESTGFVLSPNYPYPYIPKTVCRYFIYGMQDAQHLERVRLEFNAFNIPKVEHKDKSESNCTDGYLKIY----------LKGQETADAYDKFDYELCGN---ETQRVISEGPRLAM------VFSSGELQGRGFKGKYTFETEYKIPGTAAPDGTCSFTYVSSSKKRGELNSPRYPSNYPSDTNCSYLFLAEADEQVTIVFDHFKIKADNNANATAGAYGSGACFEDWLEMYVVYRDNNDRLLGR------YCGQTAPGPVESPRGAVGLRITLHTDQESVASGFKARYFFESAKSDAG-DCGGN-FSNQDSGLITSPNWPAGYKAPGRGMASNACNWVMKA-RPGYKLSIHFEQFGLEGDPANRGCPAAVLRLWMNVDSDQPPLELCGEKPPVEQWHYTSTGQTARISFTTSDKTVGAQGFRIVWTEIQDSGPGPPSVGLHCESTYHFQCGAGYCISDKLRCDGVKNCGP------------GDDTDELH 1021          
BLAST of Cubilin vs. Ensembl Fly
Match: CG42613 (gene:FBgn0261262 transcript:FBtr0304686)

HSP 1 Score: 295.819 bits (756), Expect = 1.295e-84
Identity = 225/752 (29.92%), Postives = 344/752 (45.74%), Query Frame = 3
Query:  663 LDLYIEMKSLE-STLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIA------PINSTKEQKESCHFYID---SKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKI--TNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPT-----PDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLP-DSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSG---IGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVR--VIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYR------SNLICQWSVKAFDSSNRIMIHFHDFVTEG--SHQSCANSILRIY-DGDSFQASSELCGTDSAIPA--FISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKH-------CISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEH 2795
            +D+Y E++S E + L N+   GR+CG      P   +S++  + + F+S+ N               F GTF+FI  +      PI  +      C + I    S  + G + SPTYPG YP  ++C+Y  +G   +R+RL FRD DL      C  D+V +YDG   SS +IG  +CG++  L + S+ + L + F T      SR  +           Q +GF  +Y FS  +VK+    E +  HI G+ECD  I S ++++G + SP YP       +C YF+YG+ +   +E   L+F   NIP        ++ C+ G L IY          ++ Q+     D  D  +CG    E + +  +GP + +       FSSG     GF   YTF+ +Y I G     G C F Y  SS K G +NSP +   YPS+T C Y  +   + ++ I F  F +  D        +  +  C  D++   V+ +     ++ +       CG + PGP+ S   +  + +T  +D     SGF A+Y F   +      CG N  S    G ITS  +P  Y+      ++  C W +KA     ++ IHF  F  EG  +++ C  ++LR++ + DS Q   ELCG    +    + ST  T  + F TS K  G +GF+++W+EI    P     G  C  T H       CIS +L CDGV +CG              DD+DE H
Sbjct:    1 MDIYSEVQSSEPAELINSPFGGRYCGTI---PPRRRISMYRAVAISFFSNKNVTTDL----------FEGTFRFINASEYEIGIPIAGSP-----CSYTITPSMSVNKTGALISPTYPGAYPKDMSCTYQFLGESNQRVRLEFRDFDLFFGGPHCPFDYVKVYDGPDNSSALIGT-YCGQQRNLVLYSSESSLFVHFYT-----LSRTAN----------TQNRGFKGIYEFSESFVKLDFIRENDGIHIRGSECDQKILSKKESTGFVLSPNYPYPYIPKTVCRYFIYGMQDAQHLERVRLEFNAFNIPKVEHKDKSESNCTDGYLKIY----------LKGQETADAYDKFDYELCGN---ETQRVISEGPRLAM------VFSSGELQGRGFKGKYTFETEYKIPGTAAPDGTCSFTYVSSSKKRGELNSPRYPSNYPSDTNCSYLFLAEADEQVTIVFDHFKIKADNNANATAGAYGSGACFEDWLEMYVVYRDNNDRLLGR------YCGQTAPGPVESPRGAVGLRITLHTDQESVASGFKARYFFESAKSDAG-DCGGN-FSNQDSGLITSPNWPAGYKAPGRGMASNACNWVMKA-RPGYKLSIHFEQFGLEGDPANRGCPAAVLRLWMNVDSDQPPLELCGEKPPVEQWHYTSTGQTARISFTTSDKTVGAQGFRIVWTEIQDSGPGPPSVGLHCESTYHFQCGAGYCISDKLRCDGVKNCGP------------GDDTDELH 678          

HSP 2 Score: 106.301 bits (264), Expect = 8.113e-23
Identity = 134/545 (24.59%), Postives = 219/545 (40.18%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIE-IAPINSTKE------QKESCHFYIDSKKEE-GYITSPTYPGIYPSHLNCSYLLVGNQK----ERIRLLFRDLDL------NHQNDDCIEDHVTIYDGDTESSPIIGQ---PFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQII---CGTDYREIKEITCKGPL------VLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYP------SNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKR 2021
            + VN      SP +P  YP ++ C YQF+ +S ++V + F  F++    P C  D++ +Y +     S L     +G +CG   + V   + S  + + + FY+   T  + N+       GF G ++F E    ++  +E      +   C   I SKKE  G++ SP YP  Y     C Y + G Q     ER+RL F   ++      +    +C + ++ IY    E++    +     CG + + +++S    L + F +G+                   LQ +GF   Y F  +Y KI      +   GT C     SS K  G L SP YP   P +  C+Y      +    E   + F    I    DN  +  + +  S   F   LE+    +V  D+ D+++   CG         T  GP+      V LR+       S   GF   Y F      E    + G C    N S+  SG+I SP +   Y       ++  C + +     +++ I+F++F L  D   R
Sbjct:   86 MSVNKTGALISPTYPGAYPKDMSCTYQFLGESNQRVRLEFRDFDLFFGGPHCPFDYVKVY-DGPDNSSAL-----IGTYCGQQRNLV---LYSSESSLFVHFYTLSRTANTQNR-------GFKGIYEFSESFVKLDFIRENDGIHIRGSECDQKILSKKESTGFVLSPNYPYPYIPKTVCRYFIYGMQDAQHLERVRLEFNAFNIPKVEHKDKSESNCTDGYLKIYLKGQETADAYDKFDYELCGNETQ-RVISEGPRLAMVFSSGE-------------------LQGRGFKGKYTFETEY-KIPGTAAPD---GT-CSFTYVSSSKKRGELNSPRYPSNYPSDTNCSYLFLAEAD----EQVTIVFDHFKI--KADNNANATAGAYGSGACFEDWLEM---YVVYRDNNDRLLGRYCGQ--------TAPGPVESPRGAVGLRITLHTDQESVASGFKARYFF------ESAKSDAGDCGG--NFSNQDSGLITSPNWPAGYKAPGRGMASNACNWVMKARPGYKLSIHFEQFGLEGDPANR 564          
BLAST of Cubilin vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084690)

HSP 1 Score: 102.064 bits (253), Expect = 2.521e-21
Identity = 81/266 (30.45%), Postives = 128/266 (48.12%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLL---PGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTF-KFIEIAPINSTKEQKES----------CHFYI-------DSKKEE---------GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            SP+FP+ YP    C ++ VA  + ++ +NF HF++EG       C  D + +Y ++   E+ L   K +G FCG +   +P    S  N + L+F+SD + Q+S          GF   F   I+   +N+   Q E           CH          D K+ E         G I SP YP  YP + +C +  +     RI+L+F + D+ +HQ  +C  D+V +YDG++ESS ++G+ FCG+K    I ST N + +   T
Sbjct: 1010 SPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLG--ENRL---KRIGTFCGSS---IPPTATSESNALRLEFHSDKSIQRS----------GFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQ--ECTYDNVAVYDGESESSSVLGR-FCGDKIPFPISSTSNQMYMVLKT 1254          

HSP 2 Score: 87.0409 bits (214), Expect = 1.023e-16
Identity = 151/689 (21.92%), Postives = 255/689 (37.01%), Query Frame = 3
Query:  564 CKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDL---YIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHII----GTECDMWIKSS----------------EKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNK--CSTGSLSIYSIRPFFVKL-EIRPQKLVLPDSPDQIICGT---------------DYREIKEITCKGPLVLLRLNTSN-AFSSG---------IGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIY 2477
            C+++  A   E+V +  E+ NI      C  D+L++   Y E   L         +GRFCG     V   V+   +  +L  Y  +NT +        G  GF   F  +              C   +      G + SP YP  Y  +  C + +   +  ++ L F+  ++ + +D C+ D+V + DG  + +P+IG  FCG KP   + S+ N + ++F++   +                  QK GF+ V+   VD  +  N   ++  I    G EC   I                   E  +G + SP +P   P  K C + +             L F   ++  T   +  C   S+++YS      KL E R +++          CG+               ++   K I   G   +   +    A ++G         IG ++            G   + G C   Y IS+   G I SP +   YP N  C +  I    HRI++ F EF +              +  C  D V V      G   S  +   F CG  +P P+   S SN + +   +D  +  +GF A +       +      +   S  R GN       ++Y   + C+W++ A D+S   +I F  F  E S ++C    ++++
Sbjct:  752 CEWRITATYGERVELKLENMNI-FKSNNCETDYLEIRDGYFEKSPL---------IGRFCGK----VDKEVIRTESSRMLLTY--VNTHRI------EGFRGFKAEFDVV--------------CGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVEN-HDSCVYDYVEVRDGPGQDAPLIGV-FCGYKPPPNMKSSGNSMYVKFVSDTSV------------------QKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVA----PPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYS------KLGENRLKRI-------GTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECK--YEISA-PFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVE------------SHQECTYDNVAVYD----GESESSSVLGRF-CGDKIPFPI--SSTSNQMYMVLKTDKNKQKNGFTASHSTACGGYLRATSQVQQFYSHARFGN-------QDYDDGMDCEWTIAAPDNSYVQLI-FLTFDIESS-ENCTFDYVQVF 1336          

HSP 3 Score: 86.2705 bits (212), Expect = 1.472e-16
Identity = 142/590 (24.07%), Postives = 222/590 (37.63%), Query Frame = 3
Query: 1008 NCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQ------IICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRD------YGIEGKMVE-----PGVCHFVYNISSTK--------------SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDII------NHKCGENIIS-------------------------EIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFIT 2579
            +C + +     ER+ L   ++++   N+ C  D++ I DG  E SP+IG+ FCG+  K  I +  + +L+ ++    I+  R                 GF     F V             + G E      S +   G L+SP YP+    NK C + +       +     LKFQ+  +    +N  S            +  +E+R       D P Q      + CG  Y+    +   G  + ++  +  +      GF   +  + D      +G E + +         C   + + S K              +G I SP F ++YP    C ++I+    HRI + F  F L  +G   Q+      S C  D V V  K+ +  +  + I T   CGSS+  P  + S SN++ L F SD     SGF A + F  I +         H+C   I S                         EI    G I S  YP  Y  N  C W        +RI + F++F  E SHQ C    + +YDG+S  +S     CG     P   STSN +++   T
Sbjct:  751 HCEWRITATYGERVELKLENMNIFKSNN-CETDYLEIRDGYFEKSPLIGR-FCGKVDKEVIRTESSRMLLTYVNTHRIEGFR-----------------GFKA--EFDV-------------VCGGEL-----SVDDAVGRLESPNYPLDYLPNKECVWKI----TVPESYQVALKFQSFEV----ENHDSC----------VYDYVEVR-------DGPGQDAPLIGVFCG--YKPPPNMKSSGNSMYVKFVSDTSVQKA--GFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDL--EGTAHQQ------SDCGYDSVTVYSKLGENRL--KRIGT--FCGSSI--PPTATSESNALRLEFHSDKSIQRSGFAAVF-FTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFIT-TPGHRIKLIFNEFDVE-SHQECTYDNVAVYDGESESSSVLGRFCGDKIPFP-ISSTSNQMYMVLKT 1254          

HSP 4 Score: 79.337 bits (194), Expect = 2.379e-14
Identity = 90/362 (24.86%), Postives = 139/362 (38.40%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCH-----------------FYIDSKKEE-------------GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN---HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTS--GILKSPGYPVRTPKNKLCTY 1484
             +SPN+P  Y PN  C ++       +V + F+ F +E     C  D    Y+E++       +A  +G FCG+     P  + S  N + + F SD + Q++          GF+  F    +  ++  + Q   C                  F + S K+              G ITSP++P +YP    C + +V   K RI L F   DL    HQ  DC  D VT+Y    E+       FCG        S  N L + F +   I+RS   +      DE  +N    Q +  N +      Y+ + +     H  G +C       E ++  G + SP YP   P N  C +
Sbjct:  853 LESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENH-DSCVYD----YVEVRDGPGQ--DAPLIGVFCGYK---PPPNMKSSGNSMYVKFVSDTSVQKA----------GFSAVF----MKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTI----GSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVW 1186          

HSP 5 Score: 62.7734 bits (151), Expect = 2.306e-9
Identity = 59/241 (24.48%), Postives = 103/241 (42.74%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPG--IYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY----DGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            SPN+P  YPPN  C + F+     ++ + F  F++E     C  D + +Y + +S  S++     LGRFCG   D +P  + S  N + +   +D N Q++          GF              T     +C  Y+ +  +     S    G   Y   ++C + +       ++L+F   D+   +++C  D+V ++    D   +  P+ GQ +CG      I S  + LL+RF T
Sbjct: 1171 SPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQE-CTYDNVAVY-DGESESSSV-----LGRFCG---DKIPFPISSTSNQMYMVLKTDKNKQKN----------GF--------------TASHSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIE-SSENCTFDYVQVFSDIDDVYGQYGPMYGQ-YCGNVLPQDINSMTHSLLVRFKT 1375          

HSP 6 Score: 51.9878 bits (123), Expect = 4.179e-6
Identity = 57/254 (22.44%), Postives = 108/254 (42.52%), Query Frame = 3
Query: 1881 SGVINSP-FFNQLYPSNTT--CQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFI-SDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            SG+  SP  +     SN T  C++ I      R+ +  +  ++             K++ CE D++ +      K P+I +       CG  V   +I  + S+ + LT++ +  ++   GF A++D +         CG  +  +   G + S  YP +Y  N  C W +   +S  ++ + F  F  E +H SC    + + DG    A      CG     P   S+ N+++++F+ S  +  + GF  ++
Sbjct:  731 SGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNI------------FKSNNCETDYLEIRDGYFEKSPLIGR------FCGK-VDKEVIR-TESSRMLLTYVNTHRIEGFRGFKAEFDVV---------CGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESY-QVALKFQSFEVE-NHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPP-PNMKSSGNSMYVKFV-SDTSVQKAGFSAVF 951          
BLAST of Cubilin vs. Ensembl Zebrafish
Match: cubn (cubilin (intrinsic factor-cobalamin receptor) [Source:ZFIN;Acc:ZDB-GENE-060228-6])

HSP 1 Score: 153.295 bits (386), Expect = 9.287e-37
Identity = 183/710 (25.77%), Postives = 285/710 (40.14%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYR-FSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYS----IRPFFVKL-EIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVE-PGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            F SPN+P  YP N  C +     +  ++ ++F  F++E  +  C  D+L +Y    S      NA  L + CG   + +P  + S    + +   +D           H G  GF        +A  +ST      C+  + + +  G I S  YP  YPSH +CS+ +       I   F   ++  Q+D C  DHV +YDG  + + +IG  FCG  P     ++   L I F                         +   ++ YR F +D+ +     E    +GT                 SPGYP + P N+ C + ++     + +   +L+F     P      C+   L +Y       P   +L   RP     P +P Q+            +  G  V +R  TS+A  SG              G     VE PG C       +  SG I+SP +   YP N  C + I  +  HR+   F +  +                +C  D+V     I  GP    P+    +CG+S P P+ S   +N I + F SD   +H GF AQ+         +  CG  I+++  GG I S RYP  Y  N  C W ++A +  N + + F DF  E  + +C +  + I DGD+ QA S    CG++   P   S SN + ++F+ S  A G+KGF+  +
Sbjct: 1185 FTSPNYPLPYPANAECYWHIKTSAGSRIQLSFGDFHLEDTV-DCYFDYLMVYDGNNS------NAHQLAKLCG---NQIPAPISSSRENMYVKLRTD--------SIIHTG--GF--------LANYHST------CNGMLIANRSRGMIESLNYPNDYPSHADCSWTIQAYMGNTINYTFIAFEV-EQSDGCGYDHVKLYDGPNDQANLIGT-FCGNVPPPAGTTSGTSLHIVF-------------------------RSDMSISYRGFQMDWYQNGCGGELFGPVGT---------------FNSPGYPGQYPMNRECVWHIH-TSPGSSISITILEFDVEYHP-----DCNYDKLEVYGGPDLSAPRLAQLCTTRP-----PSNPLQV------------SSTGNAVTVRF-TSDAVVSG-------------RGFNATWVEVPGGCG---GSVTAPSGEIHSPQYPSNYPDNADCSWVITVDAGHRVFFNFTDLDIE------------NQFSCSYDYV----AIHDGPHEHSPLLAQ-VCGTSRPPPVTS--STNVIYVCFRSDHSLNHRGFSAQF---------SEACGSFIVTDDVGGEIASPRYPYPYPPNQDCSWIIRAQEPFNHVTLSFTDFELEMLNSNCTHDSVEILDGDNVQAPSVGRYCGSNLPHPV-TSLSNAMVVKFV-SDHAVGRKGFRATY 1748          

HSP 2 Score: 133.65 bits (335), Expect = 8.843e-31
Identity = 174/730 (23.84%), Postives = 288/730 (39.45%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQ-KYPPNIRCKY--QFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLK-FQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIM-IHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGF 2666
            +N    F SP+F    Y  N+ C++  Q    +   +V+  +  ++E     C  D+L+  +++        N + L R CG T   +P  VVS  ++ V            +  D+ +G LGF  T+ F E     S                + G I+SP YP +YPS   C++LL       + L F   ++  ++  C+ D VTI++G +  SPIIGQ +CG      I S  N L++ F+                      + K GF   +         T+      II              +G +KSP YP   P N  C++ +   H+ N +E      FQ     P    +C    + ++S         I+  + +L        CGT       I     ++  R  +S+  + G G    +YT                C   +  S   SG + SP +   YP+N+ C Y I       + + F+ F +              +STC  D V++          S P+ T  LCG+++PG   +      + + F SDS+   +GF A+Y  IP   + N             G I S  +    Y  N+ C + +  +  +NR++ + F+ F  E S  +C    + +YDG+S  A    + CG +   P   S++N + L+F+T   +   +G++  +SE L   P   C GF
Sbjct: 2585 LNEPGNFTSPDFGNGNYSNNLNCEWLIQNPHHTNSSIVVIIDELHLEHHQT-CEWDYLEFRLDIGD-----HNGELLTRLCGQTPPSIP-IVVSTPSLWV-----------HFLSDEAVGDLGFKATYYFSECGGTQS---------------GDGGVISSPGYPNVYPSPSRCTWLLEAPVGHTVVLTFTYFEV-EEHSQCVWDSVTIFNGASSGSPIIGQ-YCGHNSPGTIRSGSNKLVVVFLAD------------------HTVSKGGFAATWS--------TDSTGCGGII-----------HADTGTIKSPNYPQNFPTNIECSWTIIA-HDGNHLEMGFASDFQI----PDSSGQCQNSYIKMWSDN-------IQNDENLLATG-----CGT--TAPAAIIAPRNVITARFQSSD--TPGKGFSAAFYT---------------TCGANFTAS---SGRVVSPNYPDHYPANSNCNYIINAGEQFVVVLTFRTFQIE------------AHSTCVYDGVKIYSGTTAS---SSPLAT--LCGNTIPGIFTT---FGPMLINFYSDSIIHDNGFLAEYTTIPCGGVFNGT----------AGTIGSPSHSISNYHHNINCTYHI--YVRNNRVINLKFNSFNLEAS-STCNFDYVAVYDGESTLAPLMGKFCGHELP-PNLRSSTNHMFLQFVTD-SSVAAEGWRATYSETLG--PQQGCGGF 3166          

HSP 3 Score: 128.642 bits (322), Expect = 3.406e-29
Identity = 164/716 (22.91%), Postives = 273/716 (38.13%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFS-SGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFL----CGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFI----PIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSS---NRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
             SP +P  YP N  C +     +  +V  NF   +IE     C+ D++ ++      +    ++  L + CG +    P  V S  N+I + F SD     S N        GF+  F               E+C  +I +    G I SP YP  YP + +CS+++   +    + L F D +L   N +C  D V I DGD   +P +G+ +CG      + S  N ++++F++   + R                  KGF   Y  S         ME                   SG   SP YP   P N  C + L                       +P N+          I+  F+  +++P             C  DY EI+E    G LV      S   + + I G +++  F  D  I G        H   N  +  +G+I SP + + YP+N   ++ +  +++  I+I F +  + +  +    Y  LK                   I   P   SFL    CG ++P P+   S  ++I+L F SD+V    GF  ++  +    P+  I    CG  +++      + S  +P  Y+ NL C W +++  S    N + +   D V      SC +  L I DG++  +   +++CG    +P  + ++    L   TS  +   +GF   +S
Sbjct: 1534 HSPQYPSNYPDNADCSWVITVDAGHRVFFNFTDLDIENQF-SCSYDYVAIH------DGPHEHSPLLAQVCGTSR---PPPVTSSTNVIYVCFRSD----HSLNHR------GFSAQFS--------------EACGSFIVTDDVGGEIASPRYPYPYPPNQDCSWIIRAQEPFNHVTLSFTDFELEMLNSNCTHDSVEILDGDNVQAPSVGR-YCGSNLPHPVTSLSNAMVVKFVSDHAVGR------------------KGFRATYMASTSGCGGLLNME-------------------SGAFNSPNYPDVYPPNVECVWTLTS---------------------SPGNR----------IQLSFIMFQLQPSS----------DCSNDYLEIREGHSTGALVGRFCGDSLPTNYTSITGHILWIKFISDSSISGAGFRAVFSHLYGNDITGSTGLIASPLYPRTYPNNADYRWTVTVDSDSHIQIQFLDIDIED--LFNCLYDKLK-------------------IYDGPSTNSFLLGEFCGLTLPNPV--RSSGSAITLEFQSDTVIGGKGFLIEWTAVQGSGPLPTIEPGACGGTLVTGDTPQFLFSPGWPELYQHNLDCSWVIRSPSSIVEFNLLSLDMEDEV------SCLHDSLDIRDGETNASPLIAKVCGRQ--LPGSLHSTGDAMLLRFTSDGSINGRGFNATFS 2105          

HSP 4 Score: 124.79 bits (312), Expect = 5.130e-28
Identity = 164/680 (24.12%), Postives = 260/680 (38.24%), Query Frame = 3
Query:  555 NIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYP--GIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDD-CIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDS--PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQ--ASSELCGTDSAIPAFISTSNTVHLEF 2573
            NI C Y    ++   + + F  FN+E     CN D++ +Y      ESTL  A  +G+FCGH L   P  + S  N + L F +D +              G+  T+          T   ++ C  ++ S    G   SP     G Y  H++C + +     + I L F   +L       C  DHVTIYDGD+ + P++G  FCG+      +S  N L + FI+   + R                  +GFN  Y               N + G   +     +  TS  + SP YP   P    C + L    +    E   +  Q  ++  +    C++  L     + F V    +  K    DS  PD       Y     IT K          S AF +G G       F   Y + G       C  VY     + G + SP +  LYP N  C   +    N  I ++F  F +              + +C  D++ V      G   + P+     CG+++P P+   S  N + + F SD   + +GF   +   P        CG  +  +   G+ TS  YP  Y +   C+WS++A   S R++    + ++      C N+ L+++DG      A    CG ++ I  F ++SN V ++F
Sbjct: 3067 NINCTYHIYVRNNRVINLKFNSFNLEASST-CNFDYVAVY----DGESTL--APLMGKFCGHEL---PPNLRSSTNHMFLQFVTDSSVAAE----------GWRATYS--------ETLGPQQGCGGFLSSPS--GMFGSPDIDMNGQYEPHMDCMWTIAVEVNKAINLTFISFELEGSTGTLCRYDHVTIYDGDSANFPLVGT-FCGDVIPAPFISASNFLTVHFISDGTVSR------------------RGFNATYS------------TVNSLCGGAFN-----ATATSQTITSPLYPNAYPPFTSCRWVL----DAPSQEGVKVSVQQFHLDTS--QSCTSNFLEF---KDFPVGDYGQAHKFCSADSHVPDFY----SYGRTMHITFK----------SEAFMTGNG-------FSLSYQVAG-------CSRVYE---QEYGYLKSPGWPDLYPHNLECSIVLQAPQNSFISLFFTSFDVE------------THPSCNFDYLEVR----NGSTATSPLLGKH-CGNTLPNPVFPGS--NELFIFFKSDFTTTRNGFEITWTSSP------QGCGGVLYGD--HGSFTSPNYPGTYANGSSCEWSIRA--PSGRVVTVTFNQISIDDPGDCQNNYLKLFDGPDANSPAVGPYCGLETNIAPFRASSNLVFVKF 3611          

HSP 5 Score: 120.168 bits (300), Expect = 1.271e-26
Identity = 163/711 (22.93%), Postives = 278/711 (39.10%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYI-DSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREI-KEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGN----ITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
             F SPN+P  YPPN+ C +   +    ++ ++F  F ++      + D  + Y+E++   ST      +GRFCG +L    N+     +I+ + F SD +   +          GF   F                  H Y  D     G I SP YP  YP++ +  + +  +    I++ F D+D+     +C+ D + IYDG + +S ++G+ FCG      + S+ + + + F                   +  ++  KG      F +++  +        I    C   + + + T   L SPG+P     N  C++ +       +  +++++F  L++    +  C   SL I          E     L+        +CG   R++   +   G  +LLR  +  +    I G     TF R  G        G  H       T  GV++SP + Q Y  N  C + ++     R+ + FQ         + Q Y    N    GD++    ++  GP  + P  +  LCGS+VP      +  NS+   F+SD     +GF   +      +  +  CG  I  E+  G+    ITS  YP  Y  N+ C W +   +     +    DF  E  H  C    + I DG +  A     LCG ++      S+  T++L F T   +    GFK  +S
Sbjct: 1765 AFNSPNYPDVYPPNVECVWTLTSSPGNRIQLSFIMFQLQP-----SSDCSNDYLEIREGHST---GALVGRFCGDSLPT--NYTSITGHILWIKFISDSSISGA----------GFRAVFS-----------------HLYGNDITGSTGLIASPLYPRTYPNNADYRWTVTVDSDSHIQIQFLDIDIEDLF-NCLYDKLKIYDGPSTNSFLLGE-FCGLTLPNPVRSSGSAITLEF------------------QSDTVIGGKG------FLIEWTAVQGSGPLPTIEPGACGGTLVTGD-TPQFLFSPGWPELYQHNLDCSWVI-------RSPSSIVEFNLLSLDMEDEVSCLHDSLDIR-------DGETNASPLIAK------VCG---RQLPGSLHSTGDAMLLRFTSDGS----INGRGFNATFSRGCG--------GFLH-------TDRGVLSSPQYPQNYKPNLNCNWQVMVTPGFRVSVTFQS------PFQVQGY---GNQCSTGDYL----ELRNGPDGNSPTLSGRLCGSNVPSTF--QTTDNSLYAHFVSDGSNEGNGFKLLF------EAHSSACGGLI--ELNDGDPPGYITSPDYPSNYPQNIDCVWIITVPNGEAVQLDFEGDFYIE-PHSGCLFDYIEIRDGPTSDADLIGRLCG-NTRPSTQHSSGTTMYLRFRTD-ASVTHIGFKAKYS 2343          

HSP 6 Score: 119.013 bits (297), Expect = 2.497e-26
Identity = 172/731 (23.53%), Postives = 283/731 (38.71%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRT-PKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPL--------VLLRLNTSNAF---------SSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPR-EYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSIL--RIYDGD-SFQASSELCG-TDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +R +  SP +PQ Y PN+ C +Q +     +V + F+  F ++G    C+  D+L+L         TL      GR CG    +VP+   +  N +   F SD + +              NG FK +  A  ++     E     ++     GYITSP YP  YP +++C +++     E ++L F        +  C+ D++ I DG T  + +IG+  CG        S+   + +RF T   +                     GF   Y  +V              IG             +G+++SPG+P    P N  C ++L G                            TG     +   F              D      C +DY EI+E    G L        +   ++T ++F         S+  GGF + +        E  + E G         +   G I+SP +  LYP +  C++ I      R+ +   +  L +             STC  DFV ++  + P  P + +      LCG +VP      S  N++++ F +DS  S+ GF A Y         +  CG  I++E   GN TS  +    Y +NL C+W ++    +N  ++   D +    HQ+C    L  R+  GD + +  + LCG T  +IP  +ST  ++ + F+ S +A G  GFK  +
Sbjct: 2115 DRGVLSSPQYPQNYKPNLNCNWQVMVTPGFRVSVTFQSPFQVQGYGNQCSTGDYLELRNGPDGNSPTL-----SGRLCG---SNVPSTFQTTDNSLYAHFVSDGSNEG-------------NG-FKLLFEAHSSACGGLIE-----LNDGDPPGYITSPDYPSNYPQNIDCVWIITVPNGEAVQLDFEGDFYIEPHSGCLFDYIEIRDGPTSDADLIGR-LCGNTRPSTQHSSGTTMYLRFRTDASVTH------------------IGFKAKYSIAV---------CGGTYIG------------QNGVIRSPGFPGSNYPDNSNCEWYLEG---------------------------PTGHYLTLTYTAF--------------DLQSSANCNSDYVEIREYNASGRLLGKHCGNNLPAPMDTGDSFAYVKFVSDASANAGGFSLSF--------EASIEECG------GDLNAPFGTISSPNYPNLYPHSRICRWSITVPQGRRVTLTINDLRLED------------QSTCAFDFVEILNGLTPSAPRLDR------LCG-TVPAGTQVKSSGNTMTVIFSTDSSVSNGGFTADY-----SSEESAVCG-GILNEP--GNFTSPDFGNGNYSNNLNCEWLIQNPHHTNSSIVVIIDELHLEHHQTCEWDYLEFRLDIGDHNGELLTRLCGQTPPSIPIVVSTP-SLWVHFL-SDEAVGDLGFKATY 2694          

HSP 7 Score: 119.013 bits (297), Expect = 2.907e-26
Identity = 178/750 (23.73%), Postives = 277/750 (36.93%), Query Frame = 3
Query:  423 LSIYCLTNYVVYALDCDIIYYSDKIG---VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFR-DLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGI---GGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFN-QLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYD--FIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQS-CANSILRIYDGDS--FQASSELCGTDSAIPA-FISTSNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            L ++ L++  V  L     YY  + G     +  +  SP +P  YP   RC +   A     VV+ F +F +E     C  D + ++    S       +  +G++CGH   + P  + S  N +V+ F +D    +           GF  T+                 C   I    + G I SP YP  +P+++ CS+ ++ +    + + F  D  +   +  C   ++ ++  + ++   +    CG      I++ RN++  RF + D                      KGF+  +                    T C     +S   SG + SP YP   P N  C Y +    N  +    VL F+T  I     + C    + IYS                   SP   +CG     I   T  GP+++      N +S  I    GF+  YT                C  V+N     +G I SP  +   Y  N  C Y I   NN  I + F  F+L              +STC  D+V V      G     P+   F CG  +P  L   S +N + L F++DS  +  G+ A Y     P Q      CG  + S              +Y  ++ C W++ A + +  I + F  F  EGS  + C    + IYDGDS  F      CG    IPA FIS SN + + FI S     ++GF   +S +
Sbjct: 2675 LWVHFLSDEAVGDLGFKATYYFSECGGTQSGDGGVISSPGYPNVYPSPSRCTWLLEAPVGHTVVLTFTYFEVE-EHSQCVWDSVTIFNGASS------GSPIIGQYCGH---NSPGTIRSGSNKLVVVFLADHTVSKG----------GFAATWS-----------TDSTGCGGII--HADTGTIKSPNYPQNFPTNIECSWTIIAHDGNHLEMGFASDFQIPDSSGQCQNSYIKMWSDNIQNDENLLATGCGTTAPAAIIAPRNVITARFQSSD-------------------TPGKGFSAAFY-------------------TTCGANFTAS---SGRVVSPNYPDHYPANSNCNYII----NAGEQFVVVLTFRTFQI--EAHSTCVYDGVKIYS-------------GTTASSSPLATLCGNTIPGI--FTTFGPMLI------NFYSDSIIHDNGFLAEYTTIP-------------CGGVFN---GTAGTIGSPSHSISNYHHNINCTYHIYVRNNRVINLKFNSFNLE------------ASSTCNFDYVAVY----DGESTLAPLMGKF-CGHELPPNL--RSSTNHMFLQFVTDSSVAAEGWRATYSETLGPQQ-----GCGGFLSSPSGMFGSPDIDMNGQYEPHMDCMWTI-AVEVNKAINLTFISFELEGSTGTLCRYDHVTIYDGDSANFPLVGTFCG--DVIPAPFISASNFLTVHFI-SDGTVSRRGFNATYSTV 3279          

HSP 8 Score: 113.235 bits (282), Expect = 1.550e-24
Identity = 166/702 (23.65%), Postives = 270/702 (38.46%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            ++P  P  YP N  C++         V +NF  F++EG    C  D    ++E++   S+  ++  +GR+CG  +   P  + S    + + F +D +              GF   F   E     +  E               G  TSP +P  YP   NC++ +       IRL F   ++    + C  D+V +YD  T  +  +   FCG      + ST +++ +  ++                     L  +GF      S DY+ I           T+C    ++S   +G L SP YP   P N+ C Y +    N   M    L F    +    +   S G          F  LEIR           Q  CGT+   I  I      + ++  + ++ +        Y  F+  +  +G     G         +T SG   SP +   YP+N  C + I  +   RI++ F +F L ED V            C  D++ V          S   + + LCG+ +P P IS SR N + +   +DS+    GF A Y         +  C   +I+    G I S  YP +Y S+  C W+++A+   N I   F  F  E S   C    +++YDG + QA+     CG +   PA  ++  ++H+ F  S  +   +GF++ W
Sbjct:  835 RTPFHPDPYPHNKVCEWVINQPEGYVVTLNFLTFDVEGSST-CAFD----HVEVRDGPSS--SSPLIGRYCGVEM---PPMLESTQKSMFIQFKTDASVSNH----------GFTAEFGSAEQGCGETLTEPT-------------GSFTSPGHPTEYPHGANCTWYISVPPGHLIRLSFSYFNMEFHTN-CAYDYVDVYDNGTALTGTLLGRFCGRSVPPSLTSTDSLMTVLLVSD------------------SSLSAEGF------SADYISINAT--------TDCSKVFRTS---TGELSSPNYPDNYPTNRECVYRIIVEVNMQIM----LNFTDFQL----EGFSSCG----------FDYLEIRDGGYETSPLIGQY-CGTNAPPI--IVSHSNRLWMKFRSDHSLT--------YRGFQAHW--DGTQTGCG------GTLTTSSGGFTSPNYPLPYPANAECYWHIKTSAGSRIQLSFGDFHL-EDTVD-----------CYFDYLMVYDGNN-----SNAHQLAKLCGNQIPAP-ISSSREN-MYVKLRTDSIIHTGGFLANY---------HSTCNGMLIANRSRGMIESLNYPNDYPSHADCSWTIQAY-MGNTINYTFIAFEVEQS-DGCGYDHVKLYDGPNDQANLIGTFCG-NVPPPAGTTSGTSLHIVF-RSDMSISYRGFQMDW 1398          

HSP 9 Score: 110.153 bits (274), Expect = 1.345e-23
Identity = 166/718 (23.12%), Postives = 256/718 (35.65%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKL-CTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY----SIRPFFVKL---EIRPQ------KLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPF--FNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYD---GDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            +SPN+PQ +P NI C +  +A     + + F   F I      C   ++ ++ +    +  L     L   CG T    P  +++  N+I   F S     +           GF+  F     A   ++                 G + SP YP  YP++ NC+Y++   ++  + L FR   +   +  C+ D V IY G T SS  +    CG      I +T   +LI F +   I  +                         F  +Y  I      N                T+G + SP + +    + + CTY +Y  +NR       LKF + N+  +  + C+   +++Y    ++ P   K    E+ P        + L    D  +    +R     T  GP              G GGF+                            S+ SG+  SP    N  Y  +  C + I    N  I + F  F L               + C  D V +      G   + P+  +F CG  +P P IS   SN +++ FISD   S  GF A Y        +N  CG    +      ITS  YP  Y     C+W + A  S   + +    F  + S QSC ++ L   D   GD  QA  + C  DS +P F S   T+H+ F +     G  GF L
Sbjct: 2827 KSPNYPQNFPTNIECSWTIIAHDGNHLEMGFASDFQIPDSSGQCQNSYIKMWSDNIQNDENL-----LATGCGTT---APAAIIAPRNVITARFQSSDTPGK-----------GFSAAFYTTCGANFTASS----------------GRVVSPNYPDHYPANSNCNYIINAGEQFVVVLTFRTFQI-EAHSTCVYDGVKIYSGTTASSSPLAT-LCGNTIP-GIFTTFGPMLINFYSDSIIHDNG------------------------FLAEYTTIPCGGVFN---------------GTAGTIGSPSHSISNYHHNINCTYHIYVRNNR----VINLKFNSFNLEAS--STCNFDYVAVYDGESTLAPLMGKFCGHELPPNLRSSTNHMFLQFVTDSSVAAEGWRATYSET-LGP------------QQGCGGFL----------------------------SSPSGMFGSPDIDMNGQYEPHMDCMWTIAVEVNKAINLTFISFELEGS----------TGTLCRYDHVTIY----DGDSANFPLVGTF-CGDVIPAPFIS--ASNFLTVHFISDGTVSRRGFNATYS------TVNSLCGGAFNATATSQTITSPLYPNAYPPFTSCRWVLDA-PSQEGVKVSVQQFHLDTS-QSCTSNFLEFKDFPVGDYGQA-HKFCSADSHVPDFYSYGRTMHITFKSEAFMTG-NGFSL 3393          

HSP 10 Score: 90.1225 bits (222), Expect = 1.733e-17
Identity = 163/728 (22.39%), Postives = 260/728 (35.71%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINT-----QQSYNQDDHMG-LLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPK---LKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCK-GPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGI--EGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA-SSELCGTDSAIPAFIS-TSNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            I   +R M +S N+P  YP +  C +   A     +   F  F +E    GC  D + LY      +     A  +G FCG+     P    +    + + F SD++      Q  + Q+   G L G  GTF                                SP YPG YP +  C + +  +    I +   + D+ +   DC  D + +Y G   S+P + Q  C  +P    L++ ST N + +RF +                    ++  +GFN  +      V++                   S    SG + SP YP   P N  C++ +      +        F  L+I                                      +Q  C  DY  I +   +  PL+     TS          VIY  F+ D+ +   G   +       + ++    G I SP +   YP N  C + I      NH + + F +F L            + NS C  D V ++     G  +  P    + CGS++P P+ S   SN++ + F+SD      GF A Y        +    G   +  +  G   S  YP  Y  N+ C W++ +    NRI + F  F  + S   C+N  L I +G S  A     CG DS    + S T + + ++FI+     G  GF+ ++S +
Sbjct: 1292 IANRSRGMIESLNYPNDYPSHADCSWTIQAYMGNTINYTFIAFEVE-QSDGCGYDHVKLY------DGPNDQANLIGTFCGNV---PPPAGTTSGTSLHIVFRSDMSISYRGFQMDWYQNGCGGELFGPVGTFN-------------------------------SPGYPGQYPMNRECVWHIHTSPGSSISITILEFDVEYH-PDCNYDKLEVYGGPDLSAPRLAQ-LCTTRPPSNPLQVSSTGNAVTVRFTSD------------------AVVSGRGFNATW------VEVPGGCGG-------------SVTAPSGEIHSPQYPSNYPDNADCSWVI----TVDAGHRVFFNFTDLDIE-------------------------------------NQFSCSYDYVAIHDGPHEHSPLLAQVCGTSRPPPVTSSTNVIYVCFRSDHSLNHRGFSAQFSEACGSFIVTDDVGGEIASPRYPYPYPPNQDCSWIIRAQEPFNH-VTLSFTDFELE-----------MLNSNCTHDSVEIL----DGDNVQAPSVGRY-CGSNLPHPVTS--LSNAMVVKFVSDHAVGRKGFRATY--------MASTSGCGGLLNMESGAFNSPNYPDVYPPNVECVWTLTS-SPGNRIQLSFIMFQLQPS-SDCSNDYLEIREGHSTGALVGRFCG-DSLPTNYTSITGHILWIKFISDSSISG-AGFRAVFSHL 1867          

HSP 11 Score: 85.8853 bits (211), Expect = 3.426e-16
Identity = 138/584 (23.63%), Postives = 227/584 (38.87%), Query Frame = 3
Query:  849 GLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGI--YPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGF-VIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAI---PAFISTSNTVHLEFIT 2579
            G+ G+  T       P   T +Q+  C   ++S    G  + P  PG   Y   ++C++++  +  + +R+ F   D+   +  C  D + ++DG++ S+ +IG+ +CG     ++ S+ N L   F       RS              +   GF V ++             +  + G +          T G +KSPGYP   P N+ C    Y   N N        F TL++     + C+            F  LEIR   L+  DS     C T      + T  GP   +  ++   FS    GF + Y T   D G  G   E               G+I SP +   Y  N  C Y I    + ++ + F    L              ++ C  DFV V     +  P+I +       CG+++P P++  S +N + + F SDS  S +GF A Y+           CG  +      G I +  +P  Y  N +C+W +   +    + ++F  F  EGS  +CA   + + DG S  +SS L G    +   P   ST  ++ ++F T
Sbjct:  451 GINGYTCTCTAQWTGPQCQTPQQE--CGGILESPA--GTFSYPNNPGTGDYDHQVSCAWVIRTDPNQILRITFPFFDI-ENSASCNFDFLQVHDGESASAFVIGK-YCGSAAPAELFSSHNSLYFWF-------RSD-----------HSVSAGGFTVAWQ------------SQAPVCGGQL-------TNTYGDIKSPGYPGNYPPNRDC----YWTVNVNPGLLITFAFGTLSL--EHHDNCN------------FDFLEIR-DGLLPEDSLLGKYCSTASPPPLQTT--GPSAWIHFHSD--FSISDRGFHITYTTSPSDPGCGGVFTE-------------TEGIIISPNWPNNYAHNRQCIYIIRMPRSEQVALNFTHMDLE------------IHTGCLFDFVEVRDGTGETDPLIGK------YCGNTLPAPIL--STTNGLWIRFQSDSSVSRAGFRAMYEL---------ACGGTLSGT---GQIRTPFHPDPYPHNKVCEWVINQPEGY-VVTLNFLTFDVEGS-STCAFDHVEVRDGPS--SSSPLIGRYCGVEMPPMLESTQKSMFIQFKT 919          

HSP 12 Score: 85.8853 bits (211), Expect = 3.426e-16
Identity = 85/326 (26.07%), Postives = 133/326 (40.80%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE--CDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFL 1490
            F SP  P +YP    C +         + ++F +FN+E     C  D++D+Y    +L  TL     LGRFCG +   VP  + S  +++ +   SD            +   GF+  +       IN+T +  +        +   G ++SP YP  YP++  C Y ++     +I L F D  L   +  C  D++ I DG  E+SP+IGQ +CG      I+S  N L ++F       RS              L  +GF                  + H  GT+  C   + +S   SG   SP YP+  P N  C + +
Sbjct:  950 FTSPGHPTEYPHGANCTWYISVPPGHLIRLSFSYFNME-FHTNCAYDYVDVYDNGTALTGTL-----LGRFCGRS---VPPSLTSTDSLMTVLLVSD----------SSLSAEGFSADY-----ISINATTDCSKV------FRTSTGELSSPNYPDNYPTNRECVYRIIVEVNMQIMLNFTDFQLEGFS-SCGFDYLEIRDGGYETSPLIGQ-YCGTNAPPIIVSHSNRLWMKF-------RSD-----------HSLTYRGF------------------QAHWDGTQTGCGGTLTTS---SGGFTSPNYPLPYPANAECYWHI 1204          

HSP 13 Score: 79.337 bits (194), Expect = 2.883e-14
Identity = 77/269 (28.62%), Postives = 117/269 (43.49%), Query Frame = 3
Query: 1878 KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI-----LQRLPDGSCPG 2663
            +SG  NSP +  +YP N  C + +  +  +RI++ F  F L              +S C  D++ + +    G ++ +       CG S+P    S +  + + + FISDS  S +GF A         + +H  G +I      G I S  YPR Y +N   +W+V   DS + I I F D   E     C    L+IYDG S  +    E CG     P   S+ + + LEF  S    G KGF + W+ +     L  +  G+C G
Sbjct: 1762 ESGAFNSPNYPDVYPPNVECVWTLTSSPGNRIQLSFIMFQLQ------------PSSDCSNDYLEIREGHSTGALVGR------FCGDSLPTNYTSIT-GHILWIKFISDSSISGAGFRA---------VFSHLYGNDITGST--GLIASPLYPRTYPNNADYRWTVTV-DSDSHIQIQFLDIDIEDLFN-CLYDKLKIYDGPSTNSFLLGEFCGLTLPNPV-RSSGSAITLEF-QSDTVIGGKGFLIEWTAVQGSGPLPTIEPGACGG 1996          

HSP 14 Score: 78.1814 bits (191), Expect = 8.336e-14
Identity = 67/250 (26.80%), Postives = 107/250 (42.80%), Query Frame = 3
Query:  513 RMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQ-SYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLE 1259
            +   SP +P  YPP   C++   A SQE V ++ + F+++     C  +FL    E K      +   H  +FC     HVP            DFYS   T   ++  +  M   GF+ ++   ++A  +   EQ            E GY+ SP +P +YP +L CS +L   Q   I L F   D+   +  C  D++ + +G T +SP++G+  CG      +    N L I F +     R+  E
Sbjct: 3294 QTITSPLYPNAYPPFTSCRWVLDAPSQEGVKVSVQQFHLD-TSQSCTSNFL----EFKDFPVGDYGQAH--KFCSAD-SHVP------------DFYSYGRTMHITFKSEAFMTGNGFSLSY---QVAGCSRVYEQ------------EYGYLKSPGWPDLYPHNLECSIVLQAPQNSFISLFFTSFDV-ETHPSCNFDYLEVRNGSTATSPLLGK-HCGNTLPNPVFPGSNELFIFFKSDFTTTRNGFE 3506          

HSP 15 Score: 75.8702 bits (185), Expect = 3.521e-13
Identity = 61/235 (25.96%), Postives = 107/235 (45.53%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            SPN+P  Y  N +C Y       E+V +NF H ++E +  GC  DF+++       + T      +G++CG+TL   P  ++S  N + + F SD +  ++          GF   ++      ++ T                 G I +P +P  YP +  C +++   +   + L F   D+   +  C  DHV + DG + SSP+IG+ +CG +    + ST+  + I+F T
Sbjct:  724 SPNWPNNYAHNRQCIYIIRMPRSEQVALNFTHMDLE-IHTGCLFDFVEV------RDGTGETDPLIGKYCGNTL---PAPILSTTNGLWIRFQSDSSVSRA----------GFRAMYELACGGTLSGT-----------------GQIRTPFHPDPYPHNKVCEWVINQPEGYVVTLNFLTFDV-EGSSTCAFDHVEVRDGPSSSSPLIGR-YCGVEMPPMLESTQKSMFIQFKT 919          

HSP 16 Score: 64.3142 bits (155), Expect = 1.265e-9
Identity = 64/274 (23.36%), Postives = 112/274 (40.88%), Query Frame = 3
Query:  501 VNNRRMFQSPNFP-QKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPK-LKILSTRNMLLIRFITGDFIKRSRLE---SGDEIKMNPKLLQKKG 1307
            +    + +SP FP   YP N  C++     +   + + +  F+++     CN D    Y+E++   ++    + LG+ CG+ L   P  + +  +   + F SD +              GF+ +F+              E C    D     G I+SP YP +YP    C + +   Q  R+ L   DL L  Q+  C  D V I +G T S+P + +  CG  P   ++ S+ N + + F T   +         S +E  +   +L + G
Sbjct: 2352 IGQNGVIRSPGFPGSNYPDNSNCEWYLEGPTGHYLTLTYTAFDLQSSA-NCNSD----YVEIREYNAS---GRLLGKHCGNNL---PAPMDTGDSFAYVKFVSDASANAG----------GFSLSFE-----------ASIEECGG--DLNAPFGTISSPNYPNLYPHSRICRWSITVPQGRRVTLTINDLRLEDQS-TCAFDFVEILNGLTPSAPRLDR-LCGTVPAGTQVKSSGNTMTVIFSTDSSVSNGGFTADYSSEESAVCGGILNEPG 2589          

HSP 17 Score: 53.1434 bits (126), Expect = 3.076e-6
Identity = 70/334 (20.96%), Postives = 116/334 (34.73%), Query Frame = 3
Query:  516 MFQSPNFPQ--KYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG-CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIR-FITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHN 1505
            MF SP+     +Y P++ C +    +  + + + F  F +EG     C  D + +Y      +    N   +G FCG   D +P   +S  N + + F SD    +           GFN T+  +              C    ++      ITSP YP  YP   +C ++L    +E +++  +   L                 DT  S                  T N L  + F  GD+ +  +  S D    +       G  +   F  +     N    ++ +     ++    E+  G LKSPG+P   P N  C+  L    N
Sbjct: 3173 MFGSPDIDMNGQYEPHMDCMWTIAVEVNKAINLTFISFELEGSTGTLCRYDHVTIY------DGDSANFPLVGTFCG---DVIPAPFISASNFLTVHFISDGTVSRR----------GFNATYSTV-----------NSLCGGAFNATATSQTITSPLYPNAYPPFTSCRWVLDAPSQEGVKVSVQQFHL-----------------DTSQS-----------------CTSNFLEFKDFPVGDYGQAHKFCSADSHVPD---FYSYGRTMHITFKSEAFMTGNGFSLSYQVAGCSRVY----EQEYGYLKSPGWPDLYPHNLECSIVLQAPQN 3435          
BLAST of Cubilin vs. Ensembl Zebrafish
Match: bmp1b (bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB-GENE-060818-2])

HSP 1 Score: 117.857 bits (294), Expect = 3.221e-26
Identity = 160/730 (21.92%), Postives = 284/730 (38.90%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG--------IHNRNKME-TAVLKFQTLNIPP--TPDNK-----CSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            F SP FP  Y   + C ++      EK+V+NF   +    L   N  + D Y+E++  +    +A   GR CG   D +P  +VS  + + ++F S  N              GF+  ++ I    +                +++ G I SP YP  Y  +  C + +V  +   + L+F+  ++  ++D+C  D++ + DGD+ESSP++G+ FCG +      S+ N L ++F++   + ++   +      DE  + +    +++  N +  F                    C  +I    K +G   SPG+P   P NK C + L          + +  +ME   V K+  + +    + D K     C T      + +   + +E +    V       Q     D    +   C+   V    NT  ++S       + ++ K D        E G    + ++S    G+I SP +   YPS   C + +     HRI++ F+E  +              +  C  D + +           +       CGS  P P+IS   SN++ L F SD+     GF A +         + +CG ++ +EI+  ++ S      N YP        CQW + A +    + + FH F  E     C    + ++DG   +A      CG  S  P  I ++    +    S     +KGF +
Sbjct:  316 FSSPGFPNGYAAYLHCIWRISVTPGEKIVLNFTSMD----LYRSNLCWYD-YVEVR--DGYGRSAPLKGRICG---DQLPEAIVSTDSELWIEFRSTSNWVGK----------GFSAVYEAICGGEV----------------RRDSGQIESPNYPDDYRPNKACIWKIVVPEGFHVGLVFQSFEI-EKHDNCAYDYLEVRDGDSESSPLLGR-FCGYEKPDDFKSSSNQLWMKFVSDGSVNKAGFAANFFKEIDECSRPDNAHCEQRCINTLGSFHCACDPGFELAPDRRSCAAACGGFIS---KLNGSFTSPGWPQEYPPNKNCVWQLIAPVQYRITLLFDAFEMEGNDVCKYDYVEVHSGLSADGKLHGKFCGTEKPEAITSQLNSMSVEFKSDNTVSKRGFKAQFFSDMDECSRENGGCQHECV----NTFGSYSCQCRSGFVLHSNKHD------CKEVGCDQAITSVS----GLITSPNWPDKYPSKKACTWTLSTTPGHRIKLAFEEIDME------------AHQECAYDHLEIYDGQN-----GRATSVGRFCGSKKPSPVISS--SNTMFLRFFSDNSVQKRGFKASH---------SAECGGSLKAEIKTKDLYSHAQFGDNNYP----GASDCQWVISA-EKGYGVELIFHTFEIE-EEADCGYDYVELFDGGDVKAPRLGRYCG--SGPPEEIYSAGDAIVIKFHSDDTINKKGFHV 954          

HSP 2 Score: 78.9518 bits (193), Expect = 3.023e-14
Identity = 68/280 (24.29%), Postives = 122/280 (43.57%), Query Frame = 3
Query:  414 FFLLSIYCLTNYVVYA--LDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
            F   S  C + +V+++   DC  +   D+   +   +  SPN+P KYP    C +        ++ + FE  ++E     C  D L++Y            A  +GRFCG      P+ V+S  N + L F+SD + Q+   +  H    G  G+ K  EI     TK+      F  ++               YP   +C +++   +   + L+F   ++  +  DC  D+V ++DG    +P +G+ +CG  P  +I S  + ++I+F + D I +
Sbjct:  705 FGSYSCQCRSGFVLHSNKHDCKEVG-CDQAITSVSGLITSPNWPDKYPSKKACTWTLSTTPGHRIKLAFEEIDMEAHQE-CAYDHLEIYDGQNG------RATSVGRFCG---SKKPSPVISSSNTMFLRFFSDNSVQKRGFKASHSAECG--GSLK-AEI----KTKDLYSHAQFGDNN---------------YPGASDCQWVISAEKGYGVELIFHTFEIEEEA-DCGYDYVELFDGGDVKAPRLGR-YCGSGPPEEIYSAGDAIVIKFHSDDTINK 949          

HSP 3 Score: 55.4546 bits (132), Expect = 4.742e-7
Identity = 69/286 (24.13%), Postives = 112/286 (39.16%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCG 2732
            +G  +SP F   Y +   C + I      +I + F    L             +++ C  D+V V     +    S P++   +CG  +P  ++S    + + + F S S     GF A Y+ I         CG  +  +   G I S  YP +YR N  C W +        + + F  F  E  H +CA   L + DGDS  +      CG +     F S+SN + ++F+ S  +  + GF    +   + + + S P        HC  R +   G  HC 
Sbjct:  313 AGNFSSPGFPNGYAAYLHCIWRISVTPGEKIVLNFTSMDL------------YRSNLCWYDYVEVRDGYGR----SAPLKGR-ICGDQLPEAIVS--TDSELWIEFRSTSNWVGKGFSAVYEAI---------CGGEVRRD--SGQIESPNYPDDYRPNKACIWKI-VVPEGFHVGLVFQSFEIE-KHDNCAYDYLEVRDGDSESSPLLGRFCGYEKP-DDFKSSSNQLWMKFV-SDGSVNKAGFA---ANFFKEIDECSRP-----DNAHCEQRCINTLGSFHCA 556          
BLAST of Cubilin vs. Ensembl Zebrafish
Match: bmp1b (bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB-GENE-060818-2])

HSP 1 Score: 116.701 bits (291), Expect = 7.739e-26
Identity = 160/731 (21.89%), Postives = 286/731 (39.12%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVVYRFSVDY-VKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG--------IHNRNKME-TAVLKFQTLNIPP--TPDNK-----CSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            F SP FP  Y   + C ++      EK+V+NF   +    L   N  + D Y+E++  +    +A   GR CG   D +P  +VS  + + ++F S  N              GF+  ++ I    +                +++ G I SP YP  Y  +  C + +V  +   + L+F+  ++  ++D+C  D++ + DGD+ESSP++G+ FCG +      S+ N L ++F++   + ++   +      DE  + +    +++  N +  F            ++       C  +I    K +G   SPG+P   P NK C + L          + +  +ME   V K+  + +    + D K     C T      + +   + +E +    V       Q     D    +   C+   V    NT  ++S       + ++ K D        E G    + ++S    G+I SP +   YPS   C + +     HRI++ F+E  +              +  C  D + +           +       CGS  P P+IS   SN++ L F SD+     GF A +         + +CG ++ +EI+  ++ S      N YP        CQW + A +    + + FH F  E     C    + ++DG   +A      CG  S  P  I ++    +    S     +KGF +
Sbjct:  316 FSSPGFPNGYAAYLHCIWRISVTPGEKIVLNFTSMD----LYRSNLCWYD-YVEVR--DGYGRSAPLKGRICG---DQLPEAIVSTDSELWIEFRSTSNWVGK----------GFSAVYEAICGGEV----------------RRDSGQIESPNYPDDYRPNKACIWKIVVPEGFHVGLVFQSFEI-EKHDNCAYDYLEVRDGDSESSPLLGR-FCGYEKPDDFKSSSNQLWMKFVSDGSVNKAGFAANFFKEIDECSRPDNAHCEQRCINTLGSFHCACDPGFELAPDRRSCAAAACGGFIS---KLNGSFTSPGWPQEYPPNKNCVWQLIAPVQYRITLLFDAFEMEGNDVCKYDYVEVHSGLSADGKLHGKFCGTEKPEAITSQLNSMSVEFKSDNTVSKRGFKAQFFSDMDECSRENGGCQHECV----NTFGSYSCQCRSGFVLHSNKHD------CKEVGCDQAITSVS----GLITSPNWPDKYPSKKACTWTLSTTPGHRIKLAFEEIDME------------AHQECAYDHLEIYDGQN-----GRATSVGRFCGSKKPSPVISS--SNTMFLRFFSDNSVQKRGFKASH---------SAECGGSLKAEIKTKDLYSHAQFGDNNYP----GASDCQWVISA-EKGYGVELIFHTFEIE-EEADCGYDYVELFDGGDVKAPRLGRYCG--SGPPEEIYSAGDAIVIKFHSDDTINKKGFHV 955          

HSP 2 Score: 78.9518 bits (193), Expect = 3.055e-14
Identity = 68/280 (24.29%), Postives = 122/280 (43.57%), Query Frame = 3
Query:  414 FFLLSIYCLTNYVVYA--LDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
            F   S  C + +V+++   DC  +   D+   +   +  SPN+P KYP    C +        ++ + FE  ++E     C  D L++Y            A  +GRFCG      P+ V+S  N + L F+SD + Q+   +  H    G  G+ K  EI     TK+      F  ++               YP   +C +++   +   + L+F   ++  +  DC  D+V ++DG    +P +G+ +CG  P  +I S  + ++I+F + D I +
Sbjct:  706 FGSYSCQCRSGFVLHSNKHDCKEVG-CDQAITSVSGLITSPNWPDKYPSKKACTWTLSTTPGHRIKLAFEEIDMEAHQE-CAYDHLEIYDGQNG------RATSVGRFCG---SKKPSPVISSSNTMFLRFFSDNSVQKRGFKASHSAECG--GSLK-AEI----KTKDLYSHAQFGDNN---------------YPGASDCQWVISAEKGYGVELIFHTFEIEEEA-DCGYDYVELFDGGDVKAPRLGR-YCGSGPPEEIYSAGDAIVIKFHSDDTINK 950          

HSP 3 Score: 55.4546 bits (132), Expect = 4.629e-7
Identity = 69/286 (24.13%), Postives = 112/286 (39.16%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCG 2732
            +G  +SP F   Y +   C + I      +I + F    L             +++ C  D+V V     +    S P++   +CG  +P  ++S    + + + F S S     GF A Y+ I         CG  +  +   G I S  YP +YR N  C W +        + + F  F  E  H +CA   L + DGDS  +      CG +     F S+SN + ++F+ S  +  + GF    +   + + + S P        HC  R +   G  HC 
Sbjct:  313 AGNFSSPGFPNGYAAYLHCIWRISVTPGEKIVLNFTSMDL------------YRSNLCWYDYVEVRDGYGR----SAPLKGR-ICGDQLPEAIVS--TDSELWIEFRSTSNWVGKGFSAVYEAI---------CGGEVRRD--SGQIESPNYPDDYRPNKACIWKI-VVPEGFHVGLVFQSFEIE-KHDNCAYDYLEVRDGDSESSPLLGRFCGYEKP-DDFKSSSNQLWMKFV-SDGSVNKAGFA---ANFFKEIDECSRP-----DNAHCEQRCINTLGSFHCA 556          
BLAST of Cubilin vs. Ensembl Zebrafish
Match: bmp1a (bone morphogenetic protein 1a [Source:ZFIN;Acc:ZDB-GENE-060818-1])

HSP 1 Score: 109.768 bits (273), Expect = 1.018e-23
Identity = 151/731 (20.66%), Postives = 275/731 (37.62%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY-----------FLYGIHNRNKMETAVLKFQTLNIPPTPDNK-----CSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKL 2615
            F SP +P  Y   + C ++      EK+++NF   ++        +  L  Y  ++  +     A   GRFCG   D +P+ ++S  + + ++F S  N              GF+  ++ I    +                KK+ G I SP YP  Y  +  C + +   Q   + L F+  ++  ++D+C  D++ + DG++ESSP++G+ FCG      I S+ N L ++F++   + ++   +      DE  + +    +++  N +  +                    C  +I    K +G + SPG+P   P NK C +            L+ +      +     F  +    + D++     C        + +   +++E +    V       Q     D    +   C+   V    NT  ++S       + +  K D        E G  H V ++    SG I SP +   YPS   C + +     HRI+I F E  +              +  C  D + +          S+       CG+  P P+I  S  N + + F SD+     GF A +           +CG  + +E++  ++ S      N YP        CQW + A +    + + F  F  E     C    + ++DG   ++      CG  S  P  I S  +++ ++F  S     +KGF +
Sbjct:  322 FSSPGYPNGYSAYMHCIWRISVTPGEKIILNFTSMDL-------YRSHLCWYDHVEIRDGYWRKAPLKGRFCG---DKLPDPIISTDSRLWIEFRSSSNWVGK----------GFSAVYEAICGGEV----------------KKDNGQIQSPNYPDDYRPNKVCVWKITVAQGYHVGLTFQSFEI-ERHDNCAYDYLEVRDGNSESSPLLGR-FCGYDKPDDIKSSSNQLWMKFVSDGSVNKAGFAANFFKEMDECSRPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFIT---KLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDVCKYDFVEVRSGLSADSRLHGKFCGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECV----NTFGSYSCQCRSGFVLHENKHD------CKEAGCDHVVNSV----SGTITSPNWPDKYPSKKACTWALSTTPGHRIKIAFNEIDME------------PHLECAYDHIEIYDGRD-----SKAQSLGRYCGTKKPQPII--STGNKMFIRFFSDNSVQKKGFEASH---------TAECGGRLKAEVKTKDLYSHAQFGDNNYP----GASDCQWVITA-EKGYGVELIFQTFEIE-EEADCGYDYMELFDGADTKSPRLGRYCG--SGPPEEIYSAGDSIVIKF-HSDDTINKKGFHV 960          

HSP 2 Score: 107.457 bits (267), Expect = 5.807e-23
Identity = 149/621 (23.99%), Postives = 236/621 (38.00%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEI----APINSTKEQ----------------------KESCHFYIDS--KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE-CDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            QSPN+P  Y PN  C ++        V + F+ F IE     C  D+L++  +  S  S L     LGRFCG+     P+ + S  N + + F SD +  ++          GF   F F E+     P N   EQ                      K SC         K  G ITSP +P  YP + NC + LV   + RI LLF D+     ND C  D V +  G +  S + G+ FCG +    I S  N + I F + + + +   ++      DE        Q +  N    +S          E  H      CD  + S    SG + SP +P + P  K CT+ L      +      +K     I   P  +C+   + IY  R      + + Q L          CGT  ++ + I   G  + +R  + N+      GF   +T +    ++ ++              TK    ++ F +  YP  + CQ+ I     + + + FQ F + E+            + C  D++ +      K P + +       CGS  P  +   S  +SI + F SD   +  GF+ +Y     QD ++ +
Sbjct:  436 QSPNYPDDYRPNKVCVWKITVAQGYHVGLTFQSFEIE-RHDNCAYDYLEVR-DGNSESSPL-----LGRFCGYDK---PDDIKSSSNQLWMKFVSDGSVNKA----------GFAANF-FKEMDECSRPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRITLLF-DVFETEGNDVCKYDFVEVRSGLSADSRLHGK-FCGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSYSCQCRSGFVLHENKHDCKEAGCDHVVNS---VSGTITSPNWPDKYPSKKACTWAL------STTPGHRIKIAFNEIDMEPHLECAYDHIEIYDGR------DSKAQSLGR-------YCGT--KKPQPIISTGNKMFIRFFSDNSVQK--KGFEASHTAECGGRLKAEV-------------KTKDLYSHAQFGDNNYPGASDCQWVITAEKGYGVELIFQTFEIEEE------------ADCGYDYMELFDGADTKSPRLGR------YCGSGPPEEIY--SAGDSIVIKFHSDDTINKKGFHVRYTSTKFQDTLHSR 974          

HSP 3 Score: 57.7658 bits (138), Expect = 9.491e-8
Identity = 49/179 (27.37%), Postives = 77/179 (43.02%), Query Frame = 3
Query:  948 KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY 1484
            ++  G  +SP YP  Y ++++C + +     E+I L F  +DL +++  C  DHV I DG    +P+ G+ FCG+K    I+ST + L I F                   +      KGF+ VY                 I G E        +K +G ++SP YP     NK+C +
Sbjct:  316 QESSGNFSSPGYPNGYSAYMHCIWRISVTPGEKIILNFTSMDL-YRSHLCWYDHVEIRDGYWRKAPLKGR-FCGDKLPDPIISTDSRLWIEF------------------RSSSNWVGKGFSAVYE---------------AICGGEV-------KKDNGQIQSPNYPDDYRPNKVCVW 452          

HSP 4 Score: 57.3806 bits (137), Expect = 1.106e-7
Identity = 65/237 (27.43%), Postives = 99/237 (41.77%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            SG  +SP +   Y +   C + I      +I + F    L             ++  C  D V    +I  G     P++  F CG  +P P+IS DSR   + + F S S     GF A Y+ I         CG  +  +   G I S  YP +YR N +C W +      + + + F  F  E  H +CA   L + DG+S  +      CG D   P  I S+SN + ++F++
Sbjct:  319 SGNFSSPGYPNGYSAYMHCIWRISVTPGEKIILNFTSMDL------------YRSHLCWYDHV----EIRDGYWRKAPLKGRF-CGDKLPDPIISTDSR---LWIEFRSSSNWVGKGFSAVYEAI---------CGGEVKKD--NGQIQSPNYPDDYRPNKVCVWKITVAQGYH-VGLTFQSFEIE-RHDNCAYDYLEVRDGNSESSPLLGRFCGYDK--PDDIKSSSNQLWMKFVS 520          
BLAST of Cubilin vs. Ensembl Zebrafish
Match: bmp1a (bone morphogenetic protein 1a [Source:ZFIN;Acc:ZDB-GENE-060818-1])

HSP 1 Score: 98.9821 bits (245), Expect = 2.082e-20
Identity = 150/634 (23.66%), Postives = 236/634 (37.22%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEI----APINSTKEQ----------------------KESCHFYIDS--KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQND----------DCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE-CDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQII---CGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            QSPN+P  Y PN  C ++        V + F+ F IE     C  D+L++  +  S  S L     LGRFCG+     P+ + S  N + + F SD +  ++          GF   F F E+     P N   EQ                      K SC         K  G ITSP +P  YP + NC + LV   + RI LLF D+     ND           C  D V +  G +  S + G+ FCG +    I S  N + I F + + + +   ++      DE        Q +  N    +S          E  H      CD  + S    SG + SP +P + P  K CT+ L      +      +K     I   P  +C+   + IY  R                DS  Q +   CGT  ++ + I   G  + +R  + N+      GF   +T +    ++ ++              TK    ++ F +  YP  + CQ+ I     + + + FQ F + E+            + C  D++ +      K P + +       CGS  P  +   S  +SI + F SD   +  GF+ +Y     QD ++ +
Sbjct:  436 QSPNYPDDYRPNKVCVWKITVAQGYHVGLTFQSFEIE-RHDNCAYDYLEVR-DGNSESSPL-----LGRFCGYDK---PDDIKSSSNQLWMKFVSDGSVNKA----------GFAANF-FKEMDECSRPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRITLLF-DVFETEGNDVSTRFLPLSGVCKYDFVEVRSGLSADSRLHGK-FCGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSYSCQCRSGFVLHENKHDCKEAGCDHVVNS---VSGTITSPNWPDKYPSKKACTWAL------STTPGHRIKIAFNEIDMEPHLECAYDHIEIYDGR----------------DSKAQSLGRYCGT--KKPQPIISTGNKMFIRFFSDNSVQK--KGFEASHTAECGGRLKAEV-------------KTKDLYSHAQFGDNNYPGASDCQWVITAEKGYGVELIFQTFEIEEE------------ADCGYDYMELFDGADTKSPRLGR------YCGSGPPEEIY--SAGDSIVIKFHSDDTINKKGFHVRYTSTKFQDTLHSR 984          

HSP 2 Score: 87.4261 bits (215), Expect = 8.950e-17
Identity = 74/330 (22.42%), Postives = 139/330 (42.12%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFL 1490
            F SP +P  Y   + C ++      EK+++NF   ++        +  L  Y  ++  +     A   GRFCG   D +P+ ++S  + + ++F S  N              GF+  ++ I    +                KK+ G I SP YP  Y  +  C + +   Q   + L F+  ++  ++D+C  D++ + DG++ESSP++G+ FCG      I S+ N L ++F++   + ++   +      DE  + +    +++  N +  +                    C  +I    K +G + SPG+P   P NK C + L
Sbjct:  322 FSSPGYPNGYSAYMHCIWRISVTPGEKIILNFTSMDL-------YRSHLCWYDHVEIRDGYWRKAPLKGRFCG---DKLPDPIISTDSRLWIEFRSSSNWVGK----------GFSAVYEAICGGEV----------------KKDNGQIQSPNYPDDYRPNKVCVWKITVAQGYHVGLTFQSFEI-ERHDNCAYDYLEVRDGNSESSPLLGR-FCGYDKPDDIKSSSNQLWMKFVSDGSVNKAGFAANFFKEMDECSRPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFIT---KLNGSITSPGWPKEYPPNKNCIWQL 610          

HSP 3 Score: 67.0106 bits (162), Expect = 1.243e-10
Identity = 72/281 (25.62%), Postives = 117/281 (41.64%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY-------------------------------DFIPIQDIINHKCGE----NIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFK 2612
            +G I SP + + YP N  C + ++    +RI + F  F    + V   ++  L +  C+ DFV V   +     +         CG+  P  + S  + N++ + F SD+  S  GF AQ+                                F+  ++   H C E    ++++ +  G ITS  +P +Y S   C W++      +RI I F++   E  H  CA   + IYDG   +A S    CGT    P  IST N + + F  S  +  +KGF+
Sbjct:  588 NGSITSPGWPKEYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDVS-TRFLPL-SGVCKYDFVEVRSGLSADSRLHGK-----FCGAEKPEAITS--QYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSYSCQCRSGFVLHEN--KHDCKEAGCDHVVNSV-SGTITSPNWPDKYPSKKACTWALST-TPGHRIKIAFNEIDME-PHLECAYDHIEIYDGRDSKAQSLGRYCGTKKPQP-IISTGNKMFIRFF-SDNSVQKKGFE 852          

HSP 4 Score: 57.7658 bits (138), Expect = 9.520e-8
Identity = 49/179 (27.37%), Postives = 77/179 (43.02%), Query Frame = 3
Query:  948 KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY 1484
            ++  G  +SP YP  Y ++++C + +     E+I L F  +DL +++  C  DHV I DG    +P+ G+ FCG+K    I+ST + L I F                   +      KGF+ VY                 I G E        +K +G ++SP YP     NK+C +
Sbjct:  316 QESSGNFSSPGYPNGYSAYMHCIWRISVTPGEKIILNFTSMDL-YRSHLCWYDHVEIRDGYWRKAPLKGR-FCGDKLPDPIISTDSRLWIEF------------------RSSSNWVGKGFSAVYE---------------AICGGEV-------KKDNGQIQSPNYPDDYRPNKVCVW 452          

HSP 5 Score: 57.7658 bits (138), Expect = 1.063e-7
Identity = 65/237 (27.43%), Postives = 99/237 (41.77%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            SG  +SP +   Y +   C + I      +I + F    L             ++  C  D V    +I  G     P++  F CG  +P P+IS DSR   + + F S S     GF A Y+ I         CG  +  +   G I S  YP +YR N +C W +      + + + F  F  E  H +CA   L + DG+S  +      CG D   P  I S+SN + ++F++
Sbjct:  319 SGNFSSPGYPNGYSAYMHCIWRISVTPGEKIILNFTSMDL------------YRSHLCWYDHV----EIRDGYWRKAPLKGRF-CGDKLPDPIISTDSR---LWIEFRSSSNWVGKGFSAVYEAI---------CGGEVKKD--NGQIQSPNYPDDYRPNKVCVWKITVAQGYH-VGLTFQSFEIE-RHDNCAYDYLEVRDGNSESSPLLGRFCGYDK--PDDIKSSSNQLWMKFVS 520          
BLAST of Cubilin vs. Ensembl Xenopus
Match: wdr81 (WD repeat domain 81 [Source:Xenbase;Acc:XB-GENE-6258221])

HSP 1 Score: 129.028 bits (323), Expect = 3.257e-29
Identity = 179/697 (25.68%), Postives = 271/697 (38.88%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFK-FIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIK-EITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFIT 2579
             +N     SP +PQ Y  N +C Y     + EK+ + F +  +E    GC+  ++++ I                 +C  T   +P  + S  N + + F SD +  +S              +FK F ++A           C  ++      G I +P YP  Y     C +++   + E + L F   D+     +C  + V I DG +  SP+IG+ +CG +  +   ST+  L IRF T            D    N       GF++ Y+  ++              GT  D        T G + SPGYP   P    CT+F+  I   N +    L F + N+       CS   L IY      ++  I               CG   R I   IT +G  + + L T    ++ + GF   YT          +     C   Y   +  SG+ +SP +   YP+N  C Y I    N +I + F  F LS             ++ C+ D V    +I  G     P+   F  G   P P+I  S SN + + F SDS  S +GF A +      D     CG  + S + GG  TS  +P  Y  N  C W + A  S +   I F  F  E SH +C N  L +YDG++  +    +LCG     P   S SN V+++F T
Sbjct:  701 TDNEGFISSPRWPQPYTGNKQCIYIIQQPANEKISLRFTNLELENS-SGCSLSYMEVRI-----------------YCNTT---IPPPISSSSNALWIKFKSDASVTRS--------------SFKAFYQVA-----------CGGFLTGA---GVIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDI-LAGTNCGSNFVEIRDGSSSDSPLIGK-YCGPEMPVPAQSTQRALYIRFTT------------DSSATN------HGFSISYQSLIEGCG-----------GTLTD--------TQGTITSPGYPAVYPHGIQCTWFI-SIPPGNLIR---LTFDSFNL--EHGYSCSYDYLDIYDSASAIMESRI------------GRFCG---RSIPPSITSRGNTMTVLLVTDT--NTAVEGFSARYT---------SLNATTACDASY---TEASGIFSSPNYPNRYPNNLECIYTITVETNKQILLNFTTFVLS------------TSTNCDKDHV----EIRDGGYEISPLLGKFCQG---PPPVIV-SHSNKLWVKFRSDSSYSETGFSAHW------DSATTGCGGTLTS-VSGG-FTSPNFPMPYYHNSECYWQMMA-SSGSTFEIQFEHFDLE-SHSNCQNDYLAVYDGNTTHSHLLEKLCGKRLPDPIRSSGSN-VYVKFRT 1243          

HSP 2 Score: 125.946 bits (315), Expect = 2.809e-28
Identity = 163/705 (23.12%), Postives = 271/705 (38.44%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYS----IRPFFVKL-EIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFIST-SNTVHLEFITSPKAYGQKGF 2609
            F SPNFP  Y  N  C +Q +A S     I FEHF++E     C  D+L +Y      +    ++  L + CG  L   P+ + S          S  N    +  D+ +   GF  T+K              ++C   + + +  G + S  YP  YP +  C++ +       I   F   ++  +      D+V +YDG  + + +IG  +CG +      +T   L + F + D I R                   GF + +     YV    E                      G   SPG+P+R P N+ C + +      + ++  + +F          + CS   L IY       P   +L   RPQ+  L                 +++  G  + +R  T +A+ SG G    + T  R+         PG C  V+      +G I+SP + + Y  NT C + I  +  HR+ + F++F +              +S+C  D V V                + LCG+ +P  +   S  N++ +   SD    H GF A++            CG  I ++  G  I+S  YP  Y +N  C W ++A +  N + + F D   E  + +C    + I DG++  A      CG    IP  I++ SN + ++FI++  +   KGF
Sbjct: 1158 FTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHFDLESH-SNCQNDYLAVY------DGNTTHSHLLEKLCGKRL---PDPIRS----------SGSNVYVKFRTDNSISFSGFFATYK--------------QTCQGVMIANRSRGILESLNYPNSYPHNQQCNWTIQATLGNTINYTFTTFNV--EGYFSCNDYVQLYDGPDKQARLIGT-YCGNQLPPSGTTTGTSLHVVFHSDDTITR------------------PGFQMQW-----YVNGCGEELSGPF----------------GSFTSPGFPMRYPDNRECIWHIQ-TSPGSSIQITIWEFNI-----EYHSTCSYDVLEIYGGPGVSSPRLAQLCAPRPQENPL-----------------QVSSTGNTMTVRFKT-DAYVSGRG----FNTTWREI--------PGGCGGVFQ---APNGEIHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIE------------SHSSCSFDSVTV----------------TVLCGTQLPAAI--SSTQNTMFVRLRSDGSNQHRGFSAKF---------TEACGSLITADSIGATISSPLYPANYPNNQNCMWIIQAQEPYNHVTLSFTDLEIEFRNDNCTLDYVEILDGNNPDAPVQGRYCG--RTIPHPITSFSNALVVKFISN-NSTSAKGF 1705          

HSP 3 Score: 122.094 bits (305), Expect = 5.007e-27
Identity = 146/705 (20.71%), Postives = 280/705 (39.72%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFE-HFNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRT-PKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNT---SNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIP-KGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPR--EYRSNLICQWSVKAFDSSNR-IMIHFHDFVTEGSHQSCANSILRI-YDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPK 2588
            NR +  SPN+P+ Y  N+ C + F+  S   +  +FE  F I      C   D+L+L          +  +   G+FCG +    P+ + +  N + + F SD + +            GF   ++ + +A   S          YI      G++TSP YP  YP + +C +++     E + L F++      +++C  +++ + DG   S  ++ +  CG    +   S    + +RF+T         +SG      P++    GF  +Y+ +             H                SGI++SPGYP++  P N LC ++  G                                      P    L I+ + + L +S D   C  D+ EI+E    G ++ +  N+   S+  +S    ++ + + + + G   ++             +  SG+I+SP +  LYP N  C++ I      R+ +      L +               C+ D+V V      + P++ +      LCG+  P   +  S  N++ + F++D   S  GF A ++   ++D +   CG   +++  GG+ +S  Y +   Y  NL C+W ++  ++ N    I F     E  H +C    + + +D    +  + LCG ++        ++ V + F+++ +
Sbjct: 2074 NRGLITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEIPNSDSTCGTGDYLELKNGPDDSSPPMGTSTRNGKFCGTS---APSTMHTTDNEMFVHFVSDNSNEGK----------GFQLKYEALSLACGGS---------IYISESDPSGFVTSPKYPENYPMNADCVWIITVPNGEAVELEFKEQFYIEPSENCSSNYLELRDGADASKRLLAK-LCGNALPITYKSLGTAMYLRFMT---------DSG-----TPRV----GFKAMYKIAT--------CGGTHF-------------GQSGIIQSPGYPLQNYPDNSLCEWYFTG--------------------------------------PTGHYLTIQFEAMDLHNSTD---CSRDFVEIREYNASGRILGVFCNSMVPSDLVTSDSFAYIKFVSDQSENGRGFRIRYDASTEECGGDYTASSGIISSPNYPNLYPHNRVCEWRITVPAGRRVTLTINALLLQDQ------------QNCDYDYVAVYNGYQNQSPLLRK------LCGNVAPETEVKSS-GNTMRVIFVTDGSVSSGGFLATFN--SMEDAV---CG-GALADPTGGHFSSPGYDQVNNYTRNLNCEWIIQNPNTENSTTFISFKRLQLE-YHLNCQRDFIELRFDNADGELITRLCGRNTPSVPLAIVASQVWVHFVSNAE 2649          

HSP 4 Score: 110.923 bits (276), Expect = 1.224e-23
Identity = 175/732 (23.91%), Postives = 278/732 (37.98%), Query Frame = 3
Query:  519 FQSPNFPQ--KYPPNIRCKYQFVAKSQEK--VVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNIS------STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIM-IHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCG--TDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGF 2666
            F SP + Q   Y  N+ C++     + E     I+F+   +E  L  C +DF++L  +         + + + R CG     VP  +V+    + + F S+   +           +GFN ++ F +   I +                E G I SP +P  Y S  +C++LL   +   I L F   D+ +HQ   C  D VTI +G +  SP+IGQ FCG      I S  N LL+ F + D                   L  +GF     ++ D +     +  +                 SG ++SP +P   P N  CT+ +   H  +  E   L F      P  +  C             +VK+    ++ +L        CG         T   P++  R              VI  TF+           PG   F   IS      +  SG I SP +   Y +N  C Y I    N  I ++FQ F +        +  S  + +C  D +++       P+ +       LCG+SVP  +   S   S+SL F +DS  +  GF A Y  IP     N             G + S  Y   +Y +N+ C + V      N+I+ + F++   E S  SC    + +YDG    +SS L G    + +P  + S+SN + L F+T       +G++  + + L   P   C G+
Sbjct: 2557 FSSPGYDQVNNYTRNLNCEWIIQNPNTENSTTFISFKRLQLEYHL-NCQRDFIELRFDNA-------DGELITRLCGRNTPSVPLAIVASQ--VWVHFVSNAEVEN----------IGFNASYSFTDCGGIQA---------------GEYGVIASPNFPASYNSMSHCAWLLDAPEGHIITLSFIHFDIESHQ--ICRWDSVTILNGASPGSPLIGQ-FCGTTSPGTIQSGSNKLLVIFNSDD------------------SLHGRGFYA--NWTSDSLGCGGHVHAD-----------------SGTIRSPAWPQHFPANSRCTWTIE-THASSHYE---LSFNNNFHIPDDNGHCQRS----------YVKVWSGAEEELLATG-----CGD--------TAPAPVISPRN-------------VIRVTFQ-------SQDAPGSGFFASFISKCGANFTNSSGRIMSPNYPNKYGNNLRCNYTIHAEANMFIVLFFQNFEV--------ECKSKTSLSCSKDGLKIFGGERTSPLAN-------LCGASVPASI---SARGSMSLNFYTDSDINMHGFMATYRVIPCGGTFNASY----------GTLRSPTYAFTDYHNNMNCTYHVTV--QENKIIELKFNELDLEAS-SSCLYDYIAVYDG--LNSSSPLLGRYCGNVLPPILRSSSNNLFLLFVTD-NHITSRGWRATFRQTLG--PMQGCGGY 3130          

HSP 5 Score: 107.071 bits (266), Expect = 1.552e-22
Identity = 156/705 (22.13%), Postives = 256/705 (36.31%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLV------LLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIP-----IQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFI-STSNTVHLEFITSPKAYG 2597
             SPN+P+ Y  N  C +        +V++ F  F+IE                  S  S  F++  +   CG  L   P  + S  N + +   SD + Q            GF+  F               E+C   I +      I+SP YP  YP++ NC +++   +    + L F DL++  +ND+C  D+V I DG+   +P+ G+ +CG      I S  N L+++FI+ +                      KGF+  +  S      T  ME                   +G   SP YP   P N  C +                     NI  +P N+     L  +S++                DS     C  DY EI+E    G L+      +L  N +      I G +++  F  D  + G   +    H   N      G I SP + + YP  +   + I  +++  I+    E  + +            +S C  D +    KI  GP     +  ++ CG + P  + S    +S+++ F SD+  +  GF  ++  +         I    CG  + +      + S  +P  Y S L C W +KA  S+  + I   D      H+SC    L I DGD+  +          +P  I S+ +++ + F T     G
Sbjct: 1506 HSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIE------------------SHSSCSFDSVTVTVLCGTQL---PAAISSTQNTMFVRLRSDGSNQHR----------GFSAKFT--------------EACGSLITADSIGATISSPLYPANYPNNQNCMWIIQAQEPYNHVTLSFTDLEIEFRNDNCTLDYVEILDGNNPDAPVQGR-YCGRTIPHPITSFSNALVVKFISNNSTS------------------AKGFHATFAASTSACGGTLHME-------------------TGAFNSPSYPENYPANTECVW---------------------NILSSPGNRL----LLTFSVQ--------------HSDS-----CSHDYLEIREGNETGSLMGRFCGDILPSNITT-----ITGHILWIKFVSDGSLSGSGFQATFSHLFGNNIGGDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDIED------------HSGCIYDKL----KIYDGPDTHYHVIGTY-CGITPPPDIFSS--GSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGGILRTGDTPLFLFSPGWPNNYASYLDCTWVIKAPGSTVELNILSVDIE---KHRSCNYDKLVIRDGDNNNSPQLAVVCGKGVPGPIRSSGDSMFIRFSTDGSVSG 2056          

HSP 6 Score: 107.071 bits (266), Expect = 1.688e-22
Identity = 169/726 (23.28%), Postives = 266/726 (36.64%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQ-IICGTDYREIKE-ITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNS-TCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW------SEILQRLPDGSCPG 2663
            F SP FP +YP N  C +         + I    FNIE     C+ D L++Y           ++  L + C       P  V S  N + + F +D           ++   GFN T++           E    C     +   E  I SP YP  Y  +  CS+++  +   R+ L FRD D+   +  C  D VT+               CG +    I ST+N + +R                        L+  G N    FS  + +    +     IG                + SP YP   P N+ C +    I  +       L F  L I    DN C+   + I                   PD+P Q   CG   R I   IT     ++++  ++N+ S+   GF  + TF       G     G  H        ++G  NSP + + YP+NT C ++I+ +  +R+ + F                S+++S +C  D++ + +    G ++ +       CG  +P   I+    + + + F+SD   S SGF A +         +H  G NI  +   G I S  +PR Y       W +   DSS  I     +   E  H  C    L+IYDG    +      CG  +  P   S+ +++ ++F TS  +   KGF L W      SE    +  G+C G
Sbjct: 1386 FTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNIE-YHSTCSYDVLEIY------GGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRFKTDA----------YVSGRGFNTTWR-----------EIPGGCGGVFQAPNGE--IHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDI-ESHSSCSFDSVTV------------TVLCGTQLPAAISSTQNTMFVR------------------------LRSDGSNQHRGFSAKFTEACGSLITADSIG--------------ATISSPLYPANYPNNQNCMWI---IQAQEPYNHVTLSFTDLEIEFRNDN-CTLDYVEILDGNN--------------PDAPVQGRYCG---RTIPHPITSFSNALVVKFISNNSTSAK--GF--HATFAASTSACG-----GTLHM-------ETGAFNSPSYPENYPANTECVWNILSSPGNRLLLTF----------------SVQHSDSCSHDYLEIREGNETGSLMGR------FCGDILPSN-ITTITGHILWIKFVSDGSLSGSGFQATF---------SHLFGNNIGGDR--GQIASPLWPRNYPHYSNYLWKINV-DSSQIIQARILEIDIE-DHSGCIYDKLKIYDGPDTHYHVIGTYCGI-TPPPDIFSSGSSMTVQF-TSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGG 1955          

HSP 7 Score: 106.686 bits (265), Expect = 2.050e-22
Identity = 155/673 (23.03%), Postives = 258/673 (38.34%), Query Frame = 3
Query:  519 FQSPNFP-QKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSP--TYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQN-DDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGT 2519
             +SP +    Y  N+ C Y    +  + + + F   ++E     C  D++ +Y  + S      ++  LGR+CG+ L   P  + S  N + L F +D          +H+   G+  TF+         T    + C  Y+      G   SP     G Y S+LNC++ ++     +I L F    L  Q+   C  D+V ++DG T  S + G  +CG       LST N+L + F++   ++R                  +GFN  Y            + K+ + G        ++  TS    SP +P   P    C + +   +    K+     + QT       D  CS            +++L+  P             CGT+   I +    G   ++   + N       GF+  Y             +   C   YN      G + SP + + YP N  C   +    NH I ++F  FS+           +  +S C  DF+ V        P+I +       CG ++P P+ S  ++N + L F SD V S  G+   +   P      + CG  +  +   G+ TS  YP  Y +N  C+W++ A      I ++F     + S  SC ++ L++Y+G    ASS L GT
Sbjct: 3018 LRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDLEAS-SSCLYDYIAVYDGLNS------SSPLLGRYCGNVL---PPILRSSSNNLFLLFVTD----------NHITSRGWRATFR--------QTLGPMQGCGGYL--TNAAGTFGSPDSNLDGRYDSNLNCAWHIIAPINTQINLTFSAFFLEAQSRSTCRYDYVKVFDGSTTDSNLQGT-YCGSSRPAPFLSTSNVLTVLFVSDSSVER------------------QGFNASY------------VTKDLLCGGS-----YNATSTSVTTSSPNFPNLYPPFTSCMWIIDAPVKEHVKLSVQSFRLQT-------DGDCSQN----------YIELKDSPGD----QGQVHRYCGTETFGIPDFYSYGQTAVVVFKSQNYMQGN--GFIFTY-------------QTANCSREYN---QTFGYLKSPGWPENYPHNAECTTVLRAPPNHTISLFFNSFSI----------EATSSSICY-DFLEVRNGSDSNSPLIGK------YCGDTLPDPIFS--KNNVLRLFFKSDLVLSSRGYEITWTSSP------NACGGTLFGD--HGSFTSPSYPGSYSNNTNCEWTILA-PLGRLITLNFAVLNIDDS-GSCDSNYLKVYNGP--DASSALAGT 3554          

HSP 8 Score: 105.145 bits (261), Expect = 6.244e-22
Identity = 162/712 (22.75%), Postives = 263/712 (36.94%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG--CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDIN-TQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTE-SSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSI----YSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +  +P++P  Y     C++       E V + F  F+I   L G  C  +F+++  +  S +S L     +G++CG     +P    S    + + F +D + T   ++      + G  GT                            +G ITSP YP +YP  + C++ +       IRL F   +L H    C  D++ IYD  +      IG+ FCG      I S  N + +                        LL       V  FS  Y  +           T CD    S  + SGI  SP YP R P N  C Y +    N+  +    L F T  +  +    C    + I    Y I P   K    P  +++  S                      + ++  + +++S    GF  ++      G  G +             ++ SG   SP F   Y  N+ C + ++ ++     I F+ F L              +S C+ D++ V          S  +E   LCG  +P P+   S  +++ + F +D+  S SGF+A Y            C   +I+    G + S  YP  Y  N  C W+++A    N I   F  F  EG + SC N  +++YDG   QA      CG +   P+  +T  ++H+ F  S     + GF++ W
Sbjct:  807 VIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDI---LAGTNCGSNFVEIR-DGSSSDSPL-----IGKYCG---PEMPVPAQSTQRALYIRFTTDSSATNHGFSISYQSLIEGCGGTLT------------------------DTQGTITSPGYPAVYPHGIQCTWFISIPPGNLIRLTFDSFNLEH-GYSCSYDYLDIYDSASAIMESRIGR-FCGRSIPPSITSRGNTMTV------------------------LLVTDTNTAVEGFSARYTSLNAT--------TACD---ASYTEASGIFSSPNYPNRYPNNLECIYTITVETNKQIL----LNFTTFVL--STSTNCDKDHVEIRDGGYEISPLLGKFCQGPPPVIVSHSNK--------------------LWVKFRSDSSYSET--GFSAHWD-SATTGCGGTL-------------TSVSGGFTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHFDLE------------SHSNCQNDYLAVYDG---NTTHSHLLEK--LCGKRLPDPI--RSSGSNVYVKFRTDNSISFSGFFATY---------KQTCQGVMIANRSRGILESLNYPNSYPHNQQCNWTIQA-TLGNTINYTFTTFNVEG-YFSC-NDYVQLYDGPDKQARLIGTYCG-NQLPPSGTTTGTSLHVVF-HSDDTITRPGFQMQW 1370          

HSP 9 Score: 98.5969 bits (244), Expect = 5.990e-20
Identity = 167/758 (22.03%), Postives = 289/758 (38.13%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQ---EFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENI-ISEIR-GGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIP-AFISTSNTVHLEFIT---SPKA---------------YGQKGFKLIWSEILQRLPDGS-CPGFECLKTKHCISRQLE 2708
            F SP++P+ YP N  C +  ++    ++++ F   + +     C+ D    Y+E++    T      +GRFCG  L    N      +I+ + F SD +   S          GF  TF  +                F  +   + G I SP +P  YP + N  + +  +  + I+    ++D+   +  CI D + IYDG      +IG  +CG  P   I S+ + + ++F            S + I M   LL+   +  V  FS ++  I             C   +++ + T   L SPG+P        CT+ +       K   + ++   L++       C+            + KL IR       +SP   ++CG        I   G  + +R +T  + S    G     ++ +  G        G  H          G+I SP + + Y +N  C +  +  +   I  +F+   E   S+       Y  LKN   +             P +         CG+S P  +   +  N + + F+SD+     GF  +Y+ + +       CG +I ISE    G +TS +YP  Y  N  C W +   +     +     F  E S ++C+++ L + DG   S +  ++LCG  +A+P  + S    ++L F+T   +P+                +GQ G        LQ  PD S C  +    T H ++ Q E
Sbjct: 1727 FNSPSYPENYPANTECVWNILSSPGNRLLLTFSVQHSDS----CSHD----YLEIREGNET---GSLMGRFCGDILPS--NITTITGHILWIKFVSDGSLSGS----------GFQATFSHL----------------FGNNIGGDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDI-EDHSGCIYDKLKIYDGPDTHYHVIGT-YCGITPPPDIFSSGSSMTVQFT-----------SDNSINMKGFLLE---WLAVDAFSENFPTIAPGA---------CGGILRTGD-TPLFLFSPGWPNNYASYLDCTWVI-------KAPGSTVELNILSVDIEKHRSCN------------YDKLVIRDGDNN--NSPQLAVVCGKGVP--GPIRSSGDSMFIRFSTDGSVS----GTGFNASYHKSCG--------GYLH-------ANRGLITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEIPNSDSTCGTGDYLELKNGPDD-----------SSPPMGTSTRNGKFCGTSAPSTM--HTTDNEMFVHFVSDNSNEGKGFQLKYEALSL------ACGGSIYISESDPSGFVTSPKYPENYPMNADCVWIITVPNGEAVELEFKEQFYIEPS-ENCSSNYLELRDGADASKRLLAKLCG--NALPITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIATCGGTHFGQSGIIQSPGYPLQNYPDNSLCEWYFTGPTGHYLTIQFE 2355          

HSP 10 Score: 82.8037 bits (203), Expect = 4.078e-15
Identity = 68/251 (27.09%), Postives = 116/251 (46.22%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIE---GLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGI-YPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFI 1241
             N+     SPN+P KY  N+RC Y   A++   +V+ F++F +E        C+KD L ++   ++          L   CG +   VP   +S    + L+FY+D +          + + GF  T++ I   P   T                 G + SPTY    Y +++NC+Y +   + + I L F +LDL   +  C+ D++ +YDG   SSP++G+ +CG      + S+ N L + F+T + I
Sbjct: 2897 TNSSGRIMSPNYPNKYGNNLRCNYTIHAEANMFIVLFFQNFEVECKSKTSLSCSKDGLKIFGGERT--------SPLANLCGAS---VPA-SISARGSMSLNFYTDSD----------INMHGFMATYRVI---PCGGTF------------NASYGTLRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDL-EASSSCLYDYIAVYDGLNSSSPLLGR-YCGNVLPPILRSSSNNLFLLFVTDNHI 3108          

HSP 11 Score: 82.4185 bits (202), Expect = 5.859e-15
Identity = 150/695 (21.58%), Postives = 248/695 (35.68%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVV----INFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSEL---CGTDSAIPAFISTSNTVHLEFIT 2579
            F  PN P            +V K++ + V    I F +F++E   P C+ +FL ++ +  S+ S +     LG++CG     VP  + S HN +   F+SD           H+   G    F+        S + ++  C   +   +  G I SP YPG YP + +C + +  N    I   F  L L +H+N  C +D++ I DG      ++G+ +C       + ++     + F                   +    + +GF++ Y  S            N                  G + SP +P     NK C Y +    N    E   L+F  L +  +     S   + IY        +      L +    D  +  + ++   ++ C                   GGF+                             T +GVI++P +   Y    TC++ I       + + F  F +            L  + C  +FV    +I  G     P+   + CG  +P P  S  R  ++ + F +DS  ++ GF   Y     Q +I   CG  +      G ITS  YP  Y   + C W + +    N I + F  F  E  + SC+   L IYD  S    S +   CG  S  P+  S  NT+ +  +T
Sbjct:  469 FGYPNNPGTDQHGHMLSCMWVIKTEPRKVRILHITFTNFHLEQSTP-CSTEFLQVH-DGDSISSFM-----LGKYCG---TGVPQEISSSHNSLFFWFHSD-----------HISSAG---GFRI-------SWESRQPECGGEL--METHGSIMSPGYPGNYPPNRDCYWTISTNPGLYITFAFGTLSLEDHEN--CGKDYLEIRDGLLPQDRVLGK-YCSTLSPAPLQTSGPYAWLHF------------------HSDSTGEDRGFHITYITSPSDPGCGGNFTDNE-----------------GFISSPRWPQPYTGNKQCIYIIQQPAN----EKISLRFTNLELENSSGCSLSYMEVRIYCNTTIPPPISSSSNALWIKFKSDASVTRSSFKAFYQVAC-------------------GGFL-----------------------------TGAGVIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDI------------LAGTNCGSNFV----EIRDGSSSDSPLIGKY-CGPEMPVPAQSTQR--ALYIRFTTDSSATNHGFSISY-----QSLI-EGCGGTLTD--TQGTITSPGYPAVYPHGIQCTWFI-SIPPGNLIRLTFDSFNLEHGY-SCSYDYLDIYDSASAIMESRIGRFCG-RSIPPSITSRGNTMTVLLVT 1010          

HSP 12 Score: 75.485 bits (184), Expect = 7.021e-13
Identity = 70/253 (27.67%), Postives = 106/253 (41.90%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRL 2642
            G   SP F   YP N  C + I  +    I+I   EF++        +YH    STC  D    + +I  GP +S P             PL   S  N++++ F +D+  S  GF   +  IP        CG   + +   G I S  YPR Y  N  C W ++  D  +R+++ F DF  E SH SC+   + +         + LCGT   +PA IS++       + S  +   +GF   ++E    L
Sbjct: 1384 GSFTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNI--------EYH----STCSYD----VLEIYGGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRFKTDAYVSGRGFNTTWREIP------GGCGG--VFQAPNGEIHSPNYPRPYEDNTECSWVIRV-DFGHRVLLTFRDFDIE-SHSSCSFDSVTV---------TVLCGTQ--LPAAISSTQNTMFVRLRSDGSNQHRGFSAKFTEACGSL 1599          

HSP 13 Score: 73.559 bits (179), Expect = 2.867e-12
Identity = 68/269 (25.28%), Postives = 120/269 (44.61%), Query Frame = 3
Query:  468 CDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQE---KVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILS-TRNMLLIRFITGDFIKRSRLES 1262
            C  +  +D IG        SP +P  YP N  C +  + ++QE    V ++F    IE     C  D++++      L+    +A   GR+CG T   +P+ + S  N +V+ F S+ +T             GF+ TF         ST     + H       E G   SP+YP  YP++  C + ++ +   R+ L F        +D C  D++ I +G+ E+  ++G+ FCG+     I + T ++L I+F++   +  S  ++
Sbjct: 1596 CGSLITADSIGA----TISSPLYPANYPNNQNCMW--IIQAQEPYNHVTLSFTDLEIEFRNDNCTLDYVEI------LDGNNPDAPVQGRYCGRT---IPHPITSFSNALVVKFISNNSTSAK----------GFHATFA-------ASTSACGGTLHM------ETGAFNSPSYPENYPANTECVWNILSSPGNRLLLTFSV----QHSDSCSHDYLEIREGN-ETGSLMGR-FCGDILPSNITTITGHILWIKFVSDGSLSGSGFQA 1820          

HSP 14 Score: 72.7886 bits (177), Expect = 4.518e-12
Identity = 148/719 (20.58%), Postives = 272/719 (37.83%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY-FLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLP---DSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGT--DSAIPAFISTSNT-VHLEFITSPKAYGQKGFKL 2615
            + + IG  +R    SP +P+ YP      ++    S + +       +IE    GC      +Y ++K  +    +   +G +CG T    P  + S  + + + F SD +        + + +  F+  F    IAP         +C   + +     ++ SP +P  Y S+L+C++++       + L    +D+  ++  C  D + I DGD  +SP +    CG+     I S+ + + IRF T   +  +                  GFN  Y  S                   C  ++ ++    G++ SP YP     N  CT+ FL          T    F+     P  D+ C TG          +++L+  P     P    + +   CGT        T     V    + SN       GF + Y          + +       +Y   S  SG + SP + + YP N  C + I   N   + + F+E           +++   +  C  +++    ++  G   S+ +    LCG+++  P+   S   ++ L F++DS     GF A Y            CG     +   G I S  YP + Y  N +C+W      + + + I F       S   C+   + I +   + AS  + G   +S +P+ + TS++  +++F++     G +GF++
Sbjct: 1826 FGNNIG-GDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDIEDH-SGC------IYDKLKIYDGPDTHYHVIGTYCGIT---PPPDIFSSGSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFP--TIAP--------GACGGILRTGDTPLFLFSPGWPNNYASYLDCTWVIKA-PGSTVELNILSVDI-EKHRSCNYDKLVIRDGDNNNSPQLAV-VCGKGVPGPIRSSGDSMFIRFSTDGSVSGT------------------GFNASYHKS-------------------CGGYLHANR---GLITSPNYPEHYSANLNCTWHFLV-----TSGFTIAAHFEPTFEIPNSDSTCGTGD---------YLELKNGPDDSSPPMGTSTRNGKFCGTSAPSTMHTTDNEMFVHFVSDNSNEGK----GFQLKY----------EALSLACGGSIYISESDPSGFVTSPKYPENYPMNADCVWIITVPNGEAVELEFKE-----------QFYIEPSENCSSNYL----ELRDGADASKRLLAK-LCGNAL--PITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIA--------TCGGTHFGQ--SGIIQSPGYPLQNYPDNSLCEWYFTG-PTGHYLTIQFEAMDLHNS-TDCSRDFVEIRE---YNASGRILGVFCNSMVPSDLVTSDSFAYIKFVSDQSENG-RGFRI 2418          

HSP 15 Score: 63.929 bits (154), Expect = 2.187e-9
Identity = 125/584 (21.40%), Postives = 208/584 (35.62%), Query Frame = 3
Query:  933 FYIDSKKEE--GYITSPTYPGIYPS--------HLNCSYLLVGNQKERIRLL---FRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDF-VTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQ 2636
            F  +S K+E  G +T  T    YP+        H+     ++  +  ++R+L   F +  L  Q+  C  + + ++DGD+ SS ++G+ +CG     +I S+ N L   F +            D I          GF + +       +   E+ + H                 G + SPGYP   P N+ C    Y   + N        F TL++       C    L I        +  + PQ  VL        C T       +   GP   L  + S++     G  + Y T   D G  G   +               G I+SP + Q Y  N  C Y I    N +I + F    L         Y                            +E    C +++P P+   S SN++ + F SD+  + S F A Y            CG  +      G I +  YP  Y     C+W +   +    + + F+ F +  G++  C ++ + I DG S  +    + CG +  +PA  ST   +++ F T   A    GF + +  +++
Sbjct:  449 FNCESPKQECGGVLTGLTGSFGYPNNPGTDQHGHMLSCMWVIKTEPRKVRILHITFTNFHL-EQSTPCSTEFLQVHDGDSISSFMLGK-YCGTGVPQEISSSHNSLFFWFHS------------DHIS------SAGGFRISWE--SRQPECGGELMETH-----------------GSIMSPGYPGNYPPNRDC----YWTISTNPGLYITFAFGTLSL--EDHENCGKDYLEI--------RDGLLPQDRVLGK-----YCST--LSPAPLQTSGPYAWLHFH-SDSTGEDRGFHITYITSPSDPGCGGNFTD-------------NEGFISSPRWPQPYTGNKQCIYIIQQPANEKISLRFTNLELENSSGCSLSY----------------------------MEVRIYCNTTIPPPI--SSSSNALWIKFKSDASVTRSSFKAFYQV---------ACGGFLTG---AGVIHTPHYPDAYFRERTCEWIITQPEGE-VVSLTFNSFDILAGTN--CGSNFVEIRDGSSSDSPLIGKYCGPEMPVPA-QSTQRALYIRFTTDSSAT-NHGFSISYQSLIE 911          
BLAST of Cubilin vs. Ensembl Xenopus
Match: wdr81 (WD repeat domain 81 [Source:Xenbase;Acc:XB-GENE-6258221])

HSP 1 Score: 128.257 bits (321), Expect = 6.407e-29
Identity = 167/710 (23.52%), Postives = 278/710 (39.15%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYS----IRPFFVKL-EIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFIST-SNTVHLEFITSPKAYGQKGFKLIWS 2624
            F SPNFP  Y  N  C +Q +A S     I FEHF++E     C  D+L +Y      +    ++  L + CG  L   P+ + S          S  N    +  D+ +   GF  T+K              ++C   + + +  G + S  YP  YP +  C++ +       I   F   ++  +      D+V +YDG  + + +IG  +CG +      +T   L + F + D I R                   GF + +     YV    E                      G   SPG+P+R P N+ C + +      + ++  + +F   NI     + CS   L IY       P   +L   RPQ+  L                 +++  G  + +R  T +A+ SG G    + T  R+         PG C  V+      +G I+SP + + Y  NT C + I  +  HR+ + F++F +              +S+C  D V V          S P+  + LCG+ +P  +   S  N++ +   SD    H GF A++            CG  I ++  G  I+S  YP  Y +N  C W ++A +  N + + F D   E  + +C    + I DG++  A      CG    IP  I++ SN + ++FI++  +   KGF   ++
Sbjct: 1162 FTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHFDLESH-SNCQNDYLAVY------DGNTTHSHLLEKLCGKRL---PDPIRS----------SGSNVYVKFRTDNSISFSGFFATYK--------------QTCQGVMIANRSRGILESLNYPNSYPHNQQCNWTIQATLGNTINYTFTTFNV--EGYFSCNDYVQLYDGPDKQARLIGT-YCGNQLPPSGTTTGTSLHVVFHSDDTITR------------------PGFQMQW-----YVNGCGEELSGPF----------------GSFTSPGFPMRYPDNRECIWHIQ-TSPGSSIQITIWEF---NI--EYHSTCSYDVLEIYGGPGVSSPRLAQLCAPRPQENPL-----------------QVSSTGNTMTVRFKT-DAYVSGRG----FNTTWREI--------PGGCGGVFQ---APNGEIHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIE------------SHSSCSFDSVTV-------STYSDPL--AVLCGTQLPAAI--SSTQNTMFVRLRSDGSNQHRGFSAKF---------TEACGSLITADSIGATISSPLYPANYPNNQNCMWIIQAQEPYNHVTLSFTDLEIEFRNDNCTLDYVEILDGNNPDAPVQGRYCG--RTIPHPITSFSNALVVKFISN-NSTSAKGFHATFA 1721          

HSP 2 Score: 121.709 bits (304), Expect = 5.931e-27
Identity = 146/705 (20.71%), Postives = 280/705 (39.72%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFE-HFNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRT-PKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNT---SNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIP-KGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPR--EYRSNLICQWSVKAFDSSNR-IMIHFHDFVTEGSHQSCANSILRI-YDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPK 2588
            NR +  SPN+P+ Y  N+ C + F+  S   +  +FE  F I      C   D+L+L          +  +   G+FCG +    P+ + +  N + + F SD + +            GF   ++ + +A   S          YI      G++TSP YP  YP + +C +++     E + L F++      +++C  +++ + DG   S  ++ +  CG    +   S    + +RF+T         +SG      P++    GF  +Y+ +             H                SGI++SPGYP++  P N LC ++  G                                      P    L I+ + + L +S D   C  D+ EI+E    G ++ +  N+   S+  +S    ++ + + + + G   ++             +  SG+I+SP +  LYP N  C++ I      R+ +      L +               C+ D+V V      + P++ +      LCG+  P   +  S  N++ + F++D   S  GF A ++   ++D +   CG   +++  GG+ +S  Y +   Y  NL C+W ++  ++ N    I F     E  H +C    + + +D    +  + LCG ++        ++ V + F+++ +
Sbjct: 2085 NRGLITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEIPNSDSTCGTGDYLELKNGPDDSSPPMGTSTRNGKFCGTS---APSTMHTTDNEMFVHFVSDNSNEGK----------GFQLKYEALSLACGGS---------IYISESDPSGFVTSPKYPENYPMNADCVWIITVPNGEAVELEFKEQFYIEPSENCSSNYLELRDGADASKRLLAK-LCGNALPITYKSLGTAMYLRFMT---------DSG-----TPRV----GFKAMYKIAT--------CGGTHF-------------GQSGIIQSPGYPLQNYPDNSLCEWYFTG--------------------------------------PTGHYLTIQFEAMDLHNSTD---CSRDFVEIREYNASGRILGVFCNSMVPSDLVTSDSFAYIKFVSDQSENGRGFRIRYDASTEECGGDYTASSGIISSPNYPNLYPHNRVCEWRITVPAGRRVTLTINALLLQDQ------------QNCDYDYVAVYNGYQNQSPLLRK------LCGNVAPETEVKSS-GNTMRVIFVTDGSVSSGGFLATFN--SMEDAV---CG-GALADPTGGHFSSPGYDQVNNYTRNLNCEWIIQNPNTENSTTFISFKRLQLE-YHLNCQRDFIELRFDNADGELITRLCGRNTPSVPLAIVASQVWVHFVSNAE 2660          

HSP 3 Score: 117.087 bits (292), Expect = 1.598e-25
Identity = 165/710 (23.24%), Postives = 274/710 (38.59%), Query Frame = 3
Query:  519 FQSPNFP-QKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSP--TYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQN-DDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG-DSFQA-SSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
             +SP +    Y  N+ C Y    +  + + + F   ++E     C  D++ +Y  + S      ++  LGR+CG+ L   P  + S  N + L F +D          +H+   G+  TF+         T    + C  Y+      G   SP     G Y S+LNC++ ++     +I L F    L  Q+   C  D+V ++DG T  S + G  +CG       LST N+L + F++   ++R                  +GFN  Y            + K+ + G        ++  TS    SP +P   P    C + +   +    K+     + QT       D  CS                      + L DSP     CGT+   I +    G   ++   + N       GF+  Y             +   C   YN      G + SP + + YP N  C   +    NH I ++F  FS+           +  +S C  DF+ V        P+I +       CG ++P P+ S  ++N + L F SD V S  G+   +   P      + CG  +  +   G+ TS  YP  Y +N  C+W++ A      I ++F     + S  SC ++ L++Y+G D+  A +   CG  S+I    ST++ + ++F     A    GF+L W
Sbjct: 3029 LRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDLEAS-SSCLYDYIAVYDGLNS------SSPLLGRYCGNVL---PPILRSSSNNLFLLFVTD----------NHITSRGWRATFR--------QTLGPMQGCGGYL--TNAAGTFGSPDSNLDGRYDSNLNCAWHIIAPINTQINLTFSAFFLEAQSRSTCRYDYVKVFDGSTTDSNLQGT-YCGSSRPAPFLSTSNVLTVLFVSDSSVER------------------QGFNASY------------VTKDLLCGGS-----YNATSTSVTTSSPNFPNLYPPFTSCMWIIDAPVKEHVKLSVQSFRLQT-------DGDCSQ-------------------NYIELKDSPVVHRYCGTETFGIPDFYSYGQTAVVVFKSQNYMQGN--GFIFTY-------------QTANCSREYN---QTFGYLKSPGWPENYPHNAECTTVLRAPPNHTISLFFNSFSI----------EATSSSICY-DFLEVRNGSDSNSPLIGK------YCGDTLPDPIFS--KNNVLRLFFKSDLVLSSRGYEITWTSSP------NACGGTLFGD--HGSFTSPSYPGSYSNNTNCEWTILA-PLGRLITLNFAVLNIDDS-GSCDSNYLKVYNGPDASSALAGTFCGMGSSIAPLTSTTHQMFIKFHAEQVAL-PSGFRLTW 3598          

HSP 4 Score: 110.923 bits (276), Expect = 1.125e-23
Identity = 172/726 (23.69%), Postives = 270/726 (37.19%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQ-IICGTDYREIKE-ITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNS-TCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW------SEILQRLPDGSCPG 2663
            F SP FP +YP N  C +         + I    FNIE     C+ D L++Y           ++  L + C       P  V S  N + + F +D           ++   GFN T++           E    C     +   E  I SP YP  Y  +  CS+++  +   R+ L FRD D+   +  C  D VT+    T S P+     CG +    I ST+N + +R                        L+  G N    FS  + +    +     IG                + SP YP   P N+ C +    I  +       L F  L I    DN C+   + I                   PD+P Q   CG   R I   IT     ++++  ++N+ S+   GF  + TF       G     G  H        ++G  NSP + + YP+NT C ++I+ +  +R+ + F                S+++S +C  D++ + +    G ++ +       CG  +P   I+    + + + F+SD   S SGF A +         +H  G NI  +   G I S  +PR Y       W +   DSS  I     +   E  H  C    L+IYDG    +      CG  +  P   S+ +++ ++F TS  +   KGF L W      SE    +  G+C G
Sbjct: 1390 FTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNIE-YHSTCSYDVLEIY------GGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRFKTDA----------YVSGRGFNTTWR-----------EIPGGCGGVFQAPNGE--IHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDI-ESHSSCSFDSVTV---STYSDPL--AVLCGTQLPAAISSTQNTMFVR------------------------LRSDGSNQHRGFSAKFTEACGSLITADSIG--------------ATISSPLYPANYPNNQNCMWI---IQAQEPYNHVTLSFTDLEIEFRNDN-CTLDYVEILDGNN--------------PDAPVQGRYCG---RTIPHPITSFSNALVVKFISNNSTSAK--GF--HATFAASTSACG-----GTLHM-------ETGAFNSPSYPENYPANTECVWNILSSPGNRLLLTF----------------SVQHSDSCSHDYLEIREGNETGSLMGR------FCGDILPSN-ITTITGHILWIKFVSDGSLSGSGFQATF---------SHLFGNNIGGDR--GQIASPLWPRNYPHYSNYLWKINV-DSSQIIQARILEIDIE-DHSGCIYDKLKIYDGPDTHYHVIGTYCGI-TPPPDIFSSGSSMTVQF-TSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGG 1966          

HSP 5 Score: 110.923 bits (276), Expect = 1.288e-23
Identity = 176/732 (24.04%), Postives = 280/732 (38.25%), Query Frame = 3
Query:  519 FQSPNFPQ--KYPPNIRCKYQFVAKSQEK--VVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNIS------STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIM-IHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCG--TDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGF 2666
            F SP + Q   Y  N+ C++     + E     I+F+   +E  L  C +DF++L  +         + + + R CG     VP  +V+    + + F S+   +           +GFN ++ F +   I +                E G I SP +P  Y S  +C++LL   +   I L F   D+ +HQ   C  D VTI +G +  SP+IGQ FCG      I S  N LL+ F + D                   L  +GF     ++ D +     +  +                 SG ++SP +P   P N  CT+ +   H  +  E   L F      P  +  C             +VK+    ++ +L        CG         T   P++  R              VI  TF+           PG   F   IS      +  SG I SP +   Y +N  C Y I    N  I ++FQ F +        +  S  + +C  D +++       P+ +       LCG+SVP  +   S   S+SL F +DS  +  GF A Y  IP        CG    +    G + S  Y   +Y +N+ C + V      N+I+ + F++   E S  SC    + +YDG    +SS L G    + +P  + S+SN + L F+T       +G++  + + L   P   C G+
Sbjct: 2568 FSSPGYDQVNNYTRNLNCEWIIQNPNTENSTTFISFKRLQLEYHL-NCQRDFIELRFDNA-------DGELITRLCGRNTPSVPLAIVASQ--VWVHFVSNAEVEN----------IGFNASYSFTDCGGIQA---------------GEYGVIASPNFPASYNSMSHCAWLLDAPEGHIITLSFIHFDIESHQ--ICRWDSVTILNGASPGSPLIGQ-FCGTTSPGTIQSGSNKLLVIFNSDD------------------SLHGRGFYA--NWTSDSLGCGGHVHAD-----------------SGTIRSPAWPQHFPANSRCTWTIE-THASSHYE---LSFNNNFHIPDDNGHCQRS----------YVKVWSGAEEELLATG-----CGD--------TAPAPVISPRN-------------VIRVTFQ-------SQDAPGSGFFASFISKCGANFTNSSGRIMSPNYPNKYGNNLRCNYTIHAEANMFIVLFFQNFEV--------ECKSKTSLSCSKDGLKIFGGERTSPLAN-------LCGASVPASI---SARGSMSLNFYTDSDINMHGFMATYRVIP--------CGGTFNASY--GTLRSPTYAFTDYHNNMNCTYHVTV--QENKIIELKFNELDLEAS-SSCLYDYIAVYDG--LNSSSPLLGRYCGNVLPPILRSSSNNLFLLFVTD-NHITSRGWRATFRQTLG--PMQGCGGY 3141          

HSP 6 Score: 105.145 bits (261), Expect = 7.089e-22
Identity = 158/705 (22.41%), Postives = 259/705 (36.74%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLV------LLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIP-----IQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFI-STSNTVHLEFITSPKAYG 2597
             SPN+P+ Y  N  C +        +V++ F  F+IE     C+ D + +        ST   +  L   CG  L   P  + S  N + +   SD + Q            GF+  F               E+C   I +      I+SP YP  YP++ NC +++   +    + L F DL++  +ND+C  D+V I DG+   +P+ G+ +CG      I S  N L+++FI+ +                      KGF+  +  S      T  ME                   +G   SP YP   P N  C +                     NI  +P N+     L  +S++                DS     C  DY EI+E    G L+      +L  N +      I G +++  F  D  + G   +    H   N      G I SP + + YP  +   + I  +++  I+    E  + +            +S C  D +    KI  GP     +  ++ CG + P  + S    +S+++ F SD+  +  GF  ++  +         I    CG  + +      + S  +P  Y S L C W +KA  S+  + I   D      H+SC    L I DGD+  +          +P  I S+ +++ + F T     G
Sbjct: 1510 HSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIESH-SSCSFDSVTV--------STY--SDPLAVLCGTQL---PAAISSTQNTMFVRLRSDGSNQHR----------GFSAKFT--------------EACGSLITADSIGATISSPLYPANYPNNQNCMWIIQAQEPYNHVTLSFTDLEIEFRNDNCTLDYVEILDGNNPDAPVQGR-YCGRTIPHPITSFSNALVVKFISNNSTS------------------AKGFHATFAASTSACGGTLHME-------------------TGAFNSPSYPENYPANTECVW---------------------NILSSPGNRL----LLTFSVQ--------------HSDS-----CSHDYLEIREGNETGSLMGRFCGDILPSNITT-----ITGHILWIKFVSDGSLSGSGFQATFSHLFGNNIGGDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDIED------------HSGCIYDKL----KIYDGPDTHYHVIGTY-CGITPPPDIFSS--GSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGGILRTGDTPLFLFSPGWPNNYASYLDCTWVIKAPGSTVELNILSVDIE---KHRSCNYDKLVIRDGDNNNSPQLAVVCGKGVPGPIRSSGDSMFIRFSTDGSVSG 2067          

HSP 7 Score: 104.375 bits (259), Expect = 1.072e-21
Identity = 171/697 (24.53%), Postives = 260/697 (37.30%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFK-FIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIK-EITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFIT 2579
             +N     SP +PQ Y  N +C Y     + EK+ + F +  +E    GC+      Y+E++  ++    A  +GR+C  T   +P  + S  N + + F SD +  +S              +FK F ++A           C  ++      G I +P YP  Y     C +++   + E + L F   D                        I+    CG           N + + F +   +K  +          P +   + F     F+    K T+        GT  D        T G + SPGYP   P    CT+F+  I   N +    L F + N+       CS   L IY      ++  I               CG   R I   IT +G  + + L T    ++ + GF   YT          +     C   Y   +  SG+ +SP +   YP+N  C Y I    N +I + F  F LS             ++ C+ D V    +I  G     P+   F  G   P P+I  S SN + + F SDS  S +GF A +      D     CG  + S + GG  TS  +P  Y  N  C W + A  S +   I F  F  E SH +C N  L +YDG++  +    +LCG     P   S SN V+++F T
Sbjct:  707 TDNEGFISSPRWPQPYTGNKQCIYIIQQPANEKISLRFTNLELENS-SGCSLS----YMEIRDGDTE--TAPLIGRYCNTT---IPPPISSSSNALWIKFKSDASVTRS--------------SFKAFYQVA-----------CGGFLTGA---GVIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFD------------------------ILAGTNCGS----------NFVEVIFTSYTHLKYCK----------PTIFVFRLFTFALLFAELQGKSTDCCFFTGCGGTLTD--------TQGTITSPGYPAVYPHGIQCTWFI-SIPPGNLIR---LTFDSFNL--EHGYSCSYDYLDIYDSASAIMESRI------------GRFCG---RSIPPSITSRGNTMTVLLVTDT--NTAVEGFSARYT---------SLNATTACDASY---TEASGIFSSPNYPNRYPNNLECIYTITVETNKQILLNFTTFVLS------------TSTNCDKDHV----EIRDGGYEISPLLGKFCQG---PPPVIV-SHSNKLWVKFRSDSSYSETGFSAHW------DSATTGCGGTLTS-VSGG-FTSPNFPMPYYHNSECYWQMMA-SSGSTFEIQFEHFDLE-SHSNCQNDYLAVYDGNTTHSHLLEKLCGKRLPDPIRSSGSN-VYVKFRT 1247          

HSP 8 Score: 99.7525 bits (247), Expect = 2.781e-20
Identity = 159/711 (22.36%), Postives = 259/711 (36.43%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG--CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTE-SSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSI----YSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +  +P++P  Y     C++       E V + F  F+I   L G  C  +F+++          +F +    ++C  T+     FV  L    +L  ++++  + +    D     G  GT                            +G ITSP YP +YP  + C++ +       IRL F   +L H    C  D++ IYD  +      IG+ FCG      I S  N + +                        LL       V  FS  Y  +           T CD    S  + SGI  SP YP R P N  C Y +    N+  +    L F T  +  +    C    + I    Y I P   K    P  +++  S                      + ++  + +++S    GF  ++      G  G +             ++ SG   SP F   Y  N+ C + ++ ++     I F+ F L              +S C+ D++ V          S  +E   LCG  +P P+   S  +++ + F +D+  S SGF+A Y            C   +I+    G + S  YP  Y  N  C W+++A    N I   F  F  EG + SC N  +++YDG   QA      CG +   P+  +T  ++H+ F  S     + GF++ W
Sbjct:  824 VIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDI---LAGTNCGSNFVEV----------IFTSYTHLKYCKPTI-----FVFRLFTFALL--FAELQGKST----DCCFFTGCGGTLT------------------------DTQGTITSPGYPAVYPHGIQCTWFISIPPGNLIRLTFDSFNLEH-GYSCSYDYLDIYDSASAIMESRIGR-FCGRSIPPSITSRGNTMTV------------------------LLVTDTNTAVEGFSARYTSLNAT--------TACD---ASYTEASGIFSSPNYPNRYPNNLECIYTITVETNKQIL----LNFTTFVL--STSTNCDKDHVEIRDGGYEISPLLGKFCQGPPPVIVSHSNK--------------------LWVKFRSDSSYSET--GFSAHWD-SATTGCGGTL-------------TSVSGGFTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHFDLE------------SHSNCQNDYLAVYDG---NTTHSHLLEK--LCGKRLPDPI--RSSGSNVYVKFRTDNSISFSGFFATY---------KQTCQGVMIANRSRGILESLNYPNSYPHNQQCNWTIQA-TLGNTINYTFTTFNVEG-YFSC-NDYVQLYDGPDKQARLIGTYCG-NQLPPSGTTTGTSLHVVF-HSDDTITRPGFQMQW 1374          

HSP 9 Score: 98.5969 bits (244), Expect = 6.303e-20
Identity = 167/758 (22.03%), Postives = 289/758 (38.13%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQ---EFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENI-ISEIR-GGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIP-AFISTSNTVHLEFIT---SPKA---------------YGQKGFKLIWSEILQRLPDGS-CPGFECLKTKHCISRQLE 2708
            F SP++P+ YP N  C +  ++    ++++ F   + +     C+ D    Y+E++    T      +GRFCG  L    N      +I+ + F SD +   S          GF  TF  +                F  +   + G I SP +P  YP + N  + +  +  + I+    ++D+   +  CI D + IYDG      +IG  +CG  P   I S+ + + ++F            S + I M   LL+   +  V  FS ++  I             C   +++ + T   L SPG+P        CT+ +       K   + ++   L++       C+            + KL IR       +SP   ++CG        I   G  + +R +T  + S    G     ++ +  G        G  H          G+I SP + + Y +N  C +  +  +   I  +F+   E   S+       Y  LKN   +             P +         CG+S P  +   +  N + + F+SD+     GF  +Y+ + +       CG +I ISE    G +TS +YP  Y  N  C W +   +     +     F  E S ++C+++ L + DG   S +  ++LCG  +A+P  + S    ++L F+T   +P+                +GQ G        LQ  PD S C  +    T H ++ Q E
Sbjct: 1738 FNSPSYPENYPANTECVWNILSSPGNRLLLTFSVQHSDS----CSHD----YLEIREGNET---GSLMGRFCGDILPS--NITTITGHILWIKFVSDGSLSGS----------GFQATFSHL----------------FGNNIGGDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDI-EDHSGCIYDKLKIYDGPDTHYHVIGT-YCGITPPPDIFSSGSSMTVQFT-----------SDNSINMKGFLLE---WLAVDAFSENFPTIAPGA---------CGGILRTGD-TPLFLFSPGWPNNYASYLDCTWVI-------KAPGSTVELNILSVDIEKHRSCN------------YDKLVIRDGDNN--NSPQLAVVCGKGVP--GPIRSSGDSMFIRFSTDGSVS----GTGFNASYHKSCG--------GYLH-------ANRGLITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEIPNSDSTCGTGDYLELKNGPDD-----------SSPPMGTSTRNGKFCGTSAPSTM--HTTDNEMFVHFVSDNSNEGKGFQLKYEALSL------ACGGSIYISESDPSGFVTSPKYPENYPMNADCVWIITVPNGEAVELEFKEQFYIEPS-ENCSSNYLELRDGADASKRLLAKLCG--NALPITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIATCGGTHFGQSGIIQSPGYPLQNYPDNSLCEWYFTGPTGHYLTIQFE 2366          

HSP 10 Score: 82.8037 bits (203), Expect = 4.364e-15
Identity = 68/251 (27.09%), Postives = 116/251 (46.22%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIE---GLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGI-YPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFI 1241
             N+     SPN+P KY  N+RC Y   A++   +V+ F++F +E        C+KD L ++   ++          L   CG +   VP   +S    + L+FY+D +          + + GF  T++ I   P   T                 G + SPTY    Y +++NC+Y +   + + I L F +LDL   +  C+ D++ +YDG   SSP++G+ +CG      + S+ N L + F+T + I
Sbjct: 2908 TNSSGRIMSPNYPNKYGNNLRCNYTIHAEANMFIVLFFQNFEVECKSKTSLSCSKDGLKIFGGERT--------SPLANLCGAS---VPA-SISARGSMSLNFYTDSD----------INMHGFMATYRVI---PCGGTF------------NASYGTLRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDL-EASSSCLYDYIAVYDGLNSSSPLLGR-YCGNVLPPILRSSSNNLFLLFVTDNHI 3119          

HSP 11 Score: 75.485 bits (184), Expect = 7.836e-13
Identity = 72/254 (28.35%), Postives = 107/254 (42.13%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCA-NSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRL 2642
            G   SP F   YP N  C + I  +    I+I   EF++        +YH    STC  D    + +I  GP +S P             PL   S  N++++ F +D+  S  GF   +  IP        CG   + +   G I S  YPR Y  N  C W ++  D  +R+++ F DF  E SH SC+ +S+      D       LCGT   +PA IS++       + S  +   +GF   ++E    L
Sbjct: 1388 GSFTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNI--------EYH----STCSYD----VLEIYGGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRFKTDAYVSGRGFNTTWREIP------GGCGG--VFQAPNGEIHSPNYPRPYEDNTECSWVIRV-DFGHRVLLTFRDFDIE-SHSSCSFDSVTVSTYSDPLAV---LCGTQ--LPAAISSTQNTMFVRLRSDGSNQHRGFSAKFTEACGSL 1610          

HSP 12 Score: 73.559 bits (179), Expect = 2.796e-12
Identity = 68/269 (25.28%), Postives = 120/269 (44.61%), Query Frame = 3
Query:  468 CDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEK---VVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILS-TRNMLLIRFITGDFIKRSRLES 1262
            C  +  +D IG        SP +P  YP N  C +  + ++QE    V ++F    IE     C  D++++      L+    +A   GR+CG T   +P+ + S  N +V+ F S+ +T             GF+ TF         ST     + H       E G   SP+YP  YP++  C + ++ +   R+ L F        +D C  D++ I +G+ E+  ++G+ FCG+     I + T ++L I+F++   +  S  ++
Sbjct: 1607 CGSLITADSIGA----TISSPLYPANYPNNQNCMW--IIQAQEPYNHVTLSFTDLEIEFRNDNCTLDYVEI------LDGNNPDAPVQGRYCGRT---IPHPITSFSNALVVKFISNNSTSAK----------GFHATFA-------ASTSACGGTLHM------ETGAFNSPSYPENYPANTECVWNILSSPGNRLLLTFSV----QHSDSCSHDYLEIREGN-ETGSLMGR-FCGDILPSNITTITGHILWIKFVSDGSLSGSGFQA 1831          

HSP 13 Score: 72.7886 bits (177), Expect = 4.916e-12
Identity = 148/719 (20.58%), Postives = 272/719 (37.83%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY-FLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLP---DSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGT--DSAIPAFISTSNT-VHLEFITSPKAYGQKGFKL 2615
            + + IG  +R    SP +P+ YP      ++    S + +       +IE    GC      +Y ++K  +    +   +G +CG T    P  + S  + + + F SD +        + + +  F+  F    IAP         +C   + +     ++ SP +P  Y S+L+C++++       + L    +D+  ++  C  D + I DGD  +SP +    CG+     I S+ + + IRF T   +  +                  GFN  Y  S                   C  ++ ++    G++ SP YP     N  CT+ FL          T    F+     P  D+ C TG          +++L+  P     P    + +   CGT        T     V    + SN       GF + Y          + +       +Y   S  SG + SP + + YP N  C + I   N   + + F+E           +++   +  C  +++    ++  G   S+ +    LCG+++  P+   S   ++ L F++DS     GF A Y            CG     +   G I S  YP + Y  N +C+W      + + + I F       S   C+   + I +   + AS  + G   +S +P+ + TS++  +++F++     G +GF++
Sbjct: 1837 FGNNIG-GDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDIEDH-SGC------IYDKLKIYDGPDTHYHVIGTYCGIT---PPPDIFSSGSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFP--TIAP--------GACGGILRTGDTPLFLFSPGWPNNYASYLDCTWVIKA-PGSTVELNILSVDI-EKHRSCNYDKLVIRDGDNNNSPQLAV-VCGKGVPGPIRSSGDSMFIRFSTDGSVSGT------------------GFNASYHKS-------------------CGGYLHANR---GLITSPNYPEHYSANLNCTWHFLV-----TSGFTIAAHFEPTFEIPNSDSTCGTGD---------YLELKNGPDDSSPPMGTSTRNGKFCGTSAPSTMHTTDNEMFVHFVSDNSNEGK----GFQLKY----------EALSLACGGSIYISESDPSGFVTSPKYPENYPMNADCVWIITVPNGEAVELEFKE-----------QFYIEPSENCSSNYL----ELRDGADASKRLLAK-LCGNAL--PITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIA--------TCGGTHFGQ--SGIIQSPGYPLQNYPDNSLCEWYFTG-PTGHYLTIQFEAMDLHNS-TDCSRDFVEIRE---YNASGRILGVFCNSMVPSDLVTSDSFAYIKFVSDQSENG-RGFRI 2429          

HSP 14 Score: 60.8474 bits (146), Expect = 1.721e-8
Identity = 142/681 (20.85%), Postives = 236/681 (34.65%), Query Frame = 3
Query:  576 FVAKSQEKVV----INFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEI-TCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISS----TKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSEL---CGTDSAIPAFISTSNTVHLEFIT 2579
            +V K++ + V    I F +F++E   P C+ +FL ++ +  S+ S +     LG++CG     VP  + S HN +   F+SD           H+   G    F+        S + ++  C   +   +  G I SP YPG YP + +C + +  N    I   F  L L +H+N  C +D++ I DG      ++G+ +C       + ++     + F                   +    + +GF++ Y  S            N                  G + SP +P     NK C Y +                                       +P   K+ +R   L L +S     C   Y EI++  T   PL+    NT+           ++  FK D  +     +       Y ++     T +GVI++P +   Y    TC++ I       + + F  F +            L  + C  +FV VI          +P  T F+        L ++ +  S    F +                         CG  +      G ITS  YP  Y   + C W + +    N I + F  F  E  + SC+   L IYD  S    S +   CG  S  P+  S  NT+ +  +T
Sbjct:  494 WVIKTEPRKVRILHITFTNFHLEQSTP-CSTEFLQVH-DGDSISSFM-----LGKYCG---TGVPQEISSSHNSLFFWFHSD-----------HISSAG---GFRI-------SWESRQPECGGEL--METHGSIMSPGYPGNYPPNRDCYWTISTNPGLYITFAFGTLSLEDHEN--CGKDYLEIRDGLLPQDRVLGK-YCSTLSPAPLQTSGPYAWLHF------------------HSDSTGEDRGFHITYITSPSDPGCGGNFTDNE-----------------GFISSPRWPQPYTGNKQCIYIIQ--------------------------------------QPANEKISLRFTNLELENSSG---CSLSYMEIRDGDTETAPLIGRYCNTTIPPPISSSSNALWIKFKSDASVTRSSFKA-----FYQVACGGFLTGAGVIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDI------------LAGTNCGSNFVEVIFTSYTHLKYCKP--TIFVFRLFTFALLFAELQGKSTDCCFFT------------------------GCGGTLTD--TQGTITSPGYPAVYPHGIQCTWFI-SIPPGNLIRLTFDSFNLEHGY-SCSYDYLDIYDSASAIMESRIGRFCG-RSIPPSITSRGNTMTVLLVT 1014          

HSP 15 Score: 56.9954 bits (136), Expect = 2.525e-7
Identity = 108/493 (21.91%), Postives = 172/493 (34.89%), Query Frame = 3
Query:  933 FYIDSKKEE--GYITSPTYPGIYPS--------HLNCSYLLVGNQKERIRLL---FRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQW 2372
            F  +S K+E  G +T  T    YP+        H+     ++  +  ++R+L   F +  L  Q+  C  + + ++DGD+ SS ++G+ +CG     +I S+ N L   F +            D I          GF + +       +   E+ + H                 G + SPGYP   P N+ C    Y   + N        F TL++       C    L I        +  + PQ  VL        C T       +   GP   L  + S++     G  + Y T   D G  G   +               G I+SP + Q Y  N  C Y I    N +I + F    L         Y  +++   E             P+I +       C +++P P+   S SN++ + F SD+  + S F A Y            CG  +      G I +  YP  Y     C+W
Sbjct:  455 FNCESPKQECGGVLTGLTGSFGYPNNPGTDQHGHMLSCMWVIKTEPRKVRILHITFTNFHL-EQSTPCSTEFLQVHDGDSISSFMLGK-YCGTGVPQEISSSHNSLFFWFHS------------DHIS------SAGGFRISWE--SRQPECGGELMETH-----------------GSIMSPGYPGNYPPNRDC----YWTISTNPGLYITFAFGTLSL--EDHENCGKDYLEI--------RDGLLPQDRVLGK-----YCST--LSPAPLQTSGPYAWLHFH-SDSTGEDRGFHITYITSPSDPGCGGNFTD-------------NEGFISSPRWPQPYTGNKQCIYIIQQPANEKISLRFTNLELENSSGCSLSYMEIRDGDTE-----------TAPLIGR------YCNTTIPPPI--SSSSNALWIKFKSDASVTRSSFKAFYQV---------ACGGFLTG---AGVIHTPHYPDAYFRERTCEW 842          
BLAST of Cubilin vs. Ensembl Xenopus
Match: ENSXETT00000007740.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 118.627 bits (296), Expect = 2.507e-26
Identity = 164/699 (23.46%), Postives = 272/699 (38.91%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPF-FVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISST-----------------------------KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG 2483
            F +P +P  YP    C ++      EK+++NF   ++        K  L  Y  ++  +     A  LGR CG   D +P  ++S  + + ++F S  N            +LG  G F   E                  D KK+ G I SP YP  Y     C + +  ++   + L F+  ++  ++D+C  D++ + DG +E   +IG+ FCG EKP+  I ST N L I+F++   I ++   +      DE  + +     ++  N +  +                    C  +I    + +G + SPG+P   P NK C + +      R  ++  V + +  ++         +  +S+ S++   +  LEIR   L          CG +  E+  IT +G  V L   + N  S    GF + +   +D   E      G  H   N   +                               G I+SP +   YPS   C +DI     HR+++ F +F + +            +  C  D + +      GP     I   F CGS  P P+I+   +NS+ L F SD+     GF A+Y         + +CG  + +EI+  +I S      N YP   +SN  C+W + A D     +I F  F  E     C    + +YDG
Sbjct:  253 FSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDL-------FKSRLCWYDYIEIRDGYWRKAALLGRLCG---DKLPEPIISSDSKLWIEFRSSSN------------ILG-KGFFAVYEAICGG-------------DIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEI-ERHDNCAYDYLEVRDGFSEDHALIGR-FCGYEKPE-DIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFIT---QLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV---------SDGISVVSLKVCKYDFLEIR-SGLSSESKLHGKFCGPEKPEV--ITSQGNTVRLEFKSDNTVSKR--GFKVNFFSDKD---ECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQ------------HQECAYDHLELYD----GPNGKSAILGRF-CGSKEPNPVIAS--TNSMFLRFYSDASVQRKGFQAKY---------STECGGRLKAEIQTKDIYSHAQFGDNNYP--VQSN--CEWVIVAEDGYGVELI-FQTFEIE-EESDCGYDYMEVYDG 858          

HSP 2 Score: 87.0409 bits (214), Expect = 1.338e-16
Identity = 70/249 (28.11%), Postives = 114/249 (45.78%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
            +N      SPN+P KYP    C +     +  +V + F  F IE     C  D L+LY +  + +S +     LGRFCG      PN V++  N + L FYSD + Q+   Q  +    G  G  K  EI     TK+      F  ++               YP   NC +++V      + L+F+  ++  ++ DC  D++ +YDG   ++P +G+ +CG  P  ++ S  + ++IRF T D I +
Sbjct:  683 INAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-CAYDHLELY-DGPNGKSAI-----LGRFCG---SKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECG--GRLK-AEI----QTKDIYSHAQFGDNN---------------YPVQSNCEWVIVAEDGYGVELIFQTFEIEEES-DCGYDYMEVYDGYDSTAPRLGR-YCGSGPPEEMYSAGDSIMIRFHTDDTINK 897          

HSP 3 Score: 53.5286 bits (127), Expect = 3.009e-6
Identity = 60/236 (25.42%), Postives = 95/236 (40.25%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
             G  ++P +   YPS T C + I      +I + F    L             K+  C  D++ +     +   +        LCG  +P P+IS    + + + F S S     GF+A Y+ I         CG +I  +   G I S  YP +YR    C W +   +    + + F  F  E  H +CA   L + DG S   +     CG +   P  I STSN + ++F++
Sbjct:  250 GGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDL------------FKSRLCWYDYIEIRDGYWRKAAL-----LGRLCGDKLPEPIISSD--SKLWIEFRSSSNILGKGFFAVYEAI---------CGGDIKKD--SGQIQSPNYPDDYRPAKECIWKITVSEGF-LVGLSFQAFEIE-RHDNCAYDYLEVRDGFSEDHALIGRFCGYEK--PEDIKSTSNKLWIKFVS 451          
BLAST of Cubilin vs. Ensembl Xenopus
Match: ENSXETT00000007933.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 118.627 bits (296), Expect = 3.089e-26
Identity = 168/705 (23.83%), Postives = 273/705 (38.72%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----------DEIKMNPKLLQKKG-FNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPF-FVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISST-----------------------------KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG 2483
            F +P +P  YP    C ++      EK+++NF   ++        K  L  Y  ++  +     A  LGR CG   D +P  ++S  + + ++F S  N            +LG  G F   E                  D KK+ G I SP YP  Y     C + +  ++   + L F+  ++  ++D+C  D++ + DG +E   +IG+ FCG EKP+  I ST N L I+F++   I ++   +            D    + + +   G +  V     +      + E        C  +I    + +G + SPG+P   P NK C + +      R  ++  V + +         N  S G +S+ S++   +  LEIR   L          CG +  E+  IT +G  V L   + N  S    GF + +   +D   E      G  H   N   +                               G I+SP +   YPS   C +DI     HR+++ F +F + +            +  C  D + +      GP     I   F CGS  P P+I+   +NS+ L F SD+     GF A+Y         + +CG  + +EI+  +I S      N YP   +SN  C+W + A D     +I F  F  E     C    + +YDG
Sbjct:  356 FSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDL-------FKSRLCWYDYIEIRDGYWRKAALLGRLCG---DKLPEPIISSDSKLWIEFRSSSN------------ILG-KGFFAVYEAICGG-------------DIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEI-ERHDNCAYDYLEVRDGFSEDHALIGR-FCGYEKPE-DIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCE------AACGGFIT---QLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELE--------GNDVSDG-ISVVSLKVCKYDFLEIR-SGLSSESKLHGKFCGPEKPEV--ITSQGNTVRLEFKSDNTVSKR--GFKVNFFSDKD---ECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQ------------HQECAYDHLELYD----GPNGKSAILGRF-CGSKEPNPVIAS--TNSMFLRFYSDASVQRKGFQAKY---------STECGGRLKAEIQTKDIYSHAQFGDNNYP--VQSN--CEWVIVAEDGYGVELI-FQTFEIE-EESDCGYDYMEVYDG 961          

HSP 2 Score: 87.0409 bits (214), Expect = 1.638e-16
Identity = 69/249 (27.71%), Postives = 111/249 (44.58%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
            +N      SPN+P KYP    C +     +  +V + F  F IE     C  D L+LY      +     +  LGRFCG      PN V++  N + L FYSD + Q+   Q  +    G  G  K  EI     TK+      F  ++               YP   NC +++V      + L+F+  ++  ++ DC  D++ +YDG   ++P +G+ +CG  P  ++ S  + ++IRF T D I +
Sbjct:  786 INAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-CAYDHLELY------DGPNGKSAILGRFCG---SKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECG--GRLK-AEI----QTKDIYSHAQFGDNN---------------YPVQSNCEWVIVAEDGYGVELIFQTFEIEEES-DCGYDYMEVYDGYDSTAPRLGR-YCGSGPPEEMYSAGDSIMIRFHTDDTINK 1000          

HSP 3 Score: 53.5286 bits (127), Expect = 2.729e-6
Identity = 60/236 (25.42%), Postives = 95/236 (40.25%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
             G  ++P +   YPS T C + I      +I + F    L             K+  C  D++ +     +   +        LCG  +P P+IS    + + + F S S     GF+A Y+ I         CG +I  +   G I S  YP +YR    C W +   +    + + F  F  E  H +CA   L + DG S   +     CG +   P  I STSN + ++F++
Sbjct:  353 GGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDL------------FKSRLCWYDYIEIRDGYWRKAAL-----LGRLCGDKLPEPIISSD--SKLWIEFRSSSNILGKGFFAVYEAI---------CGGDIKKD--SGQIQSPNYPDDYRPAKECIWKITVSEGF-LVGLSFQAFEIE-RHDNCAYDYLEVRDGFSEDHALIGRFCGYEK--PEDIKSTSNKLWIKFVS 554          
BLAST of Cubilin vs. Ensembl Xenopus
Match: ENSXETT00000007882.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 115.931 bits (289), Expect = 1.939e-25
Identity = 163/698 (23.35%), Postives = 266/698 (38.11%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISST-----------------------------KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG 2483
            F +P +P  YP    C ++      EK+++NF   ++        K  L  Y  ++  +     A  LGR CG   D +P  ++S  + + ++F S  N            +LG  G F   E                  D KK+ G I SP YP  Y     C + +  ++   + L F+  ++  ++D+C  D++ + DG +E   +IG+ FCG EKP+  I ST N L I+F++   I ++   +      DE  + +     ++  N +  +                    C  +I    + +G + SPG+P   P NK C + +      R  ++  V + +  ++       C    L I S      KL  +              CG +  E+  IT +G  V L   + N  S    GF + +   +D   E      G  H   N   +                               G I+SP +   YPS   C +DI     HR+++ F +F + +            +  C  D + +      GP     I   F CGS  P P+I+   +NS+ L F SD+     GF A+Y         + +CG  + +EI+  +I S      N YP   +SN  C+W + A D     +I F  F  E     C    + +YDG
Sbjct:  257 FSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDL-------FKSRLCWYDYIEIRDGYWRKAALLGRLCG---DKLPEPIISSDSKLWIEFRSSSN------------ILG-KGFFAVYEAICGG-------------DIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEI-ERHDNCAYDYLEVRDGFSEDHALIGR-FCGYEKPE-DIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFIT---QLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV-------CKYDFLEIRSGLSSESKLHGK-------------FCGPEKPEV--ITSQGNTVRLEFKSDNTVSKR--GFKVNFFSDKD---ECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQ------------HQECAYDHLELYD----GPNGKSAILGRF-CGSKEPNPVIAS--TNSMFLRFYSDASVQRKGFQAKY---------STECGGRLKAEIQTKDIYSHAQFGDNNYP--VQSN--CEWVIVAEDGYGVELI-FQTFEIE-EESDCGYDYMEVYDG 851          

HSP 2 Score: 87.0409 bits (214), Expect = 1.462e-16
Identity = 70/249 (28.11%), Postives = 114/249 (45.78%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
            +N      SPN+P KYP    C +     +  +V + F  F IE     C  D L+LY +  + +S +     LGRFCG      PN V++  N + L FYSD + Q+   Q  +    G  G  K  EI     TK+      F  ++               YP   NC +++V      + L+F+  ++  ++ DC  D++ +YDG   ++P +G+ +CG  P  ++ S  + ++IRF T D I +
Sbjct:  676 INAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-CAYDHLELY-DGPNGKSAI-----LGRFCG---SKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECG--GRLK-AEI----QTKDIYSHAQFGDNN---------------YPVQSNCEWVIVAEDGYGVELIFQTFEIEEES-DCGYDYMEVYDGYDSTAPRLGR-YCGSGPPEEMYSAGDSIMIRFHTDDTINK 890          

HSP 3 Score: 86.6557 bits (213), Expect = 1.824e-16
Identity = 132/617 (21.39%), Postives = 241/617 (39.06%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKH--LGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------------YNQDDHMGL----LGFNGTFKFIEIAPINSTKEQKE---SCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLE-----SGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIG-TECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQII---CGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            QSPN+P  Y P   C ++        V ++F+ F IE     C  D+L++           F+  H  +GRFCG+     P  + S  N + + F SD +  ++             ++ D+ G     +   G++K +       T ++K+   +C  +I   +  G ITSP +P  YP++ NC + +V   + RI L F   +L   ND C  D + I  G +  S + G+ FCG EKP++ I S  N + + F + + + +   +       DE   +    Q    N    +           E  H      C+  + ++E   G + SP +P + P  K CT+ +  +   ++++     F+          +C+   L +Y                  P+    I+   CG+  +E   +      + LR  +  +      GF   Y+ +    ++ ++              TK    ++ F +  YP  + C++ I+  + + + + FQ F + E+            S C  D++ V          S        CGS  P  +   S  +SI + F +D   +  GF+ QY     QD ++ +
Sbjct:  371 QSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIE-RHDNCAYDYLEV--------RDGFSEDHALIGRFCGY---EKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFI--TQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFEL-EGNDVCKYDFLEIRSGLSSESKLHGK-FCGPEKPEV-ITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAE---GTISSPNWPDKYPSRKECTWDI-AVTAGHRVKLVFTDFEI-----EQHQECAYDHLELYD----------------GPNGKSAILGRFCGS--KEPNPVIASTNSMFLRFYSDASVQR--KGFQAKYSTECGGRLKAEI-------------QTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEE------------SDCGYDYMEVYDGYD-----STAPRLGRYCGSGPPEEMY--SAGDSIMIRFHTDDTINKKGFHGQYTSTKFQDALHMR 909          

HSP 4 Score: 53.1434 bits (126), Expect = 3.054e-6
Identity = 60/236 (25.42%), Postives = 95/236 (40.25%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
             G  ++P +   YPS T C + I      +I + F    L             K+  C  D++ +     +   +        LCG  +P P+IS    + + + F S S     GF+A Y+ I         CG +I  +   G I S  YP +YR    C W +   +    + + F  F  E  H +CA   L + DG S   +     CG +   P  I STSN + ++F++
Sbjct:  254 GGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDL------------FKSRLCWYDYIEIRDGYWRKAAL-----LGRLCGDKLPEPIISSD--SKLWIEFRSSSNILGKGFFAVYEAI---------CGGDIKKD--SGQIQSPNYPDDYRPAKECIWKITVSEGF-LVGLSFQAFEIE-RHDNCAYDYLEVRDGFSEDHALIGRFCGYEK--PEDIKSTSNKLWIKFVS 455          
BLAST of Cubilin vs. Ensembl Mouse
Match: Cubn (cubilin (intrinsic factor-cobalamin receptor) [Source:MGI Symbol;Acc:MGI:1931256])

HSP 1 Score: 127.872 bits (320), Expect = 6.051e-29
Identity = 164/703 (23.33%), Postives = 276/703 (39.26%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLL-PGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDIN-TQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI--ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIP-KGPIISQPIETSFLCGSS-VPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHL 2567
            Y+D  G        SPNFP  YP N  C Y+      +++ ++F  F +E    P C  DF++  I     E++      +G +CG      P  ++S  N + L F SD   T + ++        G  G                              G +TSP YP  Y     C + L  ++     L F+D  L H   +C  D++ ++DG + +S +I +  CG+ P   I S+++++L++          R ++G          Q +GF + YR + D V I N                    KTSGIL+S  YP    K++ C + +      N +    L+F   N        CST  L +Y                   D P +I   CG +       T    +V+     ++   SG  GF +++     +G  G+M             S   G  +SP +   YP N  C ++I     + I++   +F +        +YH    ++C+ D + +   +    P I+Q      LC  S    P+   S  N +++ F +DS  +  GF A +  +P        CG   I ++  G I S  YP  YR+N  C W ++  +  +R++++  DF  E +     +S L  YDG S   +  + +CG      +  S+ N++ +
Sbjct: 1052 YTDNFG-----RLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKC-VDFVE--IRDGGFETSPL----IGIYCGSVF---PPRIISHSNKLWLRFKSDTALTARGFSAYWDASSTGCGGNLT------------------------TPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLEHH-PNCSLDYLAVFDGPSTNSRLINK-LCGDTPPAPIRSSKDIVLLKL---------RTDAGQ---------QGRGFEINYRQTCDNVVIVN--------------------KTSGILESINYPNPYDKDQRCNWTIQAT-TGNTVNYTFLEFDVENYV-----NCSTDYLELY-------------------DGPQRIGRYCGENIPPPGATTGSKLIVVFH---TDGVDSGEKGFKMHWFI---HGCGGEM-------------SGTMGSFSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDV--------EYH----ASCKYDTLEIYTGLDFHSPRIAQ------LCSRSPSANPMQISSTDNELAIRFKTDSSLNGRGFNASWRAVP------GGCGG--IFQVSRGEIHSPNYPNNYRANTECSWIIQV-EKYHRVLLNITDFDLEAT-----DSCLMTYDGSSSANTRVATVCGRQQPPNSITSSGNSLFV 1599          

HSP 2 Score: 120.168 bits (300), Expect = 1.158e-26
Identity = 166/732 (22.68%), Postives = 281/732 (38.39%), Query Frame = 3
Query:  492 KIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPG---VCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCG-TDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            K+   +  + +SP  P  YP  + C +  V +  + + + F  F +E     C  D+L++Y  +            LGR+CG ++   P+   S H+I ++           +  D  +   GF+  ++ I  + +         C +  D     G ++SP +P  YP + NC Y +     ++I L F D  L ++    C+ D V I DG  E+SP+IG  +CG     +I+S  N L +RF                   +   L  +GF+  +  S                 T C   + +    +G+L SP YP+    +  C + L      ++    +L+FQ  ++   P+  CS   L+++                   D P      T+ R I ++    P   +R +            ++    + D G +G+  E      C  V  ++ T SG++ S  +   Y  +  C + I     + +   F EF + E+ V            C  D++ +            P      CG ++P P    +  + + + F +D V S    +  + FI       H CG  +   +  G+ +S  YP  Y  N  C W+++     N I +  HDF  E  H SC    L IY G  F +   ++LC  + SA P  I ST N + + F T     G +GF   W     R   G C G
Sbjct:  934 KVLTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYLE-FHYNCANDYLEVYDTIAQTS--------LGRYCGKSIP--PSLTSSSHSIKLI-----------FVSDSALAHEGFSINYEAINASSV---------CLY--DYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKCV-DFVEIRDGGFETSPLIGI-YCGSVFPPRIISHSNKLWLRF------------------KSDTALTARGFSAYWDAS----------------STGCGGNLTTP---TGVLTSPNYPMPYYHSSECYWRL----EASRGSPFLLEFQDFHLEHHPN--CSLDYLAVF-------------------DGPS-----TNSRLINKLCGDTPPAPIRSSKD----------IVLLKLRTDAGQQGRGFEINYRQTCDNVVIVNKT-SGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDV-ENYVN-----------CSTDYLELYDG---------PQRIGRYCGENIPPP--GATTGSKLIVVFHTDGVDSGEKGFKMHWFI-------HGCGGEMSGTM--GSFSSPGYPNSYPHNKECIWNIRV-APGNSIQLTIHDFDVE-YHASCKYDTLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNG-RGFNASW-----RAVPGGCGG 1512          

HSP 3 Score: 115.546 bits (288), Expect = 3.066e-25
Identity = 168/734 (22.89%), Postives = 286/734 (38.96%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG--CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYI--DSKKEEGYITSPTYP--GIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQND--DCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYP----VRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS------GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            YS   GV N   F   N    YP N+ C Y    ++   +++ F  F I   +P   C+ D+L+++      +      + +G+FCG TL   P  + S +N + L F +D +              G+  +F+         T   ++ C  Y+  DSK       SP +   G+Y   LNC + ++  + + ++L F    L   +    C  D+V I DG + +S  +G  FCG       +S+ N L ++F++             +I      +Q +GFN  Y F                     DM    +   + + ++   P    +R P +  CT+ +    ++ +++  V K Q       P   CS  S            LE++  +    +   Q  CG +Y  +                   +SSG    V+   FK D+      V     HF Y I+          G + SP + Q Y +N  C   +    NHRI ++F  F L +    RQ         C  DF+ V      G   S P+   + C + +P P+   S+SN + L F SD   +H G+   +   P        CG  ++     G + +  +P  Y +N  C+W++ A   S R +     F++  S   C  + L +++G    +      CG D+ +  F ++SN V + F  +  A    GF+++WS
Sbjct: 3041 YSGTYGVLNSPSFSYTN----YPNNVYCVYSLQVRNDRLILLRFNDFEI---VPSNLCSHDYLEVF------DGPSIGNRSIGKFCGSTL---PQVIKSTNNSLTLLFKTDSSQTAR----------GWKVSFR--------ETIGPQQGCGGYLTEDSKS----FVSPDHDSDGLYDKGLNCIWYIIAPENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINS-YLGGRFCGSSRPAPFISSGNFLTVQFVS-------------DIS-----IQMRGFNATYTF--------------------VDMPCGGTYNATSMPQNTSSPQLSNIRRPFST-CTWVIEAPPHQ-QVQITVWKLQ------LPSQDCSRSS------------LELQDSEQTNGNQVTQ-FCGANYTTLPVF----------------YSSGSTAVVV---FKSDFLNRNSRV-----HFTYEIADCNREYNQAFGNLKSPGWPQGYANNLDCSIILRAPQNHRISLFFYWFQLED---SRQ---------CMNDFLEV----RNGSSSSSPLLGKY-CSNLLPNPIF--SQSNELYLHFHSDDSDTHHGYEIIWASSPT------GCGGTLLG--NEGILANPGFPDSYPNNTHCEWTIVA--PSGRPLSVGFPFLSIDSPGGCDQNYLILFNGPDANSPPFGPFCGIDTVVAPFHASSNRVFIRF-HAEYATVSSGFEIMWS 3622          

HSP 4 Score: 98.5969 bits (244), Expect = 5.069e-20
Identity = 173/731 (23.67%), Postives = 284/731 (38.85%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRD-LDLNHQNDDCIE-DHVTIYDGDTESSPIIGQP-----FCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQ-TLNIPPTPDNKCSTGSLSIY----SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFF-NQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWSEILQRLPDGSCP 2660
             F SP +P  Y     C +   A     V +N    +IE  L  C+ D L +    K  +S L  ++ L   CG +   VP  + S    + + F SD +   +          GFN +F+              +SC  Y+ + +  G ITSP YP  Y  +LNCS+ ++      I + F     + +++  C + D++ + +G    SP +G       FCG      + ++ N + I+FI+      S    G +I+   K L   G   ++  + D                             G + SP YP   P++  C + L     R+      L+F+   NI  TP+  CS   L +     S  P   KL                 CG        ++ +G L+ L+ +T     SG      Y  FK  Y I    V  G         S  SGVI S  +  +LY +N  CQ+ I G   H + I F++F+L              +  C  DFV + +    G ++ +       CG+S+P  +  D+ SN  S+ F++D   + SGF  Q+            CG ++      G  TS  YP       IC+W++   +   +I++ F +     + QSC    L +++G  ++     +LC   +    F S+ NT+ + F T   + YG  GF   ++     +  G+ P
Sbjct: 1990 FFFSPGWPGPYGNGADCIWIIYAP-DSTVELNILSMDIEAQL-SCSYDKLII----KDGDSRL--SQQLAVLCGRS---VPGPIRSTGEYMYIRFTSDGSVTGA----------GFNASFQ--------------KSCGGYLHADR--GIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTLFTSDNEMFIQFIS----DNSNGGQGFKIRYEAKSLACGGTIYIHDANSD-----------------------------GYVTSPNYPANYPQHAECIWILEAPSGRSIQ----LQFEDQFNIEETPN--CSASYLELRDGANSNAPVLSKL-----------------CGHTLPR-NWVSSRG-LMYLKFHTEGG--SG------YMGFKAKYSI----VSCG------GTVSGDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNLQ------------SSPGCAKDFVEIWENHTSGILLGR------YCGNSIPSSV--DTSSNVASIRFVTDGSVTDSGFRLQF------KSSREVCGGDLHGPT--GTFTSPNYPNPNPHPRICEWTINVHE-GRQIILTFTNLRLS-TQQSCNTEHLIVFNGIRNNSPRLQKLCSRVNVTNEFKSSGNTMKVIFFTDGSRPYG--GFTASYTSSEDAVCGGTLP 2575          

HSP 5 Score: 97.8265 bits (242), Expect = 7.471e-20
Identity = 166/722 (22.99%), Postives = 262/722 (36.29%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTK----------SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSEL---CGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            I   N     SP +P  YPP   C +  +      +   F   ++E     C+KD+L++       +    +   LG+FC  +L   P  + +      + F+SD  T             GF+ T+         +T         Y D+   EG +  P   G +     C YL+   Q E+I + F  ++L  Q   C   H  I  GD ES   + +  CG +    I S  N + IR          R+++         L+QK  F   Y+     V    E+                  +  G+++SP YP      + C + +    ++   E  +L F    I  +  + C T              +EI P   VL    ++  CGT+           P  +  +             V+Y TF +   +E +        F+   SS K          +G+I SP    +YPS   C + I+      IR+ F  F L        ++H      C  D++ V   I +  +          CG S+P  L S   S+SI L F+SDS  +H GF   Y+ I    +  +   +N       G ++S  +P  Y  N  C + +     + +I +HF DF  E          + I DG  F+ S  +   CG+    P  IS SN + L F  S  A   +GF   W
Sbjct:  593 ILTGNYGSITSPGYPGNYPPGRDCVWNLLVSPGSLITFTFGTLSLESH-NDCSKDYLEI------RDGPFHHDPILGKFC-TSLSTPP--LQTTGPAARIHFHSDSETSDK----------GFHITYL--------TTPSDLYCGGNYTDT---EGELLLPPLTGPFSHSRQCVYLISQPQGEQIVINFTHVELESQRG-C--SHTFIEVGDHES---LLRKICGNETLFPIRSISNNVWIRL---------RIDA---------LVQKASFRADYQ-----VACGGEL------------------RGEGVIRSPFYPNAYAGRRTCRWTI----SQPPREVVLLNFTDFQIGSS--SSCDTD------------YIEIGPSS-VLGSPGNEKFCGTNI----------PSFITSVYN-----------VLYVTFVKSSSMENR-------GFMAMFSSEKLECGKVLTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYL--------EFH----YNCANDYLEVYDTIAQTSL-------GRYCGKSIPPSLTSS--SHSIKLIFVSDSALAHEGFSINYEAINASSVCLYDYTDNF------GRLSSPNFPNNYPHNWNCVYRITV-GLNQQIALHFTDFALEDYFGPKCVDFVEIRDG-GFETSPLIGIYCGS-VFPPRIISHSNKLWLRF-KSDTALTARGFSAYW 1158          

HSP 6 Score: 95.1301 bits (235), Expect = 5.420e-19
Identity = 151/620 (24.35%), Postives = 244/620 (39.35%), Query Frame = 3
Query:  906 TKEQKESCHFYID---------SKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ--KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGV 2720
            + E+ E   FY++            E G I+SP YP +Y     CS+LL   +   I L F D  + NH    C  D VT+ +GD+  SPIIG+ +CG+     I S  N L++ F T +                    Q +GF   +         TN +     + ++           +G +KSP +P   P+N  C++     H     E   + F +    P+ D++C          R  FVK  +    L   D+     CG             P+V L     N F++     V         G     +    C   +N S   +G I SP F + Y +N  C Y I       + + F  F L +         S  + TC+ D + +I+   +   P+++       +CGS    PL  D     + L F SD+  +  GF   Y            CG  I S   G   + +     Y +N+ C +S++   +   I++ F+DF    S+  C++  L ++DG S    S  + CG  S +P  I ST+N++ L F T   +   +G+K+ + E +   P   C G+    +K  +S   + DG+
Sbjct: 2671 SNERVEYTGFYVEYSFTNCGGIQTGENGVISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENHPT--CTSDSVTVRNGDSPGSPIIGR-YCGQSVPGPIQSGSNQLVVTFNTNN------------------QGQSRGFYATWN--------TNTLGCGGTLHSD-----------NGTIKSPHWPQTFPENSRCSWTAV-THESKHWE---ISFDSNFRIPSSDSQC----------RNSFVK--VWEGMLETNDALLATSCGN--------VAPSPIVTL----GNIFTA-----VFQSEEMPAQGFSASFIS--RCGRTFNSS---TGDIVSPNFPKHYDNNMNCNYYIDVAPQSLVILTFVSFHLED--------RSAVSGTCDYDGLHIIKGHNLSSTPLVT-------ICGSETLRPLTIDG---PVMLNFYSDAYITDFGFKISYRVA--------NCG-GIYSGTYGVLNSPSFSYTNYPNNVYCVYSLQV-RNDRLILLRFNDFEIVPSNL-CSHDYLEVFDGPSIGNRSIGKFCG--STLPQVIKSTNNSLTLLFKTD-SSQTARGWKVSFRETIG--PQQGCGGYLTEDSKSFVSPDHDSDGL 3178          

HSP 7 Score: 88.9669 bits (219), Expect = 3.894e-17
Identity = 157/725 (21.66%), Postives = 265/725 (36.55%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQ-IICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGT--DSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI------LQRLPDGSCPGF 2666
            F SP +P  YP N  C +         + +    F++E     C  D L++Y  +       F++  + + C  +    P  + S  N + + F +D            +   GFN +++ +              C       + E  I SP YP  Y ++  CS+++   +  R+ L   D DL    D C+      YDG + ++  +      ++P   I S+ N L        F++     S        +  Q+ G                                     +S  + SP YP   P N+ CT+    I  +       L F   ++  + D             R F   L+ R       D+P Q   CGT       I   G  + +R  + + +  G  GF   Y+                C   +    T  G+ NSP + + Y SNT C ++I  +  + +++ F  F L          +SL    C  DFV + +    G ++ +       CG+S+PG   S    +++ + F+SD   +  GF A++  I   D        NI+     G I +  +P  Y  N   +W+V   DSS+ I     +   E +  +C    L+IYDG  F   S L GT   +   +F S+ N++  +F +     G +GF L W  +      L  +  G+C G+
Sbjct: 1402 FSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVE-YHASCKYDTLEIYTGLD------FHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTD----------SSLNGRGFNASWRAV-----------PGGCGGIFQVSRGE--IHSPNYPNNYRANTECSWIIQVEKYHRVLLNITDFDL-EATDSCL----MTYDGSSSANTRVATVCGRQQPPNSITSSGNSL--------FVRFQSGSSSQSRGFRAQFRQECG-------------------------------AHIITDSSDSISSPLYPANYPNNQNCTWI---IEAQPPFNHIALSFTHFHLQSSTD-----------CTRDFVEILDGRDS-----DAPVQGRYCGTSLPH--PIISFGNALTVRFVSDSVY--GFDGFHAIYS-----------ASTSACGGTF---YTGDGIFNSPGYPEDYHSNTECVWNIASSPGNHLQLSFLSFQLE---------NSLN---CNKDFVEIREGNATGHLMGR------YCGNSLPGNY-SSIEGHNLWVRFVSDGSGTGMGFQARFKNIFGND--------NIVGT--HGKIATPFWPGNYPLNSNYRWTVNV-DSSHIIHGRILEMDIELT-TNCFYDSLKIYDG--FDIHSRLIGTYCGTQRESFSSSRNSLTFQFSSDSSKSG-RGFLLEWFAVDVSNVTLPTIAPGACGGY 1981          

HSP 8 Score: 88.5817 bits (218), Expect = 6.037e-17
Identity = 143/697 (20.52%), Postives = 267/697 (38.31%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQ-QSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLF-RDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIIN--HKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTE--GSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFISTSNTVHLEFIT 2579
            +  SPN+P  Y    +C +   A     + + F  F++E   P C  D     + +++ +S    +  +GR+CG +   VP  + S  N +V+ F ++   Q + +    +   LG  GT                           + G I SP +P  +P +  CS+  V ++ +   + F  +  +   +  C    V +++G  E++  +    CG      I++  N+    F + +   +                          FS  ++             + C     SS   +G + SP +P     N  C Y++    +       +L F + ++    D    +G+         +  L I  +   L  +P   ICG++   ++ +T  GP++L      N +S     ++  + FK  Y +         C  +Y   S   GV+NSP F+   YP+N  C Y +   N+  I + F +F +            + ++ C  D++ V      GP I       F CGS++  P +  S +NS++L F +DS Q+  G+   +     ++ I     CG  +  + +      +     Y   L C W + A   +  + + F+ F  E   S   C    ++I DG S  +      CG+    P FIS+ N + ++F++
Sbjct: 2699 VISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENH-PTCTSD----SVTVRNGDSP--GSPIIGRYCGQS---VPGPIQSGSNQLVVTFNTNNQGQSRGFYATWNTNTLGCGGTLH------------------------SDNGTIKSPHWPQTFPENSRCSWTAVTHESKHWEISFDSNFRIPSSDSQCRNSFVKVWEGMLETNDALLATSCGNVAPSPIVTLGNIFTAVFQSEEMPAQG-------------------------FSASFI-------------SRCGRTFNSS---TGDIVSPNFPKHYDNNMNCNYYI----DVAPQSLVILTFVSFHLE---DRSAVSGTCD-------YDGLHII-KGHNLSSTPLVTICGSE--TLRPLTIDGPVML------NFYSDA---YITDFGFKISYRVAN-------CGGIY---SGTYGVLNSPSFSYTNYPNNVYCVYSLQVRNDRLILLRFNDFEI------------VPSNLCSHDYLEVF----DGPSIGNRSIGKF-CGSTL--PQVIKSTNNSLTLLFKTDSSQTARGWKVSF-----RETIGPQQGCGGYLTEDSKSFVSPDHDSDGLYDKGLNCIWYIIA-PENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAP-FISSGNFLTVQFVS 3258          

HSP 9 Score: 85.8853 bits (211), Expect = 3.370e-16
Identity = 66/278 (23.74%), Postives = 117/278 (42.09%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLLQKKGF 1310
            +R +  SP +P  Y PN+ C +  + +S   + ++FE  F I+     C++ D+L L     +    L  +   GRFCG    + P+ + +  N + + F SD  N  Q +        L   GT                     YI     +GY+TSP YP  YP H  C ++L       I+L F D     +  +C   ++ + DG   ++P++ +  CG       +S+R ++ ++F T       G   K S +  G  +  +  +++  G+
Sbjct: 2099 DRGIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCG---IYTPSTLFTSDNEMFIQFISDNSNGGQGFKIRYEAKSLACGGTI--------------------YIHDANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIEETPNCSASYLELRDGANSNAPVLSK-LCGHTLPRNWVSSRGLMYLKFHTEGGSGYMGFKAKYSIVSCGGTVSGDSGVIESVGY 2352          

HSP 10 Score: 72.4034 bits (176), Expect = 4.087e-12
Identity = 69/264 (26.14%), Postives = 110/264 (41.67%), Query Frame = 3
Query:  447 YVVYALDCD-IIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFE-HFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPG-IYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            Y   +L C   IY  D    N+     SPN+P  YP +  C +   A S   + + FE  FNIE   P C+  +L+L     S      NA  L + CGHTL   P   VS   ++ L F+++  +          G +GF   +  +      S                + G I S  YP  +Y +++ C + + G     + + F D +L   +  C +D V I++  T  S I+   +CG      + ++ N+  IRF+T
Sbjct: 2210 YEAKSLACGGTIYIHD---ANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIE-ETPNCSASYLELRDGANS------NAPVLSKLCGHTL---PRNWVSSRGLMYLKFHTEGGS----------GYMGFKAKYSIVSCGGTVS---------------GDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNL-QSSPGCAKDFVEIWENHT--SGILLGRYCGNSIPSSVDTSSNVASIRFVT 2432          

HSP 11 Score: 68.5514 bits (166), Expect = 6.054e-11
Identity = 130/559 (23.26%), Postives = 208/559 (37.21%), Query Frame = 3
Query:  975 PTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRL-NTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQLYPSNTTCQYDIIGNNNHRI--RIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQD-----IINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDS--FQASSELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFK 2612
            P YP  YP++ NC++++        I L F    L   + DC  D V I DG    +P+ G+ +CG      I+S  N L +RF++                    +    GF+ +Y  S                 + C     + +   GI  SPGYP     N  C +                     NI  +P N      LS         +LE            + + C  D+ EI+E    G L+     N+     S I G  ++  F  D    G   +    +   N +   + G I +PF+   YP N+  ++ +  +++H I  RI   +  L+ +              C  D +++        I S+ I T   CG+       S SR NS++  F SDS +S  GF  ++  + + +     I    CG  +++        S  +P  Y +   C W + A DS+  + I   D   +    SC+   L I DGDS   Q  + LCG   ++P  I ST   +++ F +     G  GF 
Sbjct: 1635 PLYPANYPNNQNCTWIIEAQPPFNHIALSFTHFHL-QSSTDCTRDFVEILDGRDSDAPVQGR-YCGTSLPHPIISFGNALTVRFVS------------------DSVYGFDGFHAIYSAST----------------SACGGTFYTGD---GIFNSPGYPEDYHSNTECVW---------------------NIASSPGNHLQLSFLSF--------QLE------------NSLNCNKDFVEIREGNATGHLMGRYCGNSLPGNYSSIEGHNLWVRFVSDGSGTGMGFQARFKNIFGNDNIVGTHGKIATPFWPGNYPLNSNYRWTVNVDSSHIIHGRILEMDIELTTN--------------CFYDSLKIYDGF---DIHSRLIGT--YCGTQRES--FSSSR-NSLTFQFSSDSSKSGRGFLLEWFAVDVSNVTLPTIAPGACGGYMVTGDTPVFFFSPGWPGPYGNGADCIWIIYAPDSTVELNILSMDIEAQ---LSCSYDKLIIKDGDSRLSQQLAVLCG--RSVPGPIRSTGEYMYIRFTSDGSVTG-AGFN 2085          

HSP 12 Score: 67.781 bits (164), Expect = 1.064e-10
Identity = 65/251 (25.90%), Postives = 112/251 (44.62%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGP--IISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            GVI SPF+   Y    TC++ I       + + F +F +              +S+C+ D++ +      GP  ++  P    F CG+++P  +   S  N + +TF+  S   + GF A +    ++      CG+ +++E   G I S  +P  Y S + C W +        I + F  F  E  H +CAN  L +YD  +  +    CG  S  P+  S+S+++ L F+ S  A   +GF + +  I
Sbjct:  825 GVIRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIG------------SSSSCDTDYIEI------GPSSVLGSPGNEKF-CGTNIPSFIT--SVYNVLYVTFVKSSSMENRGFMAMFSSEKLE------CGK-VLTE-STGIIESPGHPNVYPSGVNCTWHI-VVQRGQLIRLVFSSFYLE-FHYNCANDYLEVYDTIAQTSLGRYCG-KSIPPSLTSSSHSIKLIFV-SDSALAHEGFSINYEAI 1042          

HSP 13 Score: 56.9954 bits (136), Expect = 2.170e-7
Identity = 83/307 (27.04%), Postives = 127/307 (41.37%), Query Frame = 3
Query: 1740 RLNTSNAF-SSGIGGFVIYYT-FKRDYG---IEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL--YPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIW 2621
            R+N +N F SSG    VI++T   R YG         E  VC     + S   G  +SP +N +  Y  N  C++ +   N  N  I I+F   SL              +  C  D +        GP+I +       C  S P  PL+       + + F+S+    ++GFY +Y F     I   + GEN       G I+S  YP  Y     C W ++A    + I + F DF  E +H +C +  + + +GDS  +      CG   ++P  I S SN + + F T+ +    +GF   W
Sbjct: 2529 RVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGT--LPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLE------------SHQDCTFDVLEFRVGNADGPLIEK------FCSLSAPRVPLVIPYPQ--VWIHFVSNERVEYTGFYVEYSFTNCGGI---QTGEN-------GVISSPNYPNLYSRWTQCSWLLEA-PEGHTITLTFSDFSVE-NHPTCTSDSVTVRNGDSPGSPIIGRYCG--QSVPGPIQSGSNQLVVTFNTNNQGQ-SRGFYATW 2798          
BLAST of Cubilin vs. Ensembl Mouse
Match: Tll1 (tolloid-like [Source:MGI Symbol;Acc:MGI:106923])

HSP 1 Score: 109.768 bits (273), Expect = 1.099e-23
Identity = 76/273 (27.84%), Postives = 132/273 (48.35%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQ----SYNQDDHMGLLGFNGTFKFIEIAPINS----------TKEQKESCHFYIDSKK---EEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKL 1292
            +P +P++YPPN  C +Q +A SQ ++ + FE F +EG    C  D+++++  + S       +K  G+FCG     +P  + S  N + ++F SD    +    ++   D       NG  +   +  + S            E K  C      +K     G ITSP +P  YPS   C++++      RI L F + ++  Q+ +C  DH+ I+DG+TE SPI+G+  CG K    +++T N + IRFI+   ++R   ++    +   +L
Sbjct:  631 TPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEV-CKYDYVEIWSGLSS------ESKLHGKFCGAD---IPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEV-EQHQECAYDHLEIFDGETEKSPILGR-LCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATHSTECGGRL 891          

HSP 2 Score: 90.8929 bits (224), Expect = 7.856e-18
Identity = 131/617 (21.23%), Postives = 235/617 (38.09%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------YNQDDHMG----------LLGFNGTFKFIEIAPINSTKEQKESCHFYIDS--KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIG-TECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRP--QKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            N    QSPN+P  Y P   C ++ +      V + F+ F IE     C  D L++       +    N+  +GRFCG+     P  + S  N + + F SD    ++      + ++D              L   G+++     P       + SC         K  G IT+P +P  YP + NC + ++   + RI + F   +L   N+ C  D+V I+ G +  S + G+ FCG      + S  N + I F + + + +   ++      DE   +    Q +  N +  ++          E  H     EC+  I S    SG++ SP +P + P  K CT+ +  I   +++  A  +F+          +C+   L I     F  + E  P   +L     PD ++   +   I+ I+      + R       S+  GG +   +  RD               +Y+         ++ F +  YP    C++ ++     R+ + FQ F + E+            + C  D+V V   +      S+ +     CGS  P  +   S  +   + F +D   +  GFY +Y  I   + ++ K
Sbjct:  469 NEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIE-RHDSCAYDHLEV------RDGASENSPLIGRFCGYD---KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQ-CACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFEL-EGNEVCKYDYVEIWSGLSSESKLHGK-FCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSP---SGLITSPNWPDKYPSRKECTWVISAIPG-HRITLAFNEFEV-----EQHQECAYDHLEI-----FDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFIS---DASVQRKGFQATHSTECGGRLKAESKPRD---------------LYS---------HAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEVEEE------------ADCGYDYVEVFDGLS-----SKAVGLGRFCGSGPPEEIY--SIGDVALIHFHTDDTINKKGFYIRYKSIRYPETMHAK 1012          

HSP 3 Score: 88.1965 bits (217), Expect = 5.367e-17
Identity = 78/332 (23.49%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE---CDMWIKS-SEKTSGILKSPGYPVRTPKNKLCTY 1484
              SP FP  YP    C ++      EK+V+NF   ++        K  L  Y  ++  +     +  LGRFCG   D V   + S  + + ++F S  N              GF   ++ I    I                +K EG I SP YP  Y     C + ++ ++   + L F+  ++  ++D C  DH+ + DG +E+SP+IG+ FCG      I ST N L ++F++   + ++        E  +  K +    +++  N +  +           E  + +G +   C+        K +G + +PG+P   P NK C +
Sbjct:  360 LSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL-------YKSSLCWYDYIEVRDGYWRKSPLLGRFCG---DKVAGVLTSTDSRMWIEFRSSSNWVGK----------GFAAVYEAICGGEI----------------RKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEI-ERHDSCAYDHLEVRDGASENSPLIGR-FCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQC-------ACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVW 646          

HSP 4 Score: 68.1662 bits (165), Expect = 6.315e-11
Identity = 68/265 (25.66%), Postives = 111/265 (41.89%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD 2648
            SG+I SP +   YPS   C + I     HRI + F EF + +            +  C  D + +   +  K PI+ +      LCGS +P PL++    N + + FISD+     GF A +         + +CG  + +E +  ++ S      N YP      L C+W + + +  +R+ + F  F  E     C    + ++DG S +A      CG  S  P  I +   V L    +     +KGF + +  I  R P+
Sbjct:  782 SGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQ------------HQECAYDHLEIFDGETEKSPILGR------LCGSKIPDPLMAT--GNEMFIRFISDASVQRKGFQATH---------STECGGRLKAESKPRDLYSHAQFGDNNYP----GQLDCEWLLVS-ERGSRLELSFQTFEVE-EEADCGYDYVEVFDGLSSKAVGLGRFCG--SGPPEEIYSIGDVALIHFHTDDTINKKGFYIRYKSI--RYPE 1007          

HSP 5 Score: 63.929 bits (154), Expect = 1.432e-9
Identity = 73/240 (30.42%), Postives = 101/240 (42.08%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            SG ++SP F   YPS T C + +      +I + F    L             K+S C  D++ V      K P++ +       CG  V G L S DSR   + + F S S     GF A Y+ I         CG     EIR   G I S  YP +YR    C W +   +  + + + F  F  E  H SCA   L + DG S  +      CG D   P  I STSNT+ ++F++
Sbjct:  357 SGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL------------YKSSLCWYDYIEVRDGYWRKSPLLGR------FCGDKVAGVLTSTDSR---MWIEFRSSSNWVGKGFAAVYEAI---------CG----GEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYH-VGLTFQAFEIE-RHDSCAYDHLEVRDGASENSPLIGRFCGYDK--PEDIRSTSNTLWMKFVS 558          

HSP 6 Score: 56.6102 bits (135), Expect = 2.259e-7
Identity = 37/132 (28.03%), Postives = 65/132 (49.24%), Query Frame = 3
Query:  948 KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF------ITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYR 1325
            ++  G ++SP +P  YPS+ +C + +     E+I L F  +DL +++  C  D++ + DG    SP++G+ FCG+K    + ST + + I F      +   F        G EI+ N   +Q   +   YR
Sbjct:  354 QESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL-YKSSLCWYDYIEVRDGYWRKSPLLGR-FCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYR 483          

HSP 7 Score: 55.0694 bits (131), Expect = 6.298e-7
Identity = 66/281 (23.49%), Postives = 112/281 (39.86%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQ----------------------------------YDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTS-NTVHLEFITSPKAYGQKGFK 2612
            G I SP +   Y     C + I+ +  + + + FQ F +             ++ +C  D + V     +  P+I +       CG   P  +   S SN++ + F+SD   + +GF A                                   Y+  P +      CG  +++++ G  IT+  +P+EY  N  C W V A  S  RI + F  F  EG ++ C    + I+ G S ++    + CG D  IP  +++  N + +EF  S     +KGFK
Sbjct:  471 GQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIE------------RHDSCAYDHLEVRDGASENSPLIGR------FCGYDKPEDI--RSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACG-GLLTKLNG-TITTPGWPKEYPPNKNCVWQVIA-PSQYRISVKFEFFELEG-NEVCKYDYVEIWSGLSSESKLHGKFCGAD--IPEVMTSHFNNMRIEF-KSDNTVSKKGFK 724          
BLAST of Cubilin vs. Ensembl Mouse
Match: Bmp1 (bone morphogenetic protein 1 [Source:MGI Symbol;Acc:MGI:88176])

HSP 1 Score: 105.531 bits (262), Expect = 2.423e-22
Identity = 87/371 (23.45%), Postives = 159/371 (42.86%), Query Frame = 3
Query:  435 CLTNYVVYALDCDIIYYSDKIGVNNRRM--------------FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD------------INTQQSYNQDDHMGLLGFNGTFKFIE-------IAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGI 1430
            CL     Y   CD  Y   ++  + RR                 SP +P++YPPN  C +Q VA +Q ++ + F+ F  EG    C  DF+++   + +      ++K  G+FCG      P  + S +N + ++F SD             + +   ++D+         TF   E       +   N    ++  C   + S    G ITSP +P  YPS   C++ +      R++L F ++D+  Q  +C  DH+ ++DG    +P++G+ FCG K    +L+T N + +RF + + ++R         E G +++ + K             + D        + N+  G +C+ W+  +E+  G+
Sbjct:  568 CLNTLGSYKCSCDPGY---ELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGN-DVCKYDFVEVRSGLTA------DSKLHGKFCG---SEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTS--GTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQ-PECAYDHLEVFDGRDAKAPVLGR-FCGSKKPEPVLATGNRMFLRFYSDNSVQRKGFQASHSTECGGQVRADVK-------------TKDLYSHAQFGDNNYPGGVDCE-WVIVAEEGYGV 907          

HSP 2 Score: 98.2117 bits (243), Expect = 4.199e-20
Identity = 142/618 (22.98%), Postives = 243/618 (39.32%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------YNQDDHMG----------LLGFNGTFKF-----IEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLES-----GDEIKMNPKLLQKKGFNVVYRFSVD----YVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIE-GKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            QSPN+P  Y P+  C ++        V + F+ F IE     C  D+L++  +  S  S L     +GR+CG+     P+ + S  + + L F SD +  ++      + + D              L   G++K       E+AP    +  + +C  ++   K  G ITSP +P  YP + NC + LV   + RI L F D      ND C  D V +  G T  S + G+ FCG EKP++ I S  N + + F + + + +   ++      DE   +    Q+   N    +       +V   N   K+      C+  + S   TSG + SP +P + P  K CT+ +    +        L F  ++I   P+  C+   L ++  R     +  R              CG+  ++ + +   G  + LR  + N+        V    F+  +  E G  V   V         TK    ++ F +  YP    C++ I+    + + + FQ F + E+            + C  D++ +          S        CGS  P  +   S  +S+ + F SD   S  GF+ +Y     QD ++ +
Sbjct:  452 QSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIE-RHDSCAYDYLEVR-DGHSESSNL-----IGRYCGY---EKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAP--DKRRCEAACGGFL--TKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQF-DFFETEGNDVCKYDFVEVRSGLTADSKLHGK-FCGSEKPEV-ITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDN---KHDCKEAGCEHKVTS---TSGTITSPNWPDKYPSKKECTWAI----SSTPGHRVKLTFVEMDIESQPE--CAYDHLEVFDGRDAKAPVLGR-------------FCGS--KKPEPVLATGNRMFLRFYSDNS--------VQRKGFQASHSTECGGQVRADV--------KTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEE------------TDCGYDYIELFDGYD-----STAPRLGRYCGSGPPEEVY--SAGDSVLVKFHSDDTISKKGFHLRYTSTKFQDTLHSR 990          

HSP 3 Score: 78.1814 bits (191), Expect = 5.684e-14
Identity = 74/330 (22.42%), Postives = 135/330 (40.91%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFL 1490
            F SP +P  Y  ++ C ++      EK+++NF   ++        +  L  Y  ++  +     A   GRFCG  L   P  +VS  + + ++F S  N              GF   ++ I                   D KK+ G+I SP YP  Y     C + +  ++   + L F+  ++  ++D C  D++ + DG +ESS +IG+ +CG +    I ST + L ++F++   I ++        E  +  + N    +++  N +  +                    C  ++    K +G + SPG+P   P NK C + L
Sbjct:  338 FSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDL-------YRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKL---PEPIVSTDSRLWVEFRSSSNWVGK----------GFFAVYEAICGG----------------DVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEI-ERHDSCAYDYLEVRDGHSESSNLIGR-YCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLT---KLNGSITSPGWPKEYPPNKNCIWQL 626          

HSP 4 Score: 58.5362 bits (140), Expect = 6.792e-8
Identity = 63/237 (26.58%), Postives = 104/237 (43.88%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
            +G  +SP +   Y ++  C + I      +I + F    L             ++  C  D+V V      G     P+   F CG  +P P++S DSR   + + F S S     GF+A Y+ I         CG ++  +   G+I S  YP +YR + +C W ++  +  + + + F  F  E  H SCA   L + DG S  ++     CG +   P  I STS+ + L+F++
Sbjct:  335 TGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDL------------YRSRLCWYDYVEVRD----GFWRKAPLRGRF-CGGKLPEPIVSTDSR---LWVEFRSSSNWVGKGFFAVYEAI---------CGGDVKKD--NGHIQSPNYPDDYRPSKVCIWRIQVSEGFH-VGLTFQSFEIE-RHDSCAYDYLEVRDGHSESSNLIGRYCGYEK--PDDIKSTSSRLWLKFVS 536          

HSP 5 Score: 55.8398 bits (133), Expect = 4.029e-7
Identity = 60/264 (22.73%), Postives = 104/264 (39.39%), Query Frame = 3
Query: 1860 YNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            + ++ST SG I SP +   YPS   C + I     HR+++ F E  +                 C  D + V   +  K P++ +       CGS  P P+++    N + L F SD+     GF A +         + +CG  + ++++  ++ S      N YP      + C+W + A +    + + F  F  E     C    + ++DG    A      CG  S  P  + ++    L    S     +KGF L ++
Sbjct:  754 HKVTST-SGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIE------------SQPECAYDHLEVFDGRDAKAPVLGR------FCGSKKPEPVLAT--GNRMFLRFYSDNSVQRKGFQASH---------STECGGQVRADVKTKDLYSHAQFGDNNYP----GGVDCEWVIVA-EEGYGVELVFQTFEVE-EETDCGYDYIELFDGYDSTAPRLGRYCG--SGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRYT 979          

HSP 6 Score: 53.1434 bits (126), Expect = 2.534e-6
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            G  +SP YP  Y +H++C + +     E+I L F  +DL +++  C  D+V + DG    +P+ G+ FCG K    I+ST + L + F
Sbjct:  336 GNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDL-YRSRLCWYDYVEVRDGFWRKAPLRGR-FCGGKLPEPIVSTDSRLWVEF 421          
BLAST of Cubilin vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 97.8265 bits (242), Expect = 5.036e-20
Identity = 74/276 (26.81%), Postives = 125/276 (45.29%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD------------------------------INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES 1262
            SP +P++YP N  C +Q VA  Q ++ + FE F +EG    C  DF    +E++S  S   +AK  G+FCG      P  + S  N + ++F SD                              +NT  SY       L      ++  E    N    ++  C + I S   EG + SP +P  YPS   C++ +      R+++ F + ++  Q+ +C  DH+ +YDG    +PI+G+ FCG K    +++T + L +RF +   ++R   ++
Sbjct:  613 SPGWPKEYPTNKNCVWQVVAPVQYRISLQFEAFELEGN-DVCKYDF----VEVRSGLSP--DAKLHGKFCG---SETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQQECVNTFGSY-------LCRCRNGYRLHE----NGHDCKEAGCAYKISSA--EGTLMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEI-EQHQECAYDHLELYDGTDSLAPILGR-FCGSKKPDPVVATGSSLFLRFYSDASVQRKGFQA 863          

HSP 2 Score: 96.6709 bits (239), Expect = 1.221e-19
Identity = 77/243 (31.69%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
              SPN+P KYP    C +   + +  +V I F  F IE     C  D L+LY    SL      A  LGRFCG      P+ VV+  + + L FYSD + Q+   Q  H    G  G  K  E+     TKE      F  ++               YPS   C +++V      + L+FR  ++  +  DC  D +  YDG   S+P +G+ FCG  P  +I S  + L+IRF T D I +
Sbjct:  767 LMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEIEQHQE-CAYDHLELYDGTDSL------APILGRFCG---SKKPDPVVATGSSLFLRFYSDASVQRKGFQAVHSTECG--GRLK-AEV----QTKELYSHAQFGDNN---------------YPSQARCDWVIVAEDGYGVELIFRTFEVEEEA-DCGYDFMEAYDGYDSSAPRLGR-FCGSGPLEEIYSAGDSLMIRFHTDDTINK 975          

HSP 3 Score: 83.1889 bits (204), Expect = 1.565e-15
Identity = 81/329 (24.62%), Postives = 134/329 (40.73%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEIKM-NPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY 1484
            F +P FP  YP    C ++      EK+++NF   ++        K  L  Y  ++  +     A  LGRFCG   D +P  +VS  + + ++F S  ++            LG  G F   E                  D  K+ G I SP YP  Y     C + +       + L F+  ++  ++D C  D++ I DG TE S +IG  FCG EKP+  + S+ N L ++F++   I ++   +      DE    +    +++  N +  ++                   C  +I    K +G + SPG+P   P NK C +
Sbjct:  342 FSAPGFPNGYPSYSHCVWRISVTPGEKIILNFTSMDL-------FKSRLCWYDYVEIRDGYWRKAPLLGRFCG---DKIPESLVSSDSRLWVEFRSSSSS------------LG-KGFFAVYEAMCGG-------------DITKDAGQIQSPNYPDDYRPSKECVWRITVPDGFHVGLTFQSFEI-ERHDSCAYDYLEIRDGPTEDSTLIGH-FCGYEKPEA-VKSSANRLWVKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCVNTLGSYTCACDPGYELAADKKTCEVACGGFIT---KLNGTITSPGWPKEYPTNKNCVW 628          

HSP 4 Score: 62.3882 bits (150), Expect = 4.005e-9
Identity = 64/260 (24.62%), Postives = 103/260 (39.62%), Query Frame = 3
Query: 1857 VYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
             Y ISS + G + SP +   YPS   C ++I     HR++I F EF + +            +  C  D + +        PI+ +       CGS  P P++  +  +S+ L F SD+     GF         Q + + +CG  + +E++   + S      N YP + R    C W + A D     +I F  F  E     C    +  YDG    A      CG+   +    S  +++ + F T      +KGF
Sbjct:  757 AYKISSAE-GTLMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEIEQ------------HQECAYDHLELYDGTDSLAPILGR------FCGSKKPDPVV--ATGSSLFLRFYSDASVQRKGF---------QAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSQAR----CDWVIVAEDGYGVELI-FRTFEVE-EEADCGYDFMEAYDGYDSSAPRLGRFCGS-GPLEEIYSAGDSLMIRFHTD-DTINKKGF 978          

HSP 5 Score: 62.003 bits (149), Expect = 5.035e-9
Identity = 62/237 (26.16%), Postives = 101/237 (42.62%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFIT 2579
            +G  ++P F   YPS + C + I      +I + F    L             K+  C  D+V +      K P++ +       CG  +P  L+S DSR   + + F S S     GF+A Y+ +         CG +I  +   G I S  YP +YR +  C W +   D  + + + F  F  E  H SCA   L I DG +  ++     CG +    A  S++N + ++F++
Sbjct:  339 TGNFSAPGFPNGYPSYSHCVWRISVTPGEKIILNFTSMDL------------FKSRLCWYDYVEIRDGYWRKAPLLGR------FCGDKIPESLVSSDSR---LWVEFRSSSSSLGKGFFAVYEAM---------CGGDITKD--AGQIQSPNYPDDYRPSKECVWRITVPDGFH-VGLTFQSFEIE-RHDSCAYDYLEIRDGPTEDSTLIGHFCGYEKP-EAVKSSANRLWVKFVS 540          
BLAST of Cubilin vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 97.8265 bits (242), Expect = 5.412e-20
Identity = 74/276 (26.81%), Postives = 125/276 (45.29%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD------------------------------INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES 1262
            SP +P++YP N  C +Q VA  Q ++ + FE F +EG    C  DF    +E++S  S   +AK  G+FCG      P  + S  N + ++F SD                              +NT  SY       L      ++  E    N    ++  C + I S   EG + SP +P  YPS   C++ +      R+++ F + ++  Q+ +C  DH+ +YDG    +PI+G+ FCG K    +++T + L +RF +   ++R   ++
Sbjct:  630 SPGWPKEYPTNKNCVWQVVAPVQYRISLQFEAFELEGN-DVCKYDF----VEVRSGLSP--DAKLHGKFCG---SETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQQECVNTFGSY-------LCRCRNGYRLHE----NGHDCKEAGCAYKISSA--EGTLMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEI-EQHQECAYDHLELYDGTDSLAPILGR-FCGSKKPDPVVATGSSLFLRFYSDASVQRKGFQA 880          

HSP 2 Score: 96.6709 bits (239), Expect = 1.416e-19
Identity = 77/243 (31.69%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
              SPN+P KYP    C +   + +  +V I F  F IE     C  D L+LY    SL      A  LGRFCG      P+ VV+  + + L FYSD + Q+   Q  H    G  G  K  E+     TKE      F  ++               YPS   C +++V      + L+FR  ++  +  DC  D +  YDG   S+P +G+ FCG  P  +I S  + L+IRF T D I +
Sbjct:  784 LMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEIEQHQE-CAYDHLELYDGTDSL------APILGRFCG---SKKPDPVVATGSSLFLRFYSDASVQRKGFQAVHSTECG--GRLK-AEV----QTKELYSHAQFGDNN---------------YPSQARCDWVIVAEDGYGVELIFRTFEVEEEA-DCGYDFMEAYDGYDSSAPRLGR-FCGSGPLEEIYSAGDSLMIRFHTDDTINK 992          

HSP 3 Score: 83.1889 bits (204), Expect = 1.691e-15
Identity = 81/329 (24.62%), Postives = 134/329 (40.73%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEIKM-NPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY 1484
            F +P FP  YP    C ++      EK+++NF   ++        K  L  Y  ++  +     A  LGRFCG   D +P  +VS  + + ++F S  ++            LG  G F   E                  D  K+ G I SP YP  Y     C + +       + L F+  ++  ++D C  D++ I DG TE S +IG  FCG EKP+  + S+ N L ++F++   I ++   +      DE    +    +++  N +  ++                   C  +I    K +G + SPG+P   P NK C +
Sbjct:  359 FSAPGFPNGYPSYSHCVWRISVTPGEKIILNFTSMDL-------FKSRLCWYDYVEIRDGYWRKAPLLGRFCG---DKIPESLVSSDSRLWVEFRSSSSS------------LG-KGFFAVYEAMCGG-------------DITKDAGQIQSPNYPDDYRPSKECVWRITVPDGFHVGLTFQSFEI-ERHDSCAYDYLEIRDGPTEDSTLIGH-FCGYEKPEA-VKSSANRLWVKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCVNTLGSYTCACDPGYELAADKKTCEVACGGFIT---KLNGTITSPGWPKEYPTNKNCVW 645          

HSP 4 Score: 62.3882 bits (150), Expect = 3.764e-9
Identity = 64/260 (24.62%), Postives = 103/260 (39.62%), Query Frame = 3
Query: 1857 VYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
             Y ISS + G + SP +   YPS   C ++I     HR++I F EF + +            +  C  D + +        PI+ +       CGS  P P++  +  +S+ L F SD+     GF         Q + + +CG  + +E++   + S      N YP + R    C W + A D     +I F  F  E     C    +  YDG    A      CG+   +    S  +++ + F T      +KGF
Sbjct:  774 AYKISSAE-GTLMSPNWPDKYPSRKECTWNISSTAGHRVKITFSEFEIEQ------------HQECAYDHLELYDGTDSLAPILGR------FCGSKKPDPVV--ATGSSLFLRFYSDASVQRKGF---------QAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSQAR----CDWVIVAEDGYGVELI-FRTFEVE-EEADCGYDFMEAYDGYDSSAPRLGRFCGS-GPLEEIYSAGDSLMIRFHTD-DTINKKGF 995          

HSP 5 Score: 62.003 bits (149), Expect = 4.613e-9
Identity = 62/237 (26.16%), Postives = 101/237 (42.62%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFIT 2579
            +G  ++P F   YPS + C + I      +I + F    L             K+  C  D+V +      K P++ +       CG  +P  L+S DSR   + + F S S     GF+A Y+ +         CG +I  +   G I S  YP +YR +  C W +   D  + + + F  F  E  H SCA   L I DG +  ++     CG +    A  S++N + ++F++
Sbjct:  356 TGNFSAPGFPNGYPSYSHCVWRISVTPGEKIILNFTSMDL------------FKSRLCWYDYVEIRDGYWRKAPLLGR------FCGDKIPESLVSSDSR---LWVEFRSSSSSLGKGFFAVYEAM---------CGGDITKD--AGQIQSPNYPDDYRPSKECVWRITVPDGFH-VGLTFQSFEIE-RHDSCAYDYLEIRDGPTEDSTLIGHFCGYEKP-EAVKSSANRLWVKFVS 557          
BLAST of Cubilin vs. UniProt/SwissProt
Match: sp|O70244|CUBN_RAT (Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 1.788e-28
Identity = 166/724 (22.93%), Postives = 282/724 (38.95%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDIN-TQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSN----AFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIP-KGPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
            Y+D  G     M  SPNFP  YP N  C Y+      +++ ++F  F +E        DF++  I     E++      +G +CG  L   P  ++S  N + L F SD   T + ++        G  G                              G +TSP YP  Y     C + L  +      L F+D  L H    C  D++ ++DG T +S +I +  CG+     I S ++++L++          R ++G          Q +GF + +R   D V I N                    KTSGIL+S  YP    KN+ C + +                           + +TG+   Y+   F V+  +               C TDY E+ +    GP  + R   +N      ++G    V+++T   + G +G  ++    H      S  +G  +SP +   YP N  C ++I       I++   +F +        +YH+    +C  D + +   +    P I+Q      LC  S    P+   S  N +++ F +DS  +  GF A +  +P        CG   I ++  G I S  YP  YR+N  C W ++  +  +R++++  DF  E       +S LR+ DG S   +  + +CG      + I++ N++ + F  S  +   +GF+  + E
Sbjct: 1052 YTDNFG-----MLSSPNFPNNYPSNWECIYRITVGLNQQIALHFTDFTLEDYFGSQCVDFVE--IRDGGYETSPL----VGIYCGSVL---PPTIISHSNKLWLKFKSDAALTAKGFSAYWDGSSTGCGGNLT------------------------TPTGVLTSPNYPMPYYHSSECYWRLEASHGSPFELEFQDFHLEHH-PSCSLDYLAVFDGPTTNSRLIDK-LCGDTTPAPIRSNKDVVLLKL---------RTDAGQ---------QGRGFEINFRQRCDNVVIVN--------------------KTSGILESINYPNPYDKNQRCNWTI---------------------------QATTGNTVNYTFLGFDVESYMN--------------CSTDYVELYD----GPQWMGRYCGNNMPPPGATTGSQLHVLFHTDGINSGEKGFKMQ-WFTHGCGGEMSGTAGSFSSPGYPNSYPHNKECIWNIRVAPGSSIQLTIHDFDV--------EYHT----SCNYDSLEIYAGLDFNSPRIAQ------LCSQSPSANPMQVSSTGNELAIRFKTDSTLNGRGFNASWRAVP------GGCGG--IIQLSRGEIHSPNYPNNYRANTECSWIIQV-ERHHRVLLNITDFDLEA-----PDSCLRLMDGSSSTNARVASVCGRQQPPNSIIASGNSLFVRF-RSGSSSQNRGFRAEFRE 1618          

HSP 2 Score: 118.242 bits (295), Expect = 3.864e-25
Identity = 158/703 (22.48%), Postives = 271/703 (38.55%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
             F+SP +P  YP    C++      ++ V++NF  F I G    C+ D    YIE+    S++  +    +FC     ++P+F+ S++NI+ + F           +   M   GF   F              K  C   + +    G I SP +P +YP  +NC++ +V  + + IRL F    L  H N  C  D++ IYD  T +   +G+ +CG+     + S  N + + F++                     L  +GF++ Y  ++D   +                 +       G+L SP +P   P N  C Y +    N    +   L F    +     ++C    +    IR      E  P  LV       I CG+       I      + L+  +  A ++   GF  Y+      G  G +  P             +GV+ SP +   Y  ++ C + +  ++     + FQ+F L              + +C  D++ V      GP  +  +    LCG + P P+ S+   + + L   +D+ Q   GF   +           +C   +I     G + S  YP  Y  N  C W+++A  + N +   F  F  E S+ +C+   + +YDG   Q     CG +   P   +T + +H+ F T     G+KGFK+ W
Sbjct:  826 FFRSPFYPNAYPGRRTCRWTISQPQRQVVLLNFTDFQI-GSSASCDTD----YIEIG--PSSVLGSPGNEKFCS---SNIPSFITSVYNILYVTFV----------KSSSMENRGFTAKFS-----------SDKLECGEVLTAST--GIIESPGHPNVYPRGVNCTWHVVVQRGQLIRLEFSSFYLEFHYN--CTNDYLEIYD--TAAQTFLGR-YCGKSIPPSLTSNSNSIKLIFVSD------------------SALAHEGFSINYE-AIDASSVC----------------LYDYTDNFGMLSSPNFPNNYPSNWECIYRITVGLN----QQIALHFTDFTLEDYFGSQC----VDFVEIRD--GGYETSP--LV------GIYCGSVLPPT--IISHSNKLWLKFKSDAALTAK--GFSAYWD-GSSTGCGGNLTTP-------------TGVLTSPNYPMPYYHSSECYWRLEASHGSPFELEFQDFHLEH------------HPSCSLDYLAVFD----GPTTNSRL-IDKLCGDTTPAPIRSNK--DVVLLKLRTDAGQQGRGFEINF---------RQRCDNVVIVNKTSGILESINYPNPYDKNQRCNWTIQA-TTGNTVNYTFLGFDVE-SYMNCSTDYVELYDGP--QWMGRYCGNNMPPPG-ATTGSQLHVLFHTDGINSGEKGFKMQW 1386          

HSP 3 Score: 114.39 bits (285), Expect = 5.073e-24
Identity = 175/777 (22.52%), Postives = 300/777 (38.61%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDI-NTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLLQKKGF-------NVVYRFSV-------------------------DYVKITNEMEKNHIIGTECDMWIKSSEKTS-----------GILKSPGYPVRTPKNK-LCTYFLYGIHNRNKMETAVLKFQTLNIP-PTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREI-KEITCKGPL---VLLRLNTSNAF-SSGIGGFVIYYT-FKRDYG---IEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL--YPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVP-GPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            +R +  SP +P  Y PN+ C +  + ++   + ++FE  F I+     C++ D+L L     +    L  +   GRFCG    + P+ + +  N + + F SD  N  Q +        L   GT                     YI     +GY+TSP YP  YP H  C ++L       I+L F D        +C   ++ + DG   ++ ++ +  CG       +S+R  + ++F T       G   K S    G  +  +  +++  G+       NV  ++ +                         D+V+I        ++G  C     SS  TS           G + + G+ ++   ++ +C   L+G             F + N P P P  +    ++++   R    ++ +    L L   P    C +++  +   I    PL   +  R+N +N F SSG    V+++T   R YG         E  VC     + S   G  +SP +N +  Y  N  C++ +   N  N  I IYF E S+              +  C  D +        GP+I +       C  S P  PL+       + + F+S+    ++GFY +Y F     I   + G+N       G I+S  YP  Y +   C W +KA    + I + F DF+ E +H +C +  + + +GDS  +      CG     P   S SN + + F T+ +    +GF   W+
Sbjct: 2099 DRGVITSPKYPDTYLPNLNCSWHVLVQTGLTIAVHFEQPFQIQNRDSFCSQGDYLVLRNGPDNHSPPLGPSGRNGRFCGM---YAPSTLFTSGNEMFVQFISDSSNGGQGFKIRYEAKSLACGGTV--------------------YIHDADSDGYLTSPNYPANYPQHAECIWILEAPPGRSIQLQFEDQFNIEDTPNCSVSYLELRDGANSNARLVSK-LCGHTLPHSWVSSRERIYLKFHTDGGSSYMGFKAKYSIASCGGTVSGDSGVIESIGYPTLPYANNVFCQWFIRGLPGHYLTLSFEDFNLQSSPGCTKDFVEIWENHTSGRVLGRYCGNSTPSSVDTSSNVASVKFVTDGSVTASGFRLQFKSSRQVCGGDLHG---------PTGTFTSPNYPNPNPHARICEWTITVQEGR----RIVLTFTNLRLSTQPS---CNSEHLIVFNGIRSNSPLLQKLCSRVNVTNEFKSSGNTMKVVFFTDGSRPYGGFTASYTSTEDAVCGGF--LPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIYFLELSIE------------SHQDCTFDVLEFRVGDADGPLIEK------FCSLSAPTAPLVIPYP--QVWIHFVSNERVEYTGFYIEYSFTDCGGI---RTGDN-------GVISSPNYPNLYSAWTHCSWLLKA-PEGHTITLTFSDFLLE-AHPTCTSDSVTVRNGDSPGSPVIGRYCGQSVPRP-IQSGSNQLIVTFNTNNQGQ-TRGFYATWT 2799          

HSP 4 Score: 107.457 bits (267), Expect = 7.013e-22
Identity = 189/787 (24.02%), Postives = 301/787 (38.25%), Query Frame = 3
Query:  498 GVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVV-INFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF----ITGD-------FIKRSRLESGD-------EIKMNPK-------------LLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPG----YPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSL---SIYSIRPFF---------VKLEI-RPQK-LVLPDSPDQII-----CGTDYREIKEITCKGPLVLLRLNTSNAF-SSGIGGFV------IYYTFKRDYGIEGKMVEPGVCHFVYNISSTK----------SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFL---CGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSEL---CGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            G      + SPN    Y  N+ C +  V   +EKV+ + F  F++E     C +++L ++    S +  L      GR+CG      P  + S  N +    YS+ I + + +       L    G                              G ITSP YPG YP   +C + ++ N    I   F  L L   ND C +D++ I DG     P++G+ FC       + +T     I F     T D          +S L+ G        E+ + P              + Q +G  +V  F+  +V++ ++M  +H        +I+  +  S + K  G    +P+R+  NK        +  R +++  V K          D + + G +     +   PF+          +  I +PQ+ +VL +  D  I     C TDY EI      GP  +L    +  F SS I  F+      +Y TF +   +E +        F    SS K          +G+I SP    +YP    C + ++      IR+ F  F L        ++H      C  D++ +     +          +FL   CG S+P  L S+S  NSI L F+SDS  +H GF   Y+ I    +  +   +N       G ++S  +P  Y SN  C + +     + +I +HF DF  E    S     + I DG  ++ S  +   CG+    P  IS SN + L+F  S  A   KGF   W
Sbjct:  480 GTQGTFAYHSPN--DTYIHNVNC-FWIVRTDEEKVLHVTFTFFDLESA-SNCPREYLQIHDGDSSADFPL------GRYCG---SRPPQGIHSSANALYFHLYSEYIRSGRGFTARWEAKLPECGGILT------------------------DNYGSITSPGYPGNYPPGRDCVWQVLVNPNSLITFTFGTLSLESHND-CSKDYLEIRDGPFHQDPVLGK-FCTSLSTPPLKTTGPAARIHFHSDSETSDKGFHITYLTTQSDLDCGGNYTDTDGELLLPPLSGPFSHSRQCVYLITQAQGEQIVINFT--HVELESQMGCSH-------TYIEVGDHDSLLRKICGNETLFPIRSVSNK--------VWIRLRIDALVQKASF-----RADYQVACGGMLRGEGFFRSPFYPNAYPGRRTCRWTISQPQRQVVLLNFTDFQIGSSASCDTDYIEI------GPSSVLGSPGNEKFCSSNIPSFITSVYNILYVTFVKSSSMENR-------GFTAKFSSDKLECGEVLTASTGIIESPGHPNVYPRGVNCTWHVVVQRGQLIRLEFSSFYL--------EFHY----NCTNDYLEIYDTAAQ----------TFLGRYCGKSIPPSLTSNS--NSIKLIFVSDSALAHEGFSINYEAIDASSVCLYDYTDNF------GMLSSPNFPNNYPSNWECIYRITV-GLNQQIALHFTDFTLEDYFGSQCVDFVEIRDG-GYETSPLVGIYCGS-VLPPTIISHSNKLWLKF-KSDAALTAKGFSAYW 1158          

HSP 5 Score: 102.449 bits (254), Expect = 2.509e-20
Identity = 154/662 (23.26%), Postives = 249/662 (37.61%), Query Frame = 3
Query:  528 PNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGE-KPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGY-PVRT-PKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYN------ISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG 2483
            P  P  Y  N+ C++         + ++FE FN++   PGC KDF++++    S        + LGR+CG++    P+ V +  N+  + F +D +   S          GF   FK             ++ C    D     G  TSP YP   P    C + +   +  RI L F +L L+ Q   C  +H+ +++G   +SP++ Q  C       +  S+ N + + F    F   SR                 GF   Y  + D V               C  ++ S   + G   SPGY  +R   +N  C + L   +  N                         S+SIY     F++L I   +           C  D  E +     GPL+        + S+     VI Y     + +  + VE    +  Y+      I +  +GVI+SP +  LY + T C + +     H I + F +F L              + TC  D V V     P  P+I +       CG SVP P+   S SN + +TF +++     GFYA +    +       CG    S    G I S  +P+ +  N  C W+V   +S +  +    +F    S   C NS +++++G
Sbjct: 2353 PTLP--YANNVFCQWFIRGLPGHYLTLSFEDFNLQSS-PGCTKDFVEIWENHTS-------GRVLGRYCGNS---TPSSVDTSSNVASVKFVTDGSVTAS----------GFRLQFK-----------SSRQVCGG--DLHGPTGTFTSPNYPNPNPHARICEWTITVQEGRRIVLTFTNLRLSTQ-PSCNSEHLIVFNGIRSNSPLL-QKLCSRVNVTNEFKSSGNTMKVVF----FTDGSR--------------PYGGFTASYTSTEDAV---------------CGGFLPS--VSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENS------------------------SISIY-----FLELSIESHQ----------DCTFDVLEFRVGDADGPLI----EKFCSLSAPTAPLVIPYPQVWIHFVSNERVEYTGFYIEYSFTDCGGIRTGDNGVISSPNYPNLYSAWTHCSWLLKAPEGHTITLTFSDFLLE------------AHPTCTSDSVTVRNGDSPGSPVIGR------YCGQSVPRPI--QSGSNQLIVTFNTNNQGQTRGFYATWTTNAL------GCGGTFHSA--NGTIKSPHWPQTFPENSRCSWTVITHESKHWEISFDSNFRIPSSDSQCQNSFVKVWEG 2870          

HSP 6 Score: 100.138 bits (248), Expect = 1.107e-19
Identity = 167/724 (23.07%), Postives = 277/724 (38.26%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQ------KLVLPD-----SPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYF-QEFSLSEDGVKRQKYHSLKNSTC-EGDFVRVIQKIPK--GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENII--SEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIP-AFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            +F SP++P  Y PN  C +   +    ++ ++F  FN+E  L  CNKDF    +E++   +T      +GR+CG++L    N+  +  + + + F SD +             +GF   FK   I   N+                  G I SP +PG YP + N  +++  +    I     ++D+     +C  D + IYDG    S +IG  +CG + +    S+RN L  +F +   +                    +GF ++  F+VD    T       I    C  ++ + +    I  SPG+P        C + +Y                       PD   ST  L+I S       L+I PQ      KL++ D     SP+  ++CG        ++  GP+                G  +Y  F  D  + G                   GVI SP +   Y  N  C + ++      I ++F Q F +             ++S C +GD++ V++  P    P +         CG   P  L +    N + + FISDS     GF  +Y+   +       CG  +        G +TS  YP  Y  +  C W ++A      I + F D        +C+ S L + DG +  A   S+LCG    +P +++S+   ++L+F T   +    GFK  +S
Sbjct: 1748 IFNSPDYPADYHPNAECVWNIASSPGNRLQLSFLSFNLENSL-NCNKDF----VEIREGNAT---GHLIGRYCGNSLPG--NYSSAEGHSLWVRFVSDGSGTG----------MGFQARFK--NIFGNNNIV-------------GTHGKIASPFWPGKYPYNSNYKWVVNVDAYHIIHGRILEMDI-EPTTNCFYDSLKIYDGFDTHSRLIGT-YCGTQTE-SFSSSRNSLTFQFSSDSSVS------------------GRGF-LLEWFAVDVSDSTPPT----IAPGACGGFMVTGDTPVHIF-SPGWPREYANGADCIWIIY----------------------APD---STVELNILS-------LDIEPQQSCNYDKLIVKDGDSDLSPELAVLCG--------VSPPGPIRST-------------GEYMYIRFTSDTSVAGTGFNASFHKSCGGYLHADRGVITSPKYPDTYLPNLNCSWHVLVQTGLTIAVHFEQPFQIQN-----------RDSFCSQGDYL-VLRNGPDNHSPPLGPSGRNGRFCGMYAPSTLFTSG--NEMFVQFISDSSNGGQGFKIRYEAKSL------ACGGTVYIHDADSDGYLTSPNYPANYPQHAECIWILEA-PPGRSIQLQFEDQFNIEDTPNCSVSYLELRDGANSNARLVSKLCG--HTLPHSWVSSRERIYLKFHTDGGS-SYMGFKAKYS 2332          

HSP 7 Score: 98.2117 bits (243), Expect = 4.092e-19
Identity = 168/699 (24.03%), Postives = 268/699 (38.34%), Query Frame = 3
Query:  561 RCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGH-TLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQP----FCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLY---GIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY--SIRPFFVKLEIR--PQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            +C Y       E++VINF H  +E  + GC+      YIE+   +S L       + CG+ TL   P  + S+ N + +    D   Q++  + D+    G                              + EG+  SP YP  YP    C + +   Q++ + L F D  +   +  C  D++ I       S ++G P    FC       I S  N+L + F+     K S +E              +GF    +FS D +              EC   + +S   +GI++SPG+P   P+   CT+ +    G   R +  +  L+F            C+   L IY  + + F  +   +  P  L    +  ++I  +D     E                       GF I Y           +    VC + Y   +   G+++SP F   YPSN  C Y I    N +I ++F +F+L ED    Q            DFV    +I  G   + P+     CGS +P  +I  S SN + L F SD+  +  GF A +D        +  CG N+ +    G +TS  YP  Y  +  C W ++A   S    + F DF  E  H SC+   L ++DG +  +    +LCG     PA I ++  V L  + +      +GF++
Sbjct:  733 QCVYLITQAQGEQIVINFTHVELESQM-GCSH----TYIEVGDHDSLL------RKICGNETL--FP--IRSVSNKVWIRLRIDALVQKASFRADYQVACG---------------------------GMLRGEGFFRSPFYPNAYPGRRTCRWTISQPQRQVVLLNFTDFQIG-SSASCDTDYIEI-----GPSSVLGSPGNEKFCSSNIPSFITSVYNILYVTFV-----KSSSME-------------NRGFTA--KFSSDKL--------------ECGEVLTAS---TGIIESPGHPNVYPRGVNCTWHVVVQRGQLIRLEFSSFYLEFHY---------NCTNDYLEIYDTAAQTFLGRYCGKSIPPSLTSNSNSIKLIFVSDSALAHE-----------------------GFSINYE---------AIDASSVCLYDY---TDNFGMLSSPNFPNNYPSNWECIYRITVGLNQQIALHFTDFTL-EDYFGSQCV----------DFV----EIRDGGYETSPL-VGIYCGSVLPPTII--SHSNKLWLKFKSDAALTAKGFSAYWDG------SSTGCGGNLTTPT--GVLTSPNYPMPYYHSSECYWRLEASHGS-PFELEFQDFHLE-HHPSCSLDYLAVFDGPTTNSRLIDKLCG--DTTPAPIRSNKDVVLLKLRTDAGQQGRGFEI 1272          

HSP 8 Score: 89.3521 bits (220), Expect = 2.380e-16
Identity = 150/707 (21.22%), Postives = 253/707 (35.79%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSL-SEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWS 2624
            +  SPN+P  Y  +  C ++  A       + F+ F++E   P C+ D+L ++      +    N++ + + CG   D  P  + S  ++++L   +D   Q            GF   F+              + C   +   K  G + S  YP  Y  +  C++ +       +   F   D+    + C  D+V +YDG     P     +CG        +T + L + F T            D I    K  + + F                    H  G E          T+G   SPGYP   P NK C      I N      + ++    +        C+  SL IY+       L+    ++       Q+   +      +++  G  + +R  T +  +             R +    + V PG C  +  +S    G I+SP +   Y +NT C + I    +HR+ +   +F L + D   R    S   +       RV                  +CG   P P    +  NS+ + F S S   + GF A++           +CG  I+++     I S  YP  Y  N  C W ++A    N I + F  F  + S   C    + I DG+ + A      CG     P  IS  N + + F+T S +++  +GF+ I+S
Sbjct: 1175 VLTSPNYPMPYYHSSECYWRLEASHGSPFELEFQDFHLE-HHPSCSLDYLAVF------DGPTTNSRLIDKLCG---DTTPAPIRSNKDVVLLKLRTDAGQQGR----------GFEINFR--------------QRCDNVVIVNKTSGILESINYPNPYDKNQRCNWTIQATTGNTVNYTFLGFDVESYMN-CSTDYVELYDG-----PQWMGRYCGNNMPPPGATTGSQLHVLFHT------------DGINSGEKGFKMQWFT-------------------HGCGGE-------MSGTAGSFSSPGYPNSYPHNKEC------IWNIRVAPGSSIQLTIHDFDVEYHTSCNYDSLEIYA------GLDFNSPRIA------QLCSQSPSANPMQVSSTGNELAIRFKTDSTLNG------------RGFNASWRAV-PGGCGGIIQLSR---GEIHSPNYPNNYRANTECSWIIQVERHHRVLLNITDFDLEAPDSCLRLMDGSSSTN------ARVAS----------------VCGRQQP-PNSIIASGNSLFVRFRSGSSSQNRGFRAEF---------REECGGRIMTD-SSDTIFSPLYPHNYLHNQNCSWIIEAQPPFNHITLSFTHFQLQNS-TDCTRDFVEILDGNDYDAPVQGRYCGFSLPHP-IISFGNALTVRFVTDSTRSF--EGFRAIYS 1732          

HSP 9 Score: 87.0409 bits (214), Expect = 1.151e-15
Identity = 166/712 (23.31%), Postives = 254/712 (35.67%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRL-NTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQD-----IINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFK 2612
            +R    SPN+P  Y  N  C +    +   +V++N   F++E   P      +D         S+  NA+ +   CG      PN +++  N + + F S  ++Q            GF   F+              E C   I +   +  I SP YP  Y  + NCS+++        I L F    L +  D C  D V I DG+   +P+ G+ +CG      I+S  N L +RF+T            D  +        +GF  +Y  S                 + C     S     GI  SP YP     N  C +                     NI  +P N+     LS          LE            + + C  D+ EI+E    G L+     N+     S   G  ++  F  D    G   +    +   N +   + G I SPF+   YP N+  ++ +  +  H I     E  +  +      Y SLK         R+I                  CG+       S SR NS++  F SDS  S  GF  ++  + + D     I    CG  +++     +I S  +PREY +   C W + A DS+  + I   D   +   QSC    L + DGDS  +   + LCG     P   ST   +++ F TS  +    GF 
Sbjct: 1517 SRGEIHSPNYPNNYRANTECSWIIQVERHHRVLLNITDFDLEA--PDSCLRLMD--------GSSSTNAR-VASVCGR--QQPPNSIIASGNSLFVRFRSGSSSQNR----------GFRAEFR--------------EECGGRIMTDSSD-TIFSPLYPHNYLHNQNCSWIIEAQPPFNHITLSFTHFQLQNSTD-CTRDFVEILDGNDYDAPVQGR-YCGFSLPHPIISFGNALTVRFVT------------DSTR------SFEGFRAIYSAST----------------SSCG---GSFYTLDGIFNSPDYPADYHPNAECVW---------------------NIASSPGNRLQLSFLSF--------NLE------------NSLNCNKDFVEIREGNATGHLIGRYCGNSLPGNYSSAEGHSLWVRFVSDGSGTGMGFQARFKNIFGNNNIVGTHGKIASPFWPGKYPYNSNYKWVVNVDAYHIIHGRILEMDI--EPTTNCFYDSLKIYDGFDTHSRLIGT---------------YCGTQTES--FSSSR-NSLTFQFSSDSSVSGRGFLLEWFAVDVSDSTPPTIAPGACGGFMVTGDTPVHIFSPGWPREYANGADCIWIIYAPDSTVELNILSLDIEPQ---QSCNYDKLIVKDGDSDLSPELAVLCGVSPPGP-IRSTGEYMYIRF-TSDTSVAGTGFN 2085          

HSP 10 Score: 84.7297 bits (208), Expect = 5.339e-15
Identity = 151/720 (20.97%), Postives = 277/720 (38.47%), Query Frame = 3
Query:  447 YVVYAL-DCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQ-QSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLF-RDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFN-QLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY-DFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEG--SHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFISTSNTVHLEFIT 2579
            Y+ Y+  DC  I   D        +  SPN+P  Y     C +   A     + + F  F +E   P C  D     + +++ +S    +  +GR+CG +   VP  + S  N +++ F ++   Q + +        LG  GTF                            G I SP +P  +P +  CS+ ++ ++ +   + F  +  +   +  C    V +++G    +  +    CG+     I+++ N+    F + +   +                          FS  ++             + C    ++   + G + SP +P +   N  CTY +    + +     +L F + ++    D    TG+     +           +   L  +P   ICG++   ++ +T  GP VLL    S+A+++  G       FK  Y           C  +YN SS   G++ SP ++   YP+N  C Y +   ++  I I F +F ++   +            C  DF+ V      GP I       F CGS+ P  +   S ++S++L F +DS Q+  G+   + + I  Q        E+  S +   + ++ RY +     L C W + A   +  + + F+ F  EG  S  SC    ++I DG S  +    + CG+    P FIS+ N +  +F++
Sbjct: 2681 YIEYSFTDCGGIRTGDN------GVISSPNYPNLYSAWTHCSWLLKAPEGHTITLTFSDFLLEAH-PTCTSD----SVTVRNGDSP--GSPVIGRYCGQS---VPRPIQSGSNQLIVTFNTNNQGQTRGFYATWTTNALGCGGTFH------------------------SANGTIKSPHWPQTFPENSRCSWTVITHESKHWEISFDSNFRIPSSDSQCQNSFVKVWEGRLMINKTLLATSCGDVAPSPIVTSGNIFTAVFQSEEMAAQG-------------------------FSASFI-------------SRCG---RTFNTSPGDIISPNFPKQYDNNMNCTYLI----DADPQSLVILTFVSFHLE---DRSAITGTCDHDGLHII--------KGRNLSSTPLVTICGSE--TLRPLTVDGP-VLLNF-YSDAYTTDFG-------FKISY-------RAITCGGIYNESS---GILRSPSYSYSNYPNNLYCVYSLHVRSSRVIIIRFNDFDVAPSNL------------CAHDFLEVFD----GPSIGNRSLGKF-CGSTRPQTV--KSTNSSLTLLFKTDSSQTARGWKIFFRETIGPQQGCGGYLTEDNQSFVSPDSDSNGRYDK----GLSCIWYIVA-PENKLVKLTFNVFTLEGPSSAGSCVYDYVQIADGASINSYLGGKFCGSRMPAP-FISSGNFLTFQFVS 3258          
BLAST of Cubilin vs. UniProt/SwissProt
Match: sp|O60494|CUBN_HUMAN (Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5)

HSP 1 Score: 128.257 bits (321), Expect = 3.427e-28
Identity = 172/725 (23.72%), Postives = 276/725 (38.07%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQ-QSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW------SEILQRLPDGSCPGF 2666
            F SP FP +YPPN  C +         + +    F++E     CN D L++Y          F++  + + C       P  V S  N + + F +D++   + +N        G  G F+    AP                     G I SP YP  Y S+ +CS+++  ++  R+ L F D DL  Q D CI      YDG + +   + +    E+    I+S+ N L +RF +G     SR              Q +GF   +R          +    HI+ +  D            + SP +P   P N+ C++ +      N +  +   F+                 S    R F   L+   +   L        CGTD      IT     + LR  + ++ S+G  GF    T                C   + ++    G+ NSP +  +YP N  C ++I+ +  +R+++ F  F L +            +  C  DFV + +    G ++ +       CG+S P    S    +++ + FISD   S +GF A +  I   D        NI+     G + S  +P  Y  N   QW+V   ++S+ +     +   E   Q+C    LRIYDG S  A      CGT +   +F ST N++   F +     G KGF L W        +L  +  G+C GF
Sbjct: 1402 FSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVE-YHSRCNFDVLEIY------GGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASWQAVTGGCGGIFQ----AP--------------------SGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ-DSCI----MAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGP----SR--------------QNRGFRAQFR----------QACGGHILTSSFDT-----------VSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFEL--------------ERSTTCARDFVEILDGGHEDAPLRGR----YCGTDMPH--PITSFSSALTLRFVSDSSISAG--GFHTTVT-----------ASVSACGGTFYMAE---GIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLED------------SQDCSRDFVEIREGNATGHLVGR------YCGNSFP-LNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGND--------NIVG--THGKVASPFWPENYPHNSNYQWTVNV-NASHVVHGRILEMDIE-EIQNCYYDKLRIYDGPSIHARLIGAYCGTQTE--SFSSTGNSLTFHFYSDSSISG-KGFLLEWFAVDAPDGVLPTIAPGACGGF 1981          

HSP 2 Score: 116.316 bits (290), Expect = 1.492e-24
Identity = 179/735 (24.35%), Postives = 279/735 (37.96%), Query Frame = 3
Query:  438 LTNY-VVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI--ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNIS---STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFK 2612
            L NY  + A    +  Y+D +G      F SPNFP  YP N  C Y+   ++ + + ++F +F++E  +     DFL++       +     +  LG F G  L   P  ++S  N + L F SD I+T+  ++        G  G                              G   SP YP  Y     C + L  +      L F+D  L H   +C  D++ +YDG + +S ++ Q  CG EKP L I S+ + + I+          R + G          Q +GF   YR + + V I N+                    T GIL+S GYP    +N+ C + +      N +    L F   +        CST  L +Y                   D P Q+   CG D       T     VLL        + G+G        +R+ G + +        FVY      S  +G  +SP F   YP N  C + I  +    I++   +F +        +YH    S C  D    + +I  GP    P         S   P+   S  N +++ F +D   +  GF A +        +   CG   I +   G I S  YP  YRSN  C W ++  D ++R++++F DF  E       +S +  YDG S   S  +  CG +      +S+ N++ L F + P     +GF+
Sbjct: 1036 LINYEAISAATACLQDYTDDLGT-----FTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIGNYYTDFLEI------RDGGYEKSPLLGIFYGSNL---PPTIISHSNKLWLKFKSDQIDTRSGFSAYWDGSSTGCGGNLT------------------------TSSGTFISPNYPMPYYHSSECYWWLKSSHGSAFELEFKDFHLEHH-PNCTLDYLAVYDGPSSNSHLLTQ-LCGDEKPPL-IRSSGDSMFIKL---------RTDEGQ---------QGRGFKAEYRQTCENVVIVNQ--------------------TYGILESIGYPNPYSENQHCNWTIRAT-TGNTVNYTFLAFDLEH-----HINCSTDYLELY-------------------DGPRQMGRYCGVDLPPPGSTTSSKLQVLL-------LTDGVG--------RREKGFQMQW-------FVYGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDV--------EYH----SRCNFD----VLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASW------QAVTGGCGG--IFQAPSGEIHSPNYPSPYRSNTDCSWVIRV-DRNHRVLLNFTDFDLEPQ-----DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQ-NRGFR 1613          

HSP 3 Score: 114.39 bits (285), Expect = 5.292e-24
Identity = 168/706 (23.80%), Postives = 265/706 (37.54%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFS-SGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQD-----IINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
             SPN+P  Y  N  C +        +V++NF  F++E       +D     +    L ST+     L R CG   + + N +VS  N + L F S  + Q            GF   F+              ++C  +I +   +  ++SP +P  YP++ NCS+++        I L F   +L  ++  C  D V I DG  E +P+ G+ +CG      I S  + L +RF++      S + +G             GF+     SV     T  M +                   GI  SPGYP   P N  C +                     NI  +P N+                 L++      L DS D   C  D+ EI+E    G LV      S   + S I G  ++  F  D    G   +        N +   + G + SPF+ + YP N+  Q+ +  N +H +     E  + E  ++   Y  L+              I  GP I   +  ++ CG+         S  NS++  F SDS  S  GF  ++  +   D     I    CG  + +      + S  +P  Y + + C W ++A DS+  + I   D     SH++CA   L I DGD+   Q  + LCG +  IP  I ++        TS  +  + GF
Sbjct: 1522 HSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLE------PQD--SCIMAYDGLSSTM---SRLARTCGR--EQLANPIVSSGNSLFLRFQSGPSRQNR----------GFRAQFR--------------QACGGHILTSSFD-TVSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFEL-ERSTTCARDFVEILDGGHEDAPLRGR-YCGTDMPHPITSFSSALTLRFVS-----DSSISAG-------------GFHTTVTASVSACGGTFYMAE-------------------GIFNSPGYPDIYPPNVECVW---------------------NIVSSPGNR-----------------LQLSFISFQLEDSQD---CSRDFVEIREGNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTHGKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEE--IQNCYYDKLR--------------IYDGPSIHARLIGAY-CGTQTES---FSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGGFLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIE---SHRTCAYDSLVIRDGDNNLAQQLAVLCGRE--IPGPIRSTGEYMFIRFTSDSSVTRAGF 2084          

HSP 4 Score: 100.138 bits (248), Expect = 1.267e-19
Identity = 171/792 (21.59%), Postives = 283/792 (35.73%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLLQKKGFNVV-YRFSV-------------------------------DYVKITNEMEKNHIIGTECDMWIKSSEKTS--------------------------------------GILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY-SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL--YPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +R +  SP +P+ YP N+ C +  + +S   + ++FE  F I      CN+ D+L L          L      G FCG    H  + + +  N + + F SD + +            GF   ++          K      + YI      GY+TSP +P  YP H +C ++L    + RI+L F D        +C  +++ + DG    +PI+ + FCG        S+  ++ +RF +       G   K S  + G  +     +++  G   + YR ++                               D+V+I +     +I+G  C   I  S  TS                                      G   SP YP   P  ++C + +     R       L F  L +   P   C+   + ++  IR    +LE    KL            +      EI   G  + +   T    S   GGF   YT   D    G +             +T  G   SP ++ +  Y  N  C++ +   N  N  I I+F++F L              +  C+ D +        GP++ +      LCG S P  PL+     + + + F+++    H GF+A+Y F          CG   I +   G ITS  YP  Y S   C   ++A    + I + F DF  E  H +CA   + + +G S ++    + CG  +  P  I + +   +    S  +    GF   W
Sbjct: 2099 DRGIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCG---SHASSTLFTSDNQMFVQFISDHSNEGQ----------GFKIKYE---------AKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPILSK-FCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRVPGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDNHTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSIGTFTSPNYPNPNPHGRICEWRITAPEGRR----ITLMFNNLRLATHP--SCNNEHVIVFNGIRSNSPQLE----KLC-----------SSVNVSNEIKSSGNTMKVIFFTDG--SRPYGGFTASYTSSEDAVCGGSL------------PNTPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLE------------SHQDCQFDVLEFRVGDADGPLMWR------LCGPSKPTLPLVIP--YSQVWIHFVTNERVEHIGFHAKYSFT--------DCGGIQIGD--SGVITSPNYPNAYDSLTHCSSLLEA-PQGHTITLTFSDFDIE-PHTTCAWDSVTVRNGGSPESPIIGQYCGNSN--PRTIQSGSNQLVVTFNSDHSLQGGGFYATW 2798          

HSP 5 Score: 97.0561 bits (240), Expect = 1.079e-18
Identity = 175/756 (23.15%), Postives = 303/756 (40.08%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRD-LDLNHQNDDCIE-DHVTIYDGDTESSPIIGQP-----FCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAV-LKFQT-LNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIE--GKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWSE--------ILQRLPDG--SCPGFECLKTKHCISRQLECD 2714
            SP +P  Y   + C +  +      V +N    +IE     C  D L +     +L      A+ L   CG     +P  + S    + + F SD +  ++          GFN +F               +SC  Y+ + +  G ITSP YP  YPS+LNCS+ ++      I + F     + + +  C + D++ + +G    SP +G P     FCG      + ++ N + ++FI+      S    G +IK   K L   G                            +++I  ++ ++G + SP +P   P +  C + L         ET + L+F+   +I  TP+  C++              LE+R    V  D+P     CGT     +  +  G ++ LR  + N+          +  FK  Y I   G  V PG           +SGV+ S     L Y  N  C++ + G + H + I F++F+L              +S CE DFV +      G I+ +       CG+++P  +  D+ SN+  + F++D   + SGF  +++          +CG ++   I  G  TS  YP       IC+W + A     RI + F++ +   +H SC N  + +++G    +    +LC + +      S+ NT+ + F T   + YG  GF   ++          L   P+G  + PG++ ++     SR L C+
Sbjct: 1993 SPGWPDSYSNRVDCTW-LIQAPDSTVELNILSLDIESHRT-CAYDSLVIRDGDNNL------AQQLAVLCGR---EIPGPIRSTGEYMFIRFTSDSSVTRA----------GFNASFH--------------KSCGGYLHADR--GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFIS----DHSNEGQGFKIKYEAKSLACGG----------------------------NVYIHDAD-SAGYVTSPNHPHNYPPHADCIWILAA-----PPETRIQLQFEDRFDIEVTPN--CTSN------------YLELR--DGVDSDAPILSKFCGTSLPSSQWSS--GEVMYLRFRSDNS--------PTHVGFKAKYSIAQCGGRV-PG-----------QSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQ------------NSSGCEKDFVEIWDNHTSGNILGR------YCGNTIPDSI--DTSSNTAVVRFVTDGSVTASGFRLRFE------SSMEECGGDLQGSI--GTFTSPNYPNPNPHGRICEWRITA-PEGRRITLMFNN-LRLATHPSCNNEHVIVFNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYG--GFTASYTSSEDAVCGGSLPNTPEGNFTSPGYDGVRN---YSRNLNCE 2600          

HSP 6 Score: 90.1225 bits (222), Expect = 1.265e-16
Identity = 158/715 (22.10%), Postives = 276/715 (38.60%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDS-KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREI-KEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTC-EGDFVRVIQKIPKGPIISQPIETSF-----LCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENII--SEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            +F SP +P  YPPN+ C +  V+    ++ ++F  F +E     C++DF    +E++   +T      +GR+CG++     N+   + + + + F SD +   +          GF  TF  I                F  D+     G + SP +P  YP + N  + +  N    +     ++D+  +  +C  D + IYDG +  + +IG  +CG + +    ST N L   F +   I                    KGF ++  F+VD      +     I    C  ++++ +     L SPG+P        CT+ +       +   + ++   L++       C+  SL I              Q+L        ++CG   REI   I   G  + +R  + ++ +    GF    +F +  G        G  H          G+I SP + + YPSN  C + ++  +   I ++F++     +G          +S+C +GD++     +  GP I  P           CGS     L +    N + + FISD      GF  +Y+   +       CG N+        G +TS  +P  Y  +  C W + A     RI + F D        +C ++ L + DG    A   S+ CGT  ++P+   +S  V      S  +    GFK  +S
Sbjct: 1748 IFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQ-DCSRDF----VEIREGNAT---GHLVGRYCGNSFPL--NYSSIVGHTLWVRFISDGSGSGT----------GFQATFMKI----------------FGNDNIVGTHGKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDI-EEIQNCYYDKLRIYDGPSIHARLIGA-YCGTQTE-SFSSTGNSLTFHFYSDSSIS------------------GKGF-LLEWFAVD----APDGVLPTIAPGACGGFLRTGDAPV-FLFSPGWPDSYSNRVDCTWLI-------QAPDSTVELNILSLDIESHRTCAYDSLVIRDGDNNLA------QQLA-------VLCG---REIPGPIRSTGEYMFIRFTSDSSVTR--AGFNA--SFHKSCG--------GYLH-------ADRGIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNG----------DSSCNQGDYL----VLRNGPDICSPPLGPPGGNGHFCGSHASSTLFTS--DNQMFVQFISDHSNEGQGFKIKYEAKSL------ACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIW-ILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPILSKFCGT--SLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYS 2332          

HSP 7 Score: 89.7373 bits (221), Expect = 1.536e-16
Identity = 160/721 (22.19%), Postives = 263/721 (36.48%), Query Frame = 3
Query:  459 ALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQN---DDCIEDHVTIYDGDTESSPIIGQPF---CGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY----SIRPFFVKL--EIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTD-SAIPAFISTSNTVHLEF 2573
             L C  I++SD          +SP++PQ +P N RC +  +    + + I+F++ F I      C   F+ ++   + ++  L     L   CG+     P  V++  N     F S     Q ++               F+     N T                 GYI SP YP  Y +++NC+Y++  N    + L F    L  ++     C+ D V I  G +    ++  PF   CG++     L+    +L+ F + + I           K + +++   G   V+ FS                              SGI+ SP Y      N +   +   + +   +E   LKF   ++   P   CS   L+IY    +  P   K     RP  +   ++   ++  TD  +    T KG  +  R         G GG++         G       P           + S        N +Y  N  C + II   N  I + F  F+L E    RQ+        C  D+V    K+  G   +  +  +F CGS+VP P IS    N +++ FISD      GF A Y       I++  CG    +     NI+S           IC W +   DS     +    +  + + Q C  + L++ D      +S  + CG + SA+P F S+ +T  + F
Sbjct: 2802 TLGCGGIFHSDN------GTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKAL-----LATGCGNV---APGPVITPSNTFTAVFQSQEAPAQGFSA-------------SFVSRCGSNFTGP--------------SGYIISPNYPKQYDNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYS----VMSTPFATVCGDEMPAP-LTIAGPVLLNFYSNEQITDFGF------KFSYRIISCGG---VFNFS------------------------------SGIITSPAYSYADYPNDMHCLYTITVSDDKVIE---LKFSDFDV--VPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPNVKSSNNSMLLVFKTDSFQ----TAKGWKMSFRQTLGP--QQGCGGYLT--------GSNNTFASP----------DSDS--------NGMYDKNLNCVWIIIAPVNKVIHLTFNTFAL-EAASTRQR--------CLYDYV----KLYDGDSENANLAGTF-CGSTVPAPFISSG--NFLTVQFISDLTLEREGFNATY------TIMDMPCGGTYNATWTPQNISSPNSSDPDVPFSICTWVI---DSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASAVPVFYSSMSTAMVIF 3375          

HSP 8 Score: 89.3521 bits (220), Expect = 2.151e-16
Identity = 157/704 (22.30%), Postives = 265/704 (37.64%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQND-DCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY--DFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGS--HQSCANSILRIYDGDSFQA--SSELCGTDSAIPA-FISTSNTVHLEFIT 2579
            I + +  +  SPN+P  Y     C     A     + + F  F+IE     C  D + +     S ES +     +G++CG++    P  + S  N +V+ F SD + Q            GF  T+             Q   C     S  + G I SP +P  +P +  CS+  + ++ + + + F +  L    D  C    V ++ G  E    +    CG      +++  N     F         + +       +   + + G N                                    SG + SP YP +   N  CTY +      N +   +L F + ++        S  +  ++ IR + V             +P   +CG +      +T  GP VLL   ++   +         + FK  Y I         C  V+N S   SG+I SP ++   YP++  C Y I  +++  I + F +F +            + +++C  D++ +      G   S P+   F CGS  P P +  S +NS+ L F +DS Q+  G+   +     P Q    +  G N  +     +  SN     Y  NL C W + A   +  I + F+ F  E +   Q C    +++YDGDS  A  +   CG  S +PA FIS+ N + ++FI+
Sbjct: 2692 IQIGDSGVITSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTT-CAWDSVTVR-NGGSPESPI-----IGQYCGNS---NPRTIQSGSNQLVVTFNSDHSLQGG----------GFYATWN-----------TQTLGCGGIFHS--DNGTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLATGCGNVAPGPVITPSNTFTAVF---------QSQEAPAQGFSASFVSRCGSNFT--------------------------------GPSGYIISPNYPKQYDNNMNCTYVI----EANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVM-----------STPFATVCGDEMP--APLTIAGP-VLLNFYSNEQITD--------FGFKFSYRIIS-------CGGVFNFS---SGIITSPAYSYADYPNDMHCLYTITVSDDKVIELKFSDFDV------------VPSTSCSHDYLAIY----DGANTSDPLLGKF-CGSKRP-PNVKSS-NNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSN--NTFASPDSDSNGM---YDKNLNCVWIIIA-PVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCG--STVPAPFISSGNFLTVQFIS 3258          

HSP 9 Score: 81.6481 bits (200), Expect = 4.316e-14
Identity = 166/724 (22.93%), Postives = 268/724 (37.02%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI---ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSV-QSHSGFYAQYDFIPIQDIINHKCGENIISEIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAI-PAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            QSP  P  YP  I C +  + +    + + FE F++E     C  D+L++Y +  S  S       LGR+CG +   +P  + S  N ++L F +D +          +   GF   ++ I  A          +C    D   + G  TSP +P  YP++  C Y +     + I + F +  L     +   D + I DG  E SP++G  F G      I+S  N L ++F +     RS                  GF+  +  S                 T C   + +S   SG   SP YP+    +  C ++L   H         L+F+  ++   P+  C+   L++Y                  P S   +   +CG +         K PL+          SSG   F+   T +   G   K      C  V  ++ T  G++ S  +   Y  N  C + I     + +   F  F L          H +    C  D++ +            P +    CG  +P P    + S+ + +  ++D V +   GF  Q+ F+       + CG     E+ G  G+ +S  +P  Y  N  C W ++  D  + I +  HDF  E  H  C   +L IY G  F +   ++LC   S   P  + ST N + + F T     G +GF   W  +      G C G
Sbjct:  944 QSPGHPNVYPHGINCTWHILVQPNHLIHLMFETFHLE-FHYNCTNDYLEVY-DTDSETS-------LGRYCGKS---IPPSLTSSGNSLMLVFVTDSD----------LAYEGFLINYEAISAA---------TAC--LQDYTDDLGTFTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGI-FYGSNLPPTIISHSNKLWLKFKSDQIDTRS------------------GFSAYWDGS----------------STGCGGNLTTS---SGTFISPNYPMPYYHSSECYWWLKSSHG----SAFELEFKDFHLEHHPN--CTLDYLAVYD----------------GPSSNSHLLTQLCGDE---------KPPLIR---------SSGDSMFIKLRTDEGQQGRGFKAEYRQTCENVVIVNQTY-GILESIGYPNPYSENQHCNWTIRATTGNTVNYTFLAFDLE---------HHIN---CSTDYLELYDG---------PRQMGRYCGVDLPPP--GSTTSSKLQVLLLTDGVGRREKGFQMQW-FV-------YGCG----GELSGATGSFSSPGFPNRYPPNKECIWYIRT-DPGSSIQLTIHDFDVE-YHSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSING-RGFNASWQAVT-----GGCGG 1512          

HSP 10 Score: 78.5666 bits (192), Expect = 4.060e-13
Identity = 64/245 (26.12%), Postives = 105/245 (42.86%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLK-ILSTRNMLLIRFITGDFIKR 1247
             +SP +P  Y  +  C     A     + + F    IE  +  C  DFL++     S      N+  LG++CG  L   PN V S +N + L F SD + + + Y         G  GT                           + G  TSP YPG YP++  C ++LV      + + F  + ++   D C+++++T+YDG   SSP  G P+CG    +   +++ N + I+F   D+ +R
Sbjct: 3406 LRSPGWPDNYDNDKDCTVTLTAPQNHTISLFFHSLGIENSVE-CRNDFLEVRNGSNS------NSPLLGKYCGTLL---PNPVFSQNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLY------------------------GDRGSFTSPGYPGTYPNNTYCEWVLVAPAGRLVTINFYFISIDDPGD-CVQNYLTLYDGPNASSPSSG-PYCGGDTSIAPFVASSNQVFIKF-HADYARR 3613          

HSP 11 Score: 78.1814 bits (191), Expect = 5.833e-13
Identity = 61/244 (25.00%), Postives = 110/244 (45.08%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            +    + +SP FP  YP    C++       + +++NF  F I G    C  D    Y+E+ S  S++  +    ++CG     +P+F+ S++N + + F    +T+            GF   F   ++A      E               G I SP +P +YP  +NC++ ++      I L+F    L  H N  C  D++ +YD D+E+S  +G+ +CG+     + S+ N L++ F+T
Sbjct:  821 LTGEGVIRSPFFPNVYPGERTCRWTIHQPQSQVILLNFTVFEI-GSSAHCETD----YVEIGS--SSILGSPENKKYCG---TDIPSFITSVYNFLYVTFVKSSSTENH----------GFMAKFSAEDLACGEILTEST-------------GTIQSPGHPNVYPHGINCTWHILVQPNHLIHLMFETFHLEFHYN--CTNDYLEVYDTDSETS--LGR-YCGKSIPPSLTSSGNSLMLVFVT 1026          

HSP 12 Score: 77.7962 bits (190), Expect = 6.962e-13
Identity = 81/286 (28.32%), Postives = 127/286 (44.41%), Query Frame = 3
Query: 1788 IYYTFKRDYGIEGKMVEPGVCHFVYNISS----TKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWSEI 2630
            ++  FK D  +E           VY ++     T  GVI SPFF  +YP   TC++ I    +  I + F  F +              ++ CE D+V    +I    I+  P E    CG+ +P  +   S  N + +TF+  S   + GF A++     +D+    CGE I++E   G I S  +P  Y   + C W +     ++ I + F  F  E  H +C N  L +YD DS  +    CG  S  P+  S+ N++ L F+T S  AY  +GF + +  I
Sbjct:  794 VWIRFKIDASVEKASFRA-----VYQVACGDELTGEGVIRSPFFPNVYPGERTCRWTIHQPQSQVILLNFTVFEIG------------SSAHCETDYV----EIGSSSILGSP-ENKKYCGTDIPSFIT--SVYNFLYVTFVKSSSTENHGFMAKFS---AEDL---ACGE-ILTE-STGTIQSPGHPNVYPHGINCTWHILV-QPNHLIHLMFETFHLE-FHYNCTNDYLEVYDTDSETSLGRYCG-KSIPPSLTSSGNSLMLVFVTDSDLAY--EGFLINYEAI 1042          

HSP 13 Score: 75.0998 bits (183), Expect = 4.260e-12
Identity = 67/248 (27.02%), Postives = 113/248 (45.56%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            G + SP +   Y ++  C   +    NH I ++F    + E+ V+           C  DF+ V      G   + P+   + CG+ +P P+ S  ++N + L F SDSV S  G+   +   P        CG  +  +   G+ TS  YP  Y +N  C+W + A  +   + I+F+ F++      C  + L +YDG   S  +S   CG D++I  F+++SN V ++F  +  A     F+L W
Sbjct: 3404 GNLRSPGWPDNYDNDKDCTVTLTAPQNHTISLFFHSLGI-ENSVE-----------CRNDFLEV----RNGSNSNSPLLGKY-CGTLLPNPVFS--QNNELYLRFKSDSVTSDRGYEIIWTSSP------SGCGGTLYGDR--GSFTSPGYPGTYPNNTYCEWVLVA-PAGRLVTINFY-FISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSNQVFIKF-HADYARRPSAFRLTW 3621          
BLAST of Cubilin vs. UniProt/SwissProt
Match: sp|Q9JLB4|CUBN_MOUSE (Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 4.233e-28
Identity = 164/703 (23.33%), Postives = 276/703 (39.26%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLL-PGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDIN-TQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI--ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIP-KGPIISQPIETSFLCGSS-VPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHL 2567
            Y+D  G        SPNFP  YP N  C Y+      +++ ++F  F +E    P C  DF++  I     E++      +G +CG      P  ++S  N + L F SD   T + ++        G  G                              G +TSP YP  Y     C + L  ++     L F+D  L H   +C  D++ ++DG + +S +I +  CG+ P   I S+++++L++          R ++G          Q +GF + YR + D V I N                    KTSGIL+S  YP    K++ C + +      N +    L+F   N        CST  L +Y                   D P +I   CG +       T    +V+     ++   SG  GF +++     +G  G+M             S   G  +SP +   YP N  C ++I     + I++   +F +        +YH    ++C+ D + +   +    P I+Q      LC  S    P+   S  N +++ F +DS  +  GF A +  +P        CG   I ++  G I S  YP  YR+N  C W ++  +  +R++++  DF  E +     +S L  YDG S   +  + +CG      +  S+ N++ +
Sbjct: 1052 YTDNFG-----RLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKC-VDFVE--IRDGGFETSPL----IGIYCGSVF---PPRIISHSNKLWLRFKSDTALTARGFSAYWDASSTGCGGNLT------------------------TPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLEHH-PNCSLDYLAVFDGPSTNSRLINK-LCGDTPPAPIRSSKDIVLLKL---------RTDAGQ---------QGRGFEINYRQTCDNVVIVN--------------------KTSGILESINYPNPYDKDQRCNWTIQAT-TGNTVNYTFLEFDVENYV-----NCSTDYLELY-------------------DGPQRIGRYCGENIPPPGATTGSKLIVVFH---TDGVDSGEKGFKMHWFI---HGCGGEM-------------SGTMGSFSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDV--------EYH----ASCKYDTLEIYTGLDFHSPRIAQ------LCSRSPSANPMQISSTDNELAIRFKTDSSLNGRGFNASWRAVP------GGCGG--IFQVSRGEIHSPNYPNNYRANTECSWIIQV-EKYHRVLLNITDFDLEAT-----DSCLMTYDGSSSANTRVATVCGRQQPPNSITSSGNSLFV 1599          

HSP 2 Score: 120.168 bits (300), Expect = 8.101e-26
Identity = 166/732 (22.68%), Postives = 281/732 (38.39%), Query Frame = 3
Query:  492 KIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPG---VCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCG-TDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            K+   +  + +SP  P  YP  + C +  V +  + + + F  F +E     C  D+L++Y  +            LGR+CG ++   P+   S H+I ++           +  D  +   GF+  ++ I  + +         C +  D     G ++SP +P  YP + NC Y +     ++I L F D  L ++    C+ D V I DG  E+SP+IG  +CG     +I+S  N L +RF                   +   L  +GF+  +  S                 T C   + +    +G+L SP YP+    +  C + L      ++    +L+FQ  ++   P+  CS   L+++                   D P      T+ R I ++    P   +R +            ++    + D G +G+  E      C  V  ++ T SG++ S  +   Y  +  C + I     + +   F EF + E+ V            C  D++ +            P      CG ++P P    +  + + + F +D V S    +  + FI       H CG  +   +  G+ +S  YP  Y  N  C W+++     N I +  HDF  E  H SC    L IY G  F +   ++LC  + SA P  I ST N + + F T     G +GF   W     R   G C G
Sbjct:  934 KVLTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYLE-FHYNCANDYLEVYDTIAQTS--------LGRYCGKSIP--PSLTSSSHSIKLI-----------FVSDSALAHEGFSINYEAINASSV---------CLY--DYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYFGPKCV-DFVEIRDGGFETSPLIGI-YCGSVFPPRIISHSNKLWLRF------------------KSDTALTARGFSAYWDAS----------------STGCGGNLTTP---TGVLTSPNYPMPYYHSSECYWRL----EASRGSPFLLEFQDFHLEHHPN--CSLDYLAVF-------------------DGPS-----TNSRLINKLCGDTPPAPIRSSKD----------IVLLKLRTDAGQQGRGFEINYRQTCDNVVIVNKT-SGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDV-ENYVN-----------CSTDYLELYDG---------PQRIGRYCGENIPPP--GATTGSKLIVVFHTDGVDSGEKGFKMHWFI-------HGCGGEMSGTM--GSFSSPGYPNSYPHNKECIWNIRV-APGNSIQLTIHDFDVE-YHASCKYDTLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNG-RGFNASW-----RAVPGGCGG 1512          

HSP 3 Score: 115.546 bits (288), Expect = 2.145e-24
Identity = 168/734 (22.89%), Postives = 286/734 (38.96%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG--CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYI--DSKKEEGYITSPTYP--GIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQND--DCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYP----VRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS------GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            YS   GV N   F   N    YP N+ C Y    ++   +++ F  F I   +P   C+ D+L+++      +      + +G+FCG TL   P  + S +N + L F +D +              G+  +F+         T   ++ C  Y+  DSK       SP +   G+Y   LNC + ++  + + ++L F    L   +    C  D+V I DG + +S  +G  FCG       +S+ N L ++F++             +I      +Q +GFN  Y F                     DM    +   + + ++   P    +R P +  CT+ +    ++ +++  V K Q       P   CS  S            LE++  +    +   Q  CG +Y  +                   +SSG    V+   FK D+      V     HF Y I+          G + SP + Q Y +N  C   +    NHRI ++F  F L +    RQ         C  DF+ V      G   S P+   + C + +P P+   S+SN + L F SD   +H G+   +   P        CG  ++     G + +  +P  Y +N  C+W++ A   S R +     F++  S   C  + L +++G    +      CG D+ +  F ++SN V + F  +  A    GF+++WS
Sbjct: 3041 YSGTYGVLNSPSFSYTN----YPNNVYCVYSLQVRNDRLILLRFNDFEI---VPSNLCSHDYLEVF------DGPSIGNRSIGKFCGSTL---PQVIKSTNNSLTLLFKTDSSQTAR----------GWKVSFR--------ETIGPQQGCGGYLTEDSKS----FVSPDHDSDGLYDKGLNCIWYIIAPENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINS-YLGGRFCGSSRPAPFISSGNFLTVQFVS-------------DIS-----IQMRGFNATYTF--------------------VDMPCGGTYNATSMPQNTSSPQLSNIRRPFST-CTWVIEAPPHQ-QVQITVWKLQ------LPSQDCSRSS------------LELQDSEQTNGNQVTQ-FCGANYTTLPVF----------------YSSGSTAVVV---FKSDFLNRNSRV-----HFTYEIADCNREYNQAFGNLKSPGWPQGYANNLDCSIILRAPQNHRISLFFYWFQLED---SRQ---------CMNDFLEV----RNGSSSSSPLLGKY-CSNLLPNPIF--SQSNELYLHFHSDDSDTHHGYEIIWASSPT------GCGGTLLG--NEGILANPGFPDSYPNNTHCEWTIVA--PSGRPLSVGFPFLSIDSPGGCDQNYLILFNGPDANSPPFGPFCGIDTVVAPFHASSNRVFIRF-HAEYATVSSGFEIMWS 3622          

HSP 4 Score: 98.5969 bits (244), Expect = 3.545e-19
Identity = 173/731 (23.67%), Postives = 284/731 (38.85%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRD-LDLNHQNDDCIE-DHVTIYDGDTESSPIIGQP-----FCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQ-TLNIPPTPDNKCSTGSLSIY----SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFF-NQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWSEILQRLPDGSCP 2660
             F SP +P  Y     C +   A     V +N    +IE  L  C+ D L +    K  +S L  ++ L   CG +   VP  + S    + + F SD +   +          GFN +F+              +SC  Y+ + +  G ITSP YP  Y  +LNCS+ ++      I + F     + +++  C + D++ + +G    SP +G       FCG      + ++ N + I+FI+      S    G +I+   K L   G   ++  + D                             G + SP YP   P++  C + L     R+      L+F+   NI  TP+  CS   L +     S  P   KL                 CG        ++ +G L+ L+ +T     SG      Y  FK  Y I    V  G         S  SGVI S  +  +LY +N  CQ+ I G   H + I F++F+L              +  C  DFV + +    G ++ +       CG+S+P  +  D+ SN  S+ F++D   + SGF  Q+            CG ++      G  TS  YP       IC+W++   +   +I++ F +     + QSC    L +++G  ++     +LC   +    F S+ NT+ + F T   + YG  GF   ++     +  G+ P
Sbjct: 1990 FFFSPGWPGPYGNGADCIWIIYAP-DSTVELNILSMDIEAQL-SCSYDKLII----KDGDSRL--SQQLAVLCGRS---VPGPIRSTGEYMYIRFTSDGSVTGA----------GFNASFQ--------------KSCGGYLHADR--GIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTLFTSDNEMFIQFIS----DNSNGGQGFKIRYEAKSLACGGTIYIHDANSD-----------------------------GYVTSPNYPANYPQHAECIWILEAPSGRSIQ----LQFEDQFNIEETPN--CSASYLELRDGANSNAPVLSKL-----------------CGHTLPR-NWVSSRG-LMYLKFHTEGG--SG------YMGFKAKYSI----VSCG------GTVSGDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNLQ------------SSPGCAKDFVEIWENHTSGILLGR------YCGNSIPSSV--DTSSNVASIRFVTDGSVTDSGFRLQF------KSSREVCGGDLHGPT--GTFTSPNYPNPNPHPRICEWTINVHE-GRQIILTFTNLRLS-TQQSCNTEHLIVFNGIRNNSPRLQKLCSRVNVTNEFKSSGNTMKVIFFTDGSRPYG--GFTASYTSSEDAVCGGTLP 2575          

HSP 5 Score: 97.8265 bits (242), Expect = 5.226e-19
Identity = 166/722 (22.99%), Postives = 262/722 (36.29%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTK----------SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSEL---CGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            I   N     SP +P  YPP   C +  +      +   F   ++E     C+KD+L++       +    +   LG+FC  +L   P  + +      + F+SD  T             GF+ T+         +T         Y D+   EG +  P   G +     C YL+   Q E+I + F  ++L  Q   C   H  I  GD ES   + +  CG +    I S  N + IR          R+++         L+QK  F   Y+     V    E+                  +  G+++SP YP      + C + +    ++   E  +L F    I  +  + C T              +EI P   VL    ++  CGT+           P  +  +             V+Y TF +   +E +        F+   SS K          +G+I SP    +YPS   C + I+      IR+ F  F L        ++H      C  D++ V   I +  +          CG S+P  L S   S+SI L F+SDS  +H GF   Y+ I    +  +   +N       G ++S  +P  Y  N  C + +     + +I +HF DF  E          + I DG  F+ S  +   CG+    P  IS SN + L F  S  A   +GF   W
Sbjct:  593 ILTGNYGSITSPGYPGNYPPGRDCVWNLLVSPGSLITFTFGTLSLESH-NDCSKDYLEI------RDGPFHHDPILGKFC-TSLSTPP--LQTTGPAARIHFHSDSETSDK----------GFHITYL--------TTPSDLYCGGNYTDT---EGELLLPPLTGPFSHSRQCVYLISQPQGEQIVINFTHVELESQRG-C--SHTFIEVGDHES---LLRKICGNETLFPIRSISNNVWIRL---------RIDA---------LVQKASFRADYQ-----VACGGEL------------------RGEGVIRSPFYPNAYAGRRTCRWTI----SQPPREVVLLNFTDFQIGSS--SSCDTD------------YIEIGPSS-VLGSPGNEKFCGTNI----------PSFITSVYN-----------VLYVTFVKSSSMENR-------GFMAMFSSEKLECGKVLTESTGIIESPGHPNVYPSGVNCTWHIVVQRGQLIRLVFSSFYL--------EFH----YNCANDYLEVYDTIAQTSL-------GRYCGKSIPPSLTSS--SHSIKLIFVSDSALAHEGFSINYEAINASSVCLYDYTDNF------GRLSSPNFPNNYPHNWNCVYRITV-GLNQQIALHFTDFALEDYFGPKCVDFVEIRDG-GFETSPLIGIYCGS-VFPPRIISHSNKLWLRF-KSDTALTARGFSAYW 1158          

HSP 6 Score: 95.1301 bits (235), Expect = 3.792e-18
Identity = 151/620 (24.35%), Postives = 244/620 (39.35%), Query Frame = 3
Query:  906 TKEQKESCHFYID---------SKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ--KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGV 2720
            + E+ E   FY++            E G I+SP YP +Y     CS+LL   +   I L F D  + NH    C  D VT+ +GD+  SPIIG+ +CG+     I S  N L++ F T +                    Q +GF   +         TN +     + ++           +G +KSP +P   P+N  C++     H     E   + F +    P+ D++C          R  FVK  +    L   D+     CG             P+V L     N F++     V         G     +    C   +N S   +G I SP F + Y +N  C Y I       + + F  F L +         S  + TC+ D + +I+   +   P+++       +CGS    PL  D     + L F SD+  +  GF   Y            CG  I S   G   + +     Y +N+ C +S++   +   I++ F+DF    S+  C++  L ++DG S    S  + CG  S +P  I ST+N++ L F T   +   +G+K+ + E +   P   C G+    +K  +S   + DG+
Sbjct: 2671 SNERVEYTGFYVEYSFTNCGGIQTGENGVISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENHPT--CTSDSVTVRNGDSPGSPIIGR-YCGQSVPGPIQSGSNQLVVTFNTNN------------------QGQSRGFYATWN--------TNTLGCGGTLHSD-----------NGTIKSPHWPQTFPENSRCSWTAV-THESKHWE---ISFDSNFRIPSSDSQC----------RNSFVK--VWEGMLETNDALLATSCGN--------VAPSPIVTL----GNIFTA-----VFQSEEMPAQGFSASFIS--RCGRTFNSS---TGDIVSPNFPKHYDNNMNCNYYIDVAPQSLVILTFVSFHLED--------RSAVSGTCDYDGLHIIKGHNLSSTPLVT-------ICGSETLRPLTIDG---PVMLNFYSDAYITDFGFKISYRVA--------NCG-GIYSGTYGVLNSPSFSYTNYPNNVYCVYSLQV-RNDRLILLRFNDFEIVPSNL-CSHDYLEVFDGPSIGNRSIGKFCG--STLPQVIKSTNNSLTLLFKTD-SSQTARGWKVSFRETIG--PQQGCGGYLTEDSKSFVSPDHDSDGL 3178          

HSP 7 Score: 88.9669 bits (219), Expect = 2.724e-16
Identity = 157/725 (21.66%), Postives = 265/725 (36.55%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQ-IICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGT--DSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI------LQRLPDGSCPGF 2666
            F SP +P  YP N  C +         + +    F++E     C  D L++Y  +       F++  + + C  +    P  + S  N + + F +D            +   GFN +++ +              C       + E  I SP YP  Y ++  CS+++   +  R+ L   D DL    D C+      YDG + ++  +      ++P   I S+ N L        F++     S        +  Q+ G                                     +S  + SP YP   P N+ CT+    I  +       L F   ++  + D             R F   L+ R       D+P Q   CGT       I   G  + +R  + + +  G  GF   Y+                C   +    T  G+ NSP + + Y SNT C ++I  +  + +++ F  F L          +SL    C  DFV + +    G ++ +       CG+S+PG   S    +++ + F+SD   +  GF A++  I   D        NI+     G I +  +P  Y  N   +W+V   DSS+ I     +   E +  +C    L+IYDG  F   S L GT   +   +F S+ N++  +F +     G +GF L W  +      L  +  G+C G+
Sbjct: 1402 FSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVE-YHASCKYDTLEIYTGLD------FHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTD----------SSLNGRGFNASWRAV-----------PGGCGGIFQVSRGE--IHSPNYPNNYRANTECSWIIQVEKYHRVLLNITDFDL-EATDSCL----MTYDGSSSANTRVATVCGRQQPPNSITSSGNSL--------FVRFQSGSSSQSRGFRAQFRQECG-------------------------------AHIITDSSDSISSPLYPANYPNNQNCTWI---IEAQPPFNHIALSFTHFHLQSSTD-----------CTRDFVEILDGRDS-----DAPVQGRYCGTSLPH--PIISFGNALTVRFVSDSVY--GFDGFHAIYS-----------ASTSACGGTF---YTGDGIFNSPGYPEDYHSNTECVWNIASSPGNHLQLSFLSFQLE---------NSLN---CNKDFVEIREGNATGHLMGR------YCGNSLPGNY-SSIEGHNLWVRFVSDGSGTGMGFQARFKNIFGND--------NIVGT--HGKIATPFWPGNYPLNSNYRWTVNV-DSSHIIHGRILEMDIELT-TNCFYDSLKIYDG--FDIHSRLIGTYCGTQRESFSSSRNSLTFQFSSDSSKSG-RGFLLEWFAVDVSNVTLPTIAPGACGGY 1981          

HSP 8 Score: 88.5817 bits (218), Expect = 4.223e-16
Identity = 143/697 (20.52%), Postives = 267/697 (38.31%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQ-QSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLF-RDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIIN--HKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTE--GSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFISTSNTVHLEFIT 2579
            +  SPN+P  Y    +C +   A     + + F  F++E   P C  D     + +++ +S    +  +GR+CG +   VP  + S  N +V+ F ++   Q + +    +   LG  GT                           + G I SP +P  +P +  CS+  V ++ +   + F  +  +   +  C    V +++G  E++  +    CG      I++  N+    F + +   +                          FS  ++             + C     SS   +G + SP +P     N  C Y++    +       +L F + ++    D    +G+         +  L I  +   L  +P   ICG++   ++ +T  GP++L      N +S     ++  + FK  Y +         C  +Y   S   GV+NSP F+   YP+N  C Y +   N+  I + F +F +            + ++ C  D++ V      GP I       F CGS++  P +  S +NS++L F +DS Q+  G+   +     ++ I     CG  +  + +      +     Y   L C W + A   +  + + F+ F  E   S   C    ++I DG S  +      CG+    P FIS+ N + ++F++
Sbjct: 2699 VISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENH-PTCTSD----SVTVRNGDSP--GSPIIGRYCGQS---VPGPIQSGSNQLVVTFNTNNQGQSRGFYATWNTNTLGCGGTLH------------------------SDNGTIKSPHWPQTFPENSRCSWTAVTHESKHWEISFDSNFRIPSSDSQCRNSFVKVWEGMLETNDALLATSCGNVAPSPIVTLGNIFTAVFQSEEMPAQG-------------------------FSASFI-------------SRCGRTFNSS---TGDIVSPNFPKHYDNNMNCNYYI----DVAPQSLVILTFVSFHLE---DRSAVSGTCD-------YDGLHII-KGHNLSSTPLVTICGSE--TLRPLTIDGPVML------NFYSDA---YITDFGFKISYRVAN-------CGGIY---SGTYGVLNSPSFSYTNYPNNVYCVYSLQVRNDRLILLRFNDFEI------------VPSNLCSHDYLEVF----DGPSIGNRSIGKF-CGSTL--PQVIKSTNNSLTLLFKTDSSQTARGWKVSF-----RETIGPQQGCGGYLTEDSKSFVSPDHDSDGLYDKGLNCIWYIIA-PENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAP-FISSGNFLTVQFVS 3258          

HSP 9 Score: 85.8853 bits (211), Expect = 2.357e-15
Identity = 66/278 (23.74%), Postives = 117/278 (42.09%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLLQKKGF 1310
            +R +  SP +P  Y PN+ C +  + +S   + ++FE  F I+     C++ D+L L     +    L  +   GRFCG    + P+ + +  N + + F SD  N  Q +        L   GT                     YI     +GY+TSP YP  YP H  C ++L       I+L F D     +  +C   ++ + DG   ++P++ +  CG       +S+R ++ ++F T       G   K S +  G  +  +  +++  G+
Sbjct: 2099 DRGIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCG---IYTPSTLFTSDNEMFIQFISDNSNGGQGFKIRYEAKSLACGGTI--------------------YIHDANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIEETPNCSASYLELRDGANSNAPVLSK-LCGHTLPRNWVSSRGLMYLKFHTEGGSGYMGFKAKYSIVSCGGTVSGDSGVIESVGY 2352          

HSP 10 Score: 72.4034 bits (176), Expect = 2.859e-11
Identity = 69/264 (26.14%), Postives = 110/264 (41.67%), Query Frame = 3
Query:  447 YVVYALDCD-IIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFE-HFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPG-IYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            Y   +L C   IY  D    N+     SPN+P  YP +  C +   A S   + + FE  FNIE   P C+  +L+L     S      NA  L + CGHTL   P   VS   ++ L F+++  +          G +GF   +  +      S                + G I S  YP  +Y +++ C + + G     + + F D +L   +  C +D V I++  T  S I+   +CG      + ++ N+  IRF+T
Sbjct: 2210 YEAKSLACGGTIYIHD---ANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIE-ETPNCSASYLELRDGANS------NAPVLSKLCGHTL---PRNWVSSRGLMYLKFHTEGGS----------GYMGFKAKYSIVSCGGTVS---------------GDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNL-QSSPGCAKDFVEIWENHT--SGILLGRYCGNSIPSSVDTSSNVASIRFVT 2432          

HSP 11 Score: 68.5514 bits (166), Expect = 4.234e-10
Identity = 130/559 (23.26%), Postives = 208/559 (37.21%), Query Frame = 3
Query:  975 PTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRL-NTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQLYPSNTTCQYDIIGNNNHRI--RIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQD-----IINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDS--FQASSELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFK 2612
            P YP  YP++ NC++++        I L F    L   + DC  D V I DG    +P+ G+ +CG      I+S  N L +RF++                    +    GF+ +Y  S                 + C     + +   GI  SPGYP     N  C +                     NI  +P N      LS         +LE            + + C  D+ EI+E    G L+     N+     S I G  ++  F  D    G   +    +   N +   + G I +PF+   YP N+  ++ +  +++H I  RI   +  L+ +              C  D +++        I S+ I T   CG+       S SR NS++  F SDS +S  GF  ++  + + +     I    CG  +++        S  +P  Y +   C W + A DS+  + I   D   +    SC+   L I DGDS   Q  + LCG   ++P  I ST   +++ F +     G  GF 
Sbjct: 1635 PLYPANYPNNQNCTWIIEAQPPFNHIALSFTHFHL-QSSTDCTRDFVEILDGRDSDAPVQGR-YCGTSLPHPIISFGNALTVRFVS------------------DSVYGFDGFHAIYSAST----------------SACGGTFYTGD---GIFNSPGYPEDYHSNTECVW---------------------NIASSPGNHLQLSFLSF--------QLE------------NSLNCNKDFVEIREGNATGHLMGRYCGNSLPGNYSSIEGHNLWVRFVSDGSGTGMGFQARFKNIFGNDNIVGTHGKIATPFWPGNYPLNSNYRWTVNVDSSHIIHGRILEMDIELTTN--------------CFYDSLKIYDGF---DIHSRLIGT--YCGTQRES--FSSSR-NSLTFQFSSDSSKSGRGFLLEWFAVDVSNVTLPTIAPGACGGYMVTGDTPVFFFSPGWPGPYGNGADCIWIIYAPDSTVELNILSMDIEAQ---LSCSYDKLIIKDGDSRLSQQLAVLCG--RSVPGPIRSTGEYMYIRFTSDGSVTG-AGFN 2085          

HSP 12 Score: 67.781 bits (164), Expect = 7.445e-10
Identity = 65/251 (25.90%), Postives = 112/251 (44.62%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGP--IISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            GVI SPF+   Y    TC++ I       + + F +F +              +S+C+ D++ +      GP  ++  P    F CG+++P  +   S  N + +TF+  S   + GF A +    ++      CG+ +++E   G I S  +P  Y S + C W +        I + F  F  E  H +CAN  L +YD  +  +    CG  S  P+  S+S+++ L F+ S  A   +GF + +  I
Sbjct:  825 GVIRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIG------------SSSSCDTDYIEI------GPSSVLGSPGNEKF-CGTNIPSFIT--SVYNVLYVTFVKSSSMENRGFMAMFSSEKLE------CGK-VLTE-STGIIESPGHPNVYPSGVNCTWHI-VVQRGQLIRLVFSSFYLE-FHYNCANDYLEVYDTIAQTSLGRYCG-KSIPPSLTSSSHSIKLIFV-SDSALAHEGFSINYEAI 1042          

HSP 13 Score: 56.9954 bits (136), Expect = 1.518e-6
Identity = 83/307 (27.04%), Postives = 127/307 (41.37%), Query Frame = 3
Query: 1740 RLNTSNAF-SSGIGGFVIYYT-FKRDYG---IEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL--YPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIW 2621
            R+N +N F SSG    VI++T   R YG         E  VC     + S   G  +SP +N +  Y  N  C++ +   N  N  I I+F   SL              +  C  D +        GP+I +       C  S P  PL+       + + F+S+    ++GFY +Y F     I   + GEN       G I+S  YP  Y     C W ++A    + I + F DF  E +H +C +  + + +GDS  +      CG   ++P  I S SN + + F T+ +    +GF   W
Sbjct: 2529 RVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGT--LPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLE------------SHQDCTFDVLEFRVGNADGPLIEK------FCSLSAPRVPLVIPYPQ--VWIHFVSNERVEYTGFYVEYSFTNCGGI---QTGEN-------GVISSPNYPNLYSRWTQCSWLLEA-PEGHTITLTFSDFSVE-NHPTCTSDSVTVRNGDSPGSPIIGRYCG--QSVPGPIQSGSNQLVVTFNTNNQGQ-SRGFYATW 2798          
BLAST of Cubilin vs. UniProt/SwissProt
Match: sp|F1RWC3|CUBN_PIG (Cubilin OS=Sus scrofa OX=9823 GN=CUBN PE=1 SV=3)

HSP 1 Score: 122.094 bits (305), Expect = 2.484e-26
Identity = 166/705 (23.55%), Postives = 273/705 (38.72%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG-CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDI-NTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSEL---CGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFK 2612
            +F SPNFP  YP N+ C Y+   ++ +++ ++F  F++E  + G C  D++++            ++  LG++CG    + P  ++S  N + L F SD   +   ++      L G  G                              G  TSP YP  Y     C + L  +      L F D  L +   +C  D++ +YDG + SS ++ +  CG EKP L I ST + + ++  T            DE +      Q  GF V Y+ + D V I N                    +T GIL+S  YP     N+ C + +      N +    L F+  +        CST  L +Y            PQ++          CG         T     VL     ++    G  GF + +     +G  G++             S  +G  +SP +   YP+N  C + I  +    I++   +F +        +YH    +TC  D    + +I  GP    P         S   P+   S  N ++L F +DS  +  GF   +  +P        CG   I +   G I S  YP  YRSN  C W ++  + ++R++++F DF  E       +S +  +DG S  A++ L   CG        IST +++ + F + P     +GF+
Sbjct: 1059 IFTSPNFPSNYPNNMECIYRITVETSQQIALHFTDFSLEEPIGGACAADYVEI------TNGGYASSPPLGKYCG---SNPPPRIISHSNKLWLKFKSDFFGSGPGFSAYWDGSLTGCGGNLT------------------------TPTGTFTSPNYPMPYYHSSECFWWLKSSHGSPFELEFNDFHLEYH-PNCTLDYLDVYDGLSTSSHLLTR-LCGNEKPPL-IRSTGDSMSLKLRT------------DEGQ------QGGGFLVKYQQTCDNVVIVN--------------------RTYGILESIHYPKPYSVNQRCNWTIQATAG-NTVNYTFLAFELES-----HANCSTDYLELYD----------GPQRM-------GRFCGAVIPPSGSTTGSRLQVLFH---TDGVGQGERGFQMQWLV---HGCGGEL-------------SGDTGTFSSPGYPVGYPANKECIWYIHSSPGSSIQLTIHDFDV--------EYH----ATCNFD----VLEIYGGPDFHSPRIAQLCVQRSAENPMQVSSTGNELALRFKTDSSVNGRGFNVSWRAVP------GGCGG--IFQAPSGEIHSPNYPSPYRSNTECTWLIQV-EKNHRVLLNFTDFDLEPQ-----DSCIMAFDGLS-SATARLVGVCGRQQLSNPIISTGSSLFVRFQSGPSRQ-SRGFR 1615          

HSP 2 Score: 112.849 bits (281), Expect = 1.770e-23
Identity = 167/748 (22.33%), Postives = 279/748 (37.30%), Query Frame = 3
Query:  438 LTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQ-NDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSV-QSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAI-PAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            +  +   AL C       +I   +  + QSP  P  YP  + C +  + +    + +    F++E     C +D+L++Y  +            LGR+CG +   +P  + S  N + L F +D +          +   GF   ++  + +  N+T         +          TSP +P  YP+++ C Y +     ++I L F D  L       C  D+V I +G   SSP +G+ +CG  P  +I+S  N L ++F + DF                      GF+  +  S+                T C   + +    +G   SP YP+    +  C ++L   H  +  E   L+F   ++   P+  C+   L +Y        L  R             +CG +   +  I   G  + L+L T        GGF++ Y    D  +               I +   G++ S  + + Y  N  C + I     + +   F  F L              ++ C  D++ +            P      CG+ +P P  S + S  + + F +D V Q   GF  Q+        + H CG  +  +   G  +S  YP  Y +N  C W + +   S+ I +  HDF  E  H +C   +L IY G  F +   ++LC   SA  P  + ST N + L F T     G +GF + W     R   G C G
Sbjct:  922 MAKFSTEALACG------EILTESSGIIQSPGHPNIYPHGVNCTWHILVQPGHLIHLEIRQFHLE-FHYNCTRDYLEIYDTVSDTS--------LGRYCGKS---IPPSLTSNTNSLKLIFVADAD----------LAYEGFVINYEATDASAGNTTALLYRRIWIF----------TSPNFPSNYPNNMECIYRITVETSQQIALHFTDFSLEEPIGGACAADYVEITNGGYASSPPLGK-YCGSNPPPRIISHSNKLWLKFKS-DFFG-----------------SGPGFSAYWDGSL----------------TGCGGNLTTP---TGTFTSPNYPMPYYHSSECFWWLKSSHG-SPFE---LEFNDFHLEYHPN--CTLDYLDVYDGLSTSSHLLTR-------------LCGNEKPPL--IRSTGDSMSLKLRTDEGQQG--GGFLVKYQQTCDNVV---------------IVNRTYGILESIHYPKPYSVNQRCNWTIQATAGNTVNYTFLAFELE------------SHANCSTDYLELYDG---------PQRMGRFCGAVIP-PSGSTTGSR-LQVLFHTDGVGQGERGFQMQW--------LVHGCGGELSGDT--GTFSSPGYPVGYPANKECIWYIHSSPGSS-IQLTIHDFDVE-YHATCNFDVLEIYGGPDFHSPRIAQLCVQRSAENPMQVSSTGNELALRFKTDSSVNG-RGFNVSW-----RAVPGGCGG 1514          

HSP 3 Score: 106.301 bits (264), Expect = 1.730e-21
Identity = 164/726 (22.59%), Postives = 277/726 (38.15%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDG-DTESSPIIGQPFCG-EKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGT--DSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI------LQRLPDGSCPGF 2666
            F SP +P  YP N  C +   +     + +    F++E     CN D L++Y          F++  + + C       P  V S  N + L F +D +              GFN +++ +              C      +   G I SP YP  Y S+  C++L+   +  R+ L F D DL  Q D CI      +DG  + ++ ++G   CG ++    I+ST + L +RF +G     SR              Q +GF   +R          +    HI+    D            + SP +P   P N+ C++    I  +       L F    +  +  + C+   + I         L  R              CG+       IT  G  ++LR  + ++ +    GF   Y           +     C  +++++    G+ NSP + ++YPSN  C ++I  +  +++++ F  F L +            +  C  DFV + +    G ++ +       CG+ +P    S    + + + F+SD   S  GF A ++ I   D   H  G +       G + S  +PR Y  N   QW V   + S  I     +   EG+  +C    LRIYDG      S L GT   +   +F ST +++  +F +S  +   +GF L W  +      L  +  G+C GF
Sbjct: 1404 FSSPGYPVGYPANKECIWYIHSSPGSSIQLTIHDFDVE-YHATCNFDVLEIY------GGPDFHSPRIAQLCVQRSAENPMQVSSTGNELALRFKTDSSVNGR----------GFNVSWRAV-----------PGGCGGIF--QAPSGEIHSPNYPSPYRSNTECTWLIQVEKNHRVLLNFTDFDLEPQ-DSCI----MAFDGLSSATARLVG--VCGRQQLSNPIISTGSSLFVRFQSGP----SR--------------QSRGFRAQFR----------QACGGHILTDSFDT-----------ISSPRFPASYPNNQNCSWI---IQAQPPFNHITLSFSHFGLESS--STCTRDFVEILDGSHSDAPLRGR-------------YCGSSMPH--PITSFGNALMLRFVSDSSVN--FDGFHATY-----------VASTSACGGIFHMAE---GIFNSPGYPEVYPSNVECVWNIASSPGNQLQLSFITFQLED------------SRDCSRDFVEIREGNATGRLVGR------YCGNVLP-LNYSSIIGHDLWIKFVSDGSGSGVGFQAAFNNIFGND---HIVGTH-------GKVASPLWPRNYPHNSNYQWIVNV-NESQVIHGRILEMDVEGTF-NCYYDKLRIYDGADIH--SRLIGTYCGAQTESFSSTGSSLTFQF-SSDSSISGRGFLLEWFAMDASDGPLPTIATGACGGF 1983          

HSP 4 Score: 103.605 bits (257), Expect = 9.117e-21
Identity = 163/716 (22.77%), Postives = 268/716 (37.43%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETA---VLKFQTLNIPPTPDNKCSTGSLSI----YSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNT-VHLEFITSPKAYGQKGFKLIW 2621
            +    + +SP +P  YP    C++       + V++NF  F + G    C+ D    YIE+ S  S +  +    ++CG     +P+F+ S++N + + F    +T+            GF   F    +A      E               G I SP +P IYP  +NC++ ++      I L  R   L  H N  C  D++ IYD  +++S  +G+ +CG+     + S  N L + F+                      L  +GF + Y  +      T  +    I       W         I  SP +P   P N  C Y       R  +ET+    L F   ++       C+   + I    Y+  P          K    + P +II  ++   +K               S+ F SG  GF  Y+      G  G +  P             +G   SP +   Y  ++ C + +  ++     + F +F L        +YH      C  D++ V   +     +      + LCG+  P PLI  S  +S+SL   +D  Q   GF  +Y            C   +I     G + S  YP+ Y  N  C W+++A  + N +   F  F  E SH +C+   L +YDG   Q     CG  + IP   ST+ + + + F T     G++GF++ W
Sbjct:  821 LTGEGVIRSPFYPNVYPGERICRWTIHQPQSQVVLLNFTAFEM-GSSAHCDTD----YIEIGS--SPVLGSPENKKYCG---TDIPSFITSVYNSLHVVFVKSSSTENH----------GFMAKFSTEALACGEILTESS-------------GIIQSPGHPNIYPHGVNCTWHILVQPGHLIHLEIRQFHLEFHYN--CTRDYLEIYDTVSDTS--LGR-YCGKSIPPSLTSNTNSLKLIFVAD------------------ADLAYEGFVINYEATDASAGNTTALLYRRI-------W---------IFTSPNFPSNYPNNMECIY-------RITVETSQQIALHFTDFSLEEPIGGACAADYVEITNGGYASSPPL-------GKYCGSNPPPRIISHSNKLWLKF-------------KSDFFGSGP-GFSAYWDGSLT-GCGGNLTTP-------------TGTFTSPNYPMPYYHSSECFWWLKSSHGSPFELEFNDFHL--------EYH----PNCTLDYLDVYDGLSTSSHL-----LTRLCGNEKP-PLIR-STGDSMSLKLRTDEGQQGGGFLVKY---------QQTCDNVVIVNRTYGILESIHYPKPYSVNQRCNWTIQA-TAGNTVNYTFLAFELE-SHANCSTDYLELYDGP--QRMGRFCG--AVIPPSGSTTGSRLQVLFHTDGVGQGERGFQMQW 1388          

HSP 5 Score: 97.0561 bits (240), Expect = 8.891e-19
Identity = 162/728 (22.25%), Postives = 282/728 (38.74%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDD-CIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFN-QLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIIN--HKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEG--SHQSCANSILRIYDGDSFQA--SSELCGTDSAIPA-FISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDG 2651
            I + +  +  SPN+P  Y     C +   A     + + F  F+IE     C  D     + +++  S    +  +G +CG +    P  + S  N +V+ F +D + Q            GF  T+             +   C   + S  + G I SP +P  +P +  CS+ ++ +  + + + F +  L    D  C+   V ++ G  E+   +    CG     +I++ RN     F + +   +           +   L + G N                                    SG + SP YP +   N  CTY +      + +   +LK  + ++        S  S  ++ IR              L  +P   +CG +   +  +T  GP VLL    SNA ++  G       FK  Y I         C   +N+S    G+I SP ++   YP++  C Y +   ++  I++ F +F L            + ++ C  D++    +I  G  IS P+   F CGS++P P +  S +N++ L F +DSV +  G+      I  ++ +     CG  +           +     Y  NL C W + A   +  I + F  F  E   S Q C    +++YDGDS  A  +   CG  S +PA FIS+ N + ++F+ S  +  ++GF   ++  L  +P G
Sbjct: 2694 IQIGDHGVISSPNYPASYDSLTHCSWLLEAPQGHTITLTFSDFDIEAHA-SCAWD----SVTVRNGGSP--GSPIIGHYCGSS---NPRTIQSGSNQLVVIFNTDSSVQNG----------GFYATWN-----------TETSGCGGILHS--DTGTIRSPHWPQNFPENSRCSWTVITHPSKHLEISFDNNFLIPSGDSQCLNSFVKVWAGTQEADKDLLATSCGNVSPGRIITPRNAFTAVFQSQETPAQG---------FSASFLSRCGRNFT--------------------------------NPSGYIVSPNYPKQYDNNMNCTYII----EASPLSVILLKVVSFHLEARSTVSGSCDSDGVHIIR-----------GHSLSSTPLVTLCGDE--ALSPVTISGP-VLLNF-YSNAHTTDFG-------FKFSYRIT-------PCGGTFNLSF---GIIKSPSYSYSNYPNDMHCLYTVTVRDDRVIQLKFNDFDL------------VPSTFCSQDYL----EIYDGSNISDPLLGKF-CGSTLP-PNVKSS-NNTMFLVFKTDSVHTARGWK-----ISFRETLGPQQGCGGYLTGSTHTFGSPDSDSNGRYDKNLNCIWFITA-PVNKLIKLTFSTFALEAATSLQRCIYDYVKLYDGDSENANLAGTFCG--STVPAPFISSGNFLTVQFV-SDSSLEREGFNATYT--LLDMPCG 3281          

HSP 6 Score: 96.2857 bits (238), Expect = 1.591e-18
Identity = 166/770 (21.56%), Postives = 285/770 (37.01%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLLQKKGFNVV---------YRF-----------------------SVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQ----TLNIP----PTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREI-KEITCKGPLVLLRLNTSNAF----SSGIGGFVIYYT-FKRDYG---IEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL--YPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +R +  SP +P+ Y  N+ C +    +    + ++FE  F +      CN+ D+L L          L      GRFCG       + + +  N + + F SD + +            GF  T++          K      + YI      GY+ SP +P  YP H +C +++       IRL F D        +C   ++ + DG   ++P++ + FCG       LS+  ++ +RF +       G   K S  + G  +     +++  G+  +         +R                          D+V+I       +++G  C   +  S  TSG +      VR   +   T   + +   + ME      Q    T   P    P P        +++   R    ++ +    L L   P    C +++  +   I    P +  R ++ N      SSG    V+Y+T   R YG         E  VC    +++++  G   SP ++    Y  N  C++ +  +N  N  I I F++F L              +  C+ D +        G +I +      LCGSS P  PL+       + + F+++    H GF A+Y F          CG   I +   G I+S  YP  Y S   C W ++A    + I + F DF  E +H SCA   + + +G S  +      CG  S+ P  I + +   +    +  +    GF   W
Sbjct: 2101 DRGIITSPGYPEAYTSNLNCSWHVQVQQGLSIAVHFEQPFQVSNRDAFCNQGDYLVLKNGPDIYSPPLGPHGGNGRFCG---SRPSSTLFTSDNELFVQFISDNSNEGQ----------GFKITYE---------AKSLACGGNIYIHDADSSGYVASPNHPDNYPQHADCIWVIAAPSGRPIRLEFEDQFSIEITPNCTSSYLELRDGADSNAPVLAK-FCGTSLPPSQLSSGEVMYLRFRSDNSPTHAGFKAKYSIAQCGGTVTGQSGVIESSGYPALPYANNLFCEWRLQGLSGHYLTIHFEDFNLQNSSGCERDFVEIWENHTSGNLLGRYCGNTVPDSIDTSGNVAL----VRFVTDGFLTASGFRLRFDSSMEGCGGDLQGPTGTFTAPNYLNPNPHGWMCEWRITVQEGR----RVTLTLNDLRLEAHP---FCNSEHVAVFNGIRSNSPQLEKRCSSVNGSNEIRSSGNTMKVVYFTDGSRPYGGFTASYTSSEDAVCG--GSLTNSPEGNFTSPGYDGTRNYSRNLNCEWTLSNSNQGNSSIYIDFEDFYLE------------SHQDCQFDVLEFRVDNADGLLIWR------LCGSSKPTMPLVIPYP--QVWIHFVTNERVEHIGFRARYSFT--------DCGGIQIGD--HGVISSPNYPASYDSLTHCSWLLEA-PQGHTITLTFSDFDIE-AHASCAWDSVTVRNGGSPGSPIIGHYCG--SSNPRTIQSGSNQLVVIFNTDSSVQNGGFYATW 2800          

HSP 7 Score: 92.4337 bits (228), Expect = 2.265e-17
Identity = 165/712 (23.17%), Postives = 255/712 (35.81%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLV------LLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYN--ISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFI-----PIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
             SPN+P  Y  N  C +    +   +V++NF  F++E       +D     +    L S    A+ +G  CG     + N ++S  + + + F S  + Q            GF   F+            Q    H   DS      I+SP +P  YP++ NCS+++        I L F    L   +  C  D V I DG    +P+ G+ +CG      I S  N L++RF++   +                     GF+  Y  S         M +                   GI  SPGYP   P N  C +                     NI  +P N+                 L++      L DS D   C  D+ EI+E    G LV      +L LN S+     I G  ++  F  D    G   +    +   N  I  T  G + SP + + YP N+   Y  I N N    I+ +   +  +G     Y  L+              I  G  I   +  ++ CG+         S  +S++  F SDS  S  GF  ++  +     P+  I    CG  + +      + S  +P  Y +   C W ++A DS+  + I   D     SH++C    L I DGD+  A   + LCG +  IP  I ++        TS  +  + GF
Sbjct: 1524 HSPNYPSPYRSNTECTWLIQVEKNHRVLLNFTDFDLE------PQD--SCIMAFDGLSSA--TARLVG-VCGR--QQLSNPIISTGSSLFVRFQSGPSRQSR----------GFRAQFR------------QACGGHILTDSFDT---ISSPRFPASYPNNQNCSWIIQAQPPFNHITLSFSHFGL-ESSSTCTRDFVEILDGSHSDAPLRGR-YCGSSMPHPITSFGNALMLRFVSDSSVNF------------------DGFHATYVASTSACGGIFHMAE-------------------GIFNSPGYPEVYPSNVECVW---------------------NIASSPGNQ-----------------LQLSFITFQLEDSRD---CSRDFVEIREGNATGRLVGRYCGNVLPLNYSS-----IIGHDLWIKFVSDGSGSGVGFQAAFNNIFGNDHIVGTH-GKVASPLWPRNYPHNS--NYQWIVNVNESQVIHGRILEMDVEGTFNCYYDKLR--------------IYDGADIHSRLIGTY-CGAQTES---FSSTGSSLTFQFSSDSSISGRGFLLEWFAMDASDGPLPTIATGACGGFLRTGDAPVFLYSPGWPGSYSNGADCMWLIQAPDSTVELNILSLDIE---SHRTCDYDKLVIRDGDNNMAQELAVLCGRE--IPGPIRSTGEYMTIRFTSDFSVTRAGF 2086          

HSP 8 Score: 90.8929 bits (224), Expect = 6.836e-17
Identity = 139/669 (20.78%), Postives = 262/669 (39.16%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRD-LDLNHQNDDCIE-DHVTIYDGDTESSPIIG-----QPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKE-ITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRD-----YGIEGK--MVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG 2483
            SP +P  Y     C +  +      V +N    +IE     C+ D L +     ++      A+ L   CG     +P  + S    + + F SD +  ++          GFN +F               +SC  Y+ + +  G ITSP YP  Y S+LNCS+ +   Q   I + F     +++++  C + D++ + +G    SP +G       FCG +P   + ++ N L ++FI+         ++ +E          +GF + Y              K+   G   +++I  ++ +SG + SP +P   P++  C + +                                  +  S RP  ++ E +    + P+      C + Y E+++      P++     TS   S    G V+Y  F+ D      G + K  + + G         + +SGVI S  +  L Y +N  C++ + G + H + I+F++F+L              +S CE DFV + +    G ++ +       CG++VP  +  D+  N   + F++D   + SGF  ++      D     CG ++      G  T+  Y        +C+W +       R+ +  +D   E +H  C +  + +++G
Sbjct: 1995 SPGWPGSYSNGADCMW-LIQAPDSTVELNILSLDIESHRT-CDYDKLVIRDGDNNM------AQELAVLCGR---EIPGPIRSTGEYMTIRFTSDFSVTRA----------GFNASFH--------------KSCGGYLHADR--GIITSPGYPEAYTSNLNCSWHVQVQQGLSIAVHFEQPFQVSNRDAFCNQGDYLVLKNGPDIYSPPLGPHGGNGRFCGSRPSSTLFTSDNELFVQFIS---------DNSNE---------GQGFKITYE------------AKSLACGG--NIYIHDAD-SSGYVASPNHPDNYPQHADCIWVI----------------------------------AAPSGRPIRLEFEDQFSIEITPN------CTSSYLELRDGADSNAPVLAKFCGTSLPPSQLSSGEVMYLRFRSDNSPTHAGFKAKYSIAQCG------GTVTGQSGVIESSGYPALPYANNLFCEWRLQGLSGHYLTIHFEDFNLQ------------NSSGCERDFVEIWENHTSGNLLGR------YCGNTVPDSI--DTSGNVALVRFVTDGFLTASGFRLRF------DSSMEGCGGDLQGPT--GTFTAPNYLNPNPHGWMCEWRITV-QEGRRVTLTLNDLRLE-AHPFCNSEHVAVFNG 2517          

HSP 9 Score: 74.7146 bits (182), Expect = 5.867e-12
Identity = 61/236 (25.85%), Postives = 104/236 (44.07%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLK-ILSTRNMLLIRF 1223
             +SP +P  Y  +  C     A     + + F  F +E    GC +DFL++       EST   +  LG++CG  L   PN + S    + L F SD  T                   +  EI  I ++         Y DS    G +TSP YPG YP+H +C ++++      + + F  + ++    +C+++++ +YDG   +SP  G P+CG    +    ++ + + IRF
Sbjct: 3408 LRSPGWPAGYASDADCAVVLRAPQNHTISLFFHAFGLEDS-GGCTRDFLEV---RNGSEST---SPLLGKYCGTLL---PNPIFSQSRDLYLRFKSDSATSG-----------------RGYEI--IWTSSPSGCGGTLYGDS----GLVTSPGYPGTYPNHTHCEWVIIAPGGRPVTVSFSFISIDDPG-ECVQNYLMLYDGPDANSPSSG-PYCGADTDVAPFAASSHRVFIRF 3608          

HSP 10 Score: 70.4774 bits (171), Expect = 1.336e-10
Identity = 63/249 (25.30%), Postives = 101/249 (40.56%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQ--ASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            G + SP +   Y S+  C   +    NH I ++F  F L + G             C  DF+ V      G   + P+   + CG+ +P P+ S SR   + L F SDS  S  G+   +   P        CG  +  +   G +TS  YP  Y ++  C+W + A     R +     F++      C  + L +YDG      +S   CG D+ +  F ++S+ V + F     A      +L W+
Sbjct: 3406 GRLRSPGWPAGYASDADCAVVLRAPQNHTISLFFHAFGLEDSG------------GCTRDFLEVR----NGSESTSPLLGKY-CGTLLPNPIFSQSRD--LYLRFKSDSATSGRGYEIIWTSSP------SGCGGTLYGD--SGLVTSPGYPGTYPNHTHCEWVIIA--PGGRPVTVSFSFISIDDPGECVQNYLMLYDGPDANSPSSGPYCGADTDVAPFAASSHRVFIRFHAEAAAR-PSALRLTWA 3624          
BLAST of Cubilin vs. UniProt/SwissProt
Match: sp|Q9TU53|CUBN_CANLF (Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.189e-24
Identity = 158/700 (22.57%), Postives = 262/700 (37.43%), Query Frame = 3
Query:  561 RCKYQFVAKSQEKVVINFEHFNIEGLLPG-CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI--ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIG----GFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            +C Y+   ++ +++ ++F +F +E  + G C  DF+++       +     +  LG +CG      P  ++S  N + L F SD + +   ++      L G  G                              G  TSP+YP  Y     C +LL  +      L F D  L H   +C  D++ +YDG + SS ++ Q  CG +    I ST + + ++F T            DE +      Q  GF   Y+ +   V I N                    +  GIL+S  YP     N+ C + +      N +    L F+  N        CST  L +Y                   D P ++   CG D       T     VL        ++ G+G    GF + +     +G  G++             S  +G  +SP +   YP N  C + I       I++   +F +        +YH    + C  D + V      GP    P  T      S   P+   S  N +++ F +DS  +  GF A +  +P        CG   I +   G I S  YP  YR N  C W ++  + ++RI+++F DF  E       +S +  YDG S   +  + +CG         S+ N++ L F + P   G +GF+  ++++
Sbjct: 1069 KCIYRITVETSQQIALHFTNFALEEAIGGQCVADFVEI------RDGGYETSPPLGTYCGSI---PPPRIISHSNKLWLQFTSDFLGSGPGFSAYWDGSLTGCGGNIT------------------------TPTGVFTSPSYPMPYYHSSECYWLLKASHGSPFELEFEDFHLEHH-PNCTLDYLAVYDGPSTSSHLLSQ-LCGNEKPPVIRSTGDSMFLKFRT------------DEDQ------QGGGFLAKYQQTCRNVVIVN--------------------RNYGILESIHYPNPYSDNQRCNWTIQAT-TGNTVNYTFLAFELEN-----HINCSTDYLELY-------------------DGPRRMGRYCGADMPPTGSTTGSKLQVLF-------YTDGVGHQEKGFQMQWFI---HGCGGEL-------------SGTTGSFSSPGYPNTYPPNKECIWYITTAPGSSIQLTIHDFDV--------EYH----ARCNFDVLEVY----GGPDFHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNASWQAVP------GGCGG--IFQAPNGEIHSPNYPSPYRGNTDCSWVIRV-ERNHRILLNFTDFDLEPQ-----DSCITAYDGLSSTTTRLASVCGRQQLTNPITSSGNSLFLRFQSGPSRQG-RGFRAQFNQV 1616          

HSP 2 Score: 114.39 bits (285), Expect = 5.806e-24
Identity = 169/727 (23.25%), Postives = 273/727 (37.55%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD--INTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLK-ILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEI------LQRLPDGSCPGF 2666
            F SP +P  YPPN  C +         + +    F++E     CN D L++Y          F++  + + C       P  V S  N + + F +D  IN +            GFN +++ +              C     +   E  I SP YP  Y  + +CS+++   +  RI L F D DL  Q D CI    T YDG + ++  +    CG +     I S+ N L +RF +G     SR              Q +GF   +          N++   HI+    D            + SP +P + P N+ C++    I  +       L F    +  +    C+   L I         L  R     +P                 IT     + LR  + +  +S   GF   Y                 C   ++++    G+ NSP + ++YPSN  C ++I+ +  +R+++ F  F L +            +  C  DFV V +    G ++ +       CG+ +P    S    + + + F+SD   S +GF A +  I   D        NI+     G I S  +P  Y  N   QW V   +++  I     +   EG+ QSC    LR+YDG    +      CGT +   +F S+ N++  +F +     G KGF L W  +      L  +  G+C GF
Sbjct: 1399 FSSPGYPNTYPPNKECIWYITTAPGSSIQLTIHDFDVE-YHARCNFDVLEVY------GGPDFHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGR------------GFNASWQAV-----------PGGCGGIFQAPNGE--IHSPNYPSPYRGNTDCSWVIRVERNHRILLNFTDFDLEPQ-DSCI----TAYDGLSSTTTRLAS-VCGRQQLTNPITSSGNSLFLRFQSGP----SR--------------QGRGFRAQF----------NQVCGGHILTNSFDT-----------ISSPLFPAKYPNNQNCSWV---IQAQPPFNHITLSFDHFGLESS--TTCTQDFLEILDGDYDDAPLRGRYCGHSMP---------------HPITSFSSALTLRFVSDSRVNSD--GFHATYA-----------ASSSACGGTFHMAE---GIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLED------------SQDCSRDFVEVREGNATGHLVGR------YCGNVLP-LNYSSIVGHILWIRFVSDGSGSGTGFQATFTKIFGND--------NIVG--THGKIASPLWPGRYPHNSNYQWIVNV-NATQVIHGRILEIDIEGA-QSCYYDKLRVYDGLGIHSRLIGTYCGTQTT--SFSSSRNSLTFQFSSDSSITG-KGFLLEWFAVNASGGPLPTIATGACGGF 1978          

HSP 3 Score: 108.612 bits (270), Expect = 3.309e-22
Identity = 173/760 (22.76%), Postives = 301/760 (39.61%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRD-LDLNHQNDDCIE-DHVTIYDGDTESSPIIG-----QPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQ---TLNIPPTPDNKCSTGSL----SIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFIT-SPKAYGQKGFKLIWSE--------ILQRLPDG--SCPGFECLKTKHCISRQLECD 2714
            SP +P+ Y  +  C +  +      V +N    +IE     C+ D L     ++  +S L  A  L   CG     +P  + S    + + F SD +   +          GFN +F               +SC  Y+ + +  G ITSP YP  Y  +LNCS+ ++      I + F     +   +  C + D++ + +G    SP +G       FCG +P   + ++ N + ++FI+      S    G +IK   K L   G N+       Y+   N                     ++G + SPG+P   P++  C + +     +      +++ Q     NI  TP+  C +  L     + S  P   KL  R     LP S                   G ++ LR  + N  SS   GF I Y   +     G++             + +SG+I S  +  L Y  N+ C++ + G + H + I+F++F            H   +S CE DFV + +    G ++ +       CG+++P  +  D+ SN   + F++D   + SGF  ++      +     CG     E++G  G  TS  YP       +C+W +       RI + F++   E +H SC +  + I++G  ++     +LCG+ +A     S+ NT+ + F T   + +G  GF   ++          L   P+G  + PG+  +      SR L C+
Sbjct: 1990 SPGWPESYSNSADCTW-LIQAPDSTVELNILSLDIEAQRT-CDYDKL----VIRDGDSNL--APQLAVLCGR---EIPGPIRSTGEYMFIRFTSDFSITGA----------GFNASFH--------------KSCGGYLHADR--GIITSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYSPPLGPYGRNGHFCGSRPSSTLFTSDNQMFVQFIS----DGSNGGQGFKIKYEAKSLACGG-NI-------YIHDVN---------------------SAGYVTSPGHPNNYPQHADCNWLIAAPPGK------LIRVQFEDQFNIEETPN--CVSNYLELRDGVDSNAPLLAKLCGRS----LPSSQ---------------LSSGEVMYLRFRSDN--SSTQVGFKIKYAIAQ---CGGRV-------------TGQSGIIESSGYPTLPYRDNSFCEWHLKGPSGHYLTIHFEDF------------HLQNSSGCEKDFVEIWENHTSGNLLGR------YCGNTIPDSI--DTSSNVALVRFVTDGSVTASGFRLRF------ESSMEACG----GELQGPTGTFTSPNYPNPNPHGRVCEWRIMV-QEGRRITLTFNNLRLE-AHPSCYSEHVTIFNGIRNNSPQLEKLCGSVNASSEIKSSGNTMKVVFFTDGSRPFG--GFSATYTSSEDAVCGGSLTHFPEGNFTSPGYNGVSN---YSRNLNCE 2597          

HSP 4 Score: 108.227 bits (269), Expect = 4.121e-22
Identity = 172/792 (21.72%), Postives = 282/792 (35.61%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLLQKKGFNVV-YR-------------------------------FSVDYVKITNEMEKNHIIGTECDMWIKSSEKTS--------------------------------------GILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY-SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL--YPSNTTCQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVP-GPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +R +  SP +P+ Y PN+ C +  + +S   + ++FE  F I      C++ D+L L          L      G FCG      P+  +         F SD      +  D   G  GF   ++          K      + YI      GY+TSP +P  YP H +C++L+     + IR+ F D     +  +C+ +++ + DG   ++P++ +  CG       LS+  ++ +RF +       G  IK +  + G  +     +++  G+  + YR                                  D+V+I       +++G  C   I  S  TS                                      G   SP YP   P  ++C + +     R       L F  L +   P   C +  ++I+  IR    +LE               +CG+      EI   G  + +   T    S   GGF   YT   D    G +      HF         G   SP +N +  Y  N  C++ +   N  N  I I+F++F L              +  C+ D +        GP++ +      LCG S P  PL+       + + F+++    H GF+A+Y F          CG   + E   G I S  YP  Y S   C W ++A      I + F DF  E  H +CA   + + +G S  +    + CGT +  P  I + +   +    S  +    GF   W
Sbjct: 2096 DRGIITSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYSPPLGPYGRNGHFCGSR----PSSTL---------FTSDNQMFVQFISDGSNGGQGFKIKYE---------AKSLACGGNIYIHDVNSAGYVTSPGHPNNYPQHADCNWLIAAPPGKLIRVQFEDQFNIEETPNCVSNYLELRDGVDSNAPLLAK-LCGRSLPSSQLSSGEVMYLRFRSDNSSTQVGFKIKYAIAQCGGRVTGQSGIIESSGYPTLPYRDNSFCEWHLKGPSGHYLTIHFEDFHLQNSSGCEKDFVEIWENHTSGNLLGRYCGNTIPDSIDTSSNVALVRFVTDGSVTASGFRLRFESSMEACGGELQGPTGTFTSPNYPNPNPHGRVCEWRIMVQEGRR----ITLTFNNLRLEAHP--SCYSEHVTIFNGIRNNSPQLE--------------KLCGS-VNASSEIKSSGNTMKVVFFTDG--SRPFGGFSATYTSSEDAVCGGSLT-----HF-------PEGNFTSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFEDFYLE------------SHQDCQFDVLEFRVGNADGPLMWR------LCGPSKPIVPLVIPYP--EVWIHFVTNEHVEHVGFHAEYSFT--------DCGGIQLGE--SGVIASPNYPASYDSLTHCSWLLEA-PQGFTITLTFSDFDIE-DHATCAWDSVSVRNGGSPGSPIIGQYCGTSN--PRTIQSGSNQLVVIFNSDHSVQNGGFYATW 2795          

HSP 5 Score: 107.457 bits (267), Expect = 7.192e-22
Identity = 163/721 (22.61%), Postives = 286/721 (39.67%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLF-RDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFN-QLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIIN--HKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEG--SHQSCANSILRIYDGDSFQA--SSELCGTDSAIPA-FISTSNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            I +    +  SPN+P  Y     C +   A     + + F  F+IE     C  D     + +++  S    +  +G++CG +    P  + S  N +V+ F SD + Q            GF  T+             Q   C   + S  + G I SP +P  +P +  CS+ ++ ++ +++ + F  +  +   +  C    V ++ G  E +  +    CG      IL+ RN+ +  F + +   +                          FS  +V        N                 SG + SP YP +   N  CTY +      + +   +L F++ ++        S  +  ++ IR              L  +P   +CG +   +  +T  GP VLL    SNA ++ +G       FK +Y I         C  V+N+S+   GVI SP ++   YP+N  C Y I+G ++  +++ F +F +            + ++ C  D++ +      G  IS P+   F CGS++P P I  S ++S+ L F +DS Q+  G+      I  Q  +     CG  +           +     Y  NL C W + A   +  I + F+ F  E   + Q C    +++YDGDS  A  +   CG  S +PA FIS+ N + ++F+ S     ++GF   ++ +
Sbjct: 2689 IQLGESGVIASPNYPASYDSLTHCSWLLEAPQGFTITLTFSDFDIEDHAT-CAWD----SVSVRNGGSP--GSPIIGQYCGTS---NPRTIQSGSNQLVVIFNSDHSVQNG----------GFYATWN-----------TQTLGCGGILHS--DNGTIRSPHWPQNFPENSRCSWTVITHESKQLEISFDNNFRIPSGDGQCQNSFVKVWAGTEEVAESLLATGCGNVAPGSILTPRNVFIAVFQSQETPAQG-------------------------FSASFVSRCGGNFTN----------------PSGYILSPNYPRQYDNNMNCTYII----EADPLSVVLLTFESFHLEARSAITGSCANDGVHIIR-----------GSNLSSTPFATVCGNEI--LSPVTILGP-VLLNF-YSNAHTTDLG-------FKFNYKITS-------CGGVFNVST---GVIKSPAYSYSDYPNNIYCLYTIVGRDDRVVQLKFSDFDV------------VPSTFCSQDYLAIY----DGSNISDPLLGKF-CGSNLP-PNIKSS-NHSMLLVFKTDSFQTARGWK-----ITFQQTLGPQQGCGGYLTGSDNTFASPDSDSNGRYDKNLNCVWFIIA-PVNKLIKLTFNTFALEAQSAMQRCIYDYVKLYDGDSENANLAGTFCG--STVPAPFISSGNFLTVQFV-SDVTLEREGFNATYTTV 3271          

HSP 6 Score: 93.5893 bits (231), Expect = 1.173e-17
Identity = 172/727 (23.66%), Postives = 272/727 (37.41%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQ-NDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI---ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSV-QSHSGFYAQYDFIPIQDIINHKCGENIISEIRG--GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAI-PAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            + QSP  P  YP  I C +  + +    + + F  F++E     C  D+L++Y    +         +LGR+CG +   +P  + S  N + L F +D +             L + G     E    +S   +        D  +  G  TSP +P  YP++  C Y +     ++I L F +  L       C+ D V I DG  E+SP +G  +CG  P  +I+S  N L ++F T DF     L SG             GF+  +  S+                T C   I +    +G+  SP YP+    +  C + L   H  +  E   L+F+  ++   P+  C+   L++Y                  P +   +   +CG +   +  I   G  + L+  T        GGF+  Y                 C  V  I +   G++ S  +   Y  N  C + I     + +   F  F L              +  C  D++ +            P      CG+ +P P  S + S  + + F +D V     GF  Q+ FI       H CG     E+ G  G+ +S  YP  Y  N  C W +     S+ I +  HDF  E  H  C   +L +Y G  F +   ++LC   S+  P  + ST N + + F T     G +GF   W    Q +P G C G
Sbjct:  938 IIQSPGHPNIYPHGINCTWHILVQPGHLIHLIFRKFHLE-FHYNCTNDYLEVYDTGSN--------TYLGRYCGKS---IPPSLTSSTNSLKLIFVADSD-------------LAYEGFLINYEATDASSACME--------DYTENSGTFTSPNFPNNYPNNWKCIYRITVETSQQIALHFTNFALEEAIGGQCVADFVEIRDGGYETSPPLGT-YCGSIPPPRIISHSNKLWLQF-TSDF-----LGSG------------PGFSAYWDGSL----------------TGCGGNITTP---TGVFTSPSYPMPYYHSSECYWLLKASHG-SPFE---LEFEDFHLEHHPN--CTLDYLAVYD----------------GPSTSSHLLSQLCGNEKPPV--IRSTGDSMFLKFRTDEDQQG--GGFLAKYQ--------------QTCRNVV-IVNRNYGILESIHYPNPYSDNQRCNWTIQATTGNTVNYTFLAFELE------------NHINCSTDYLELYDG---------PRRMGRYCGADMP-PTGSTTGSK-LQVLFYTDGVGHQEKGFQMQW-FI-------HGCG----GELSGTTGSFSSPGYPNTYPPNKECIWYITTAPGSS-IQLTIHDFDVE-YHARCNFDVLEVYGGPDFHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSING-RGFNASW----QAVP-GGCGG 1509          

HSP 7 Score: 82.0333 bits (201), Expect = 3.836e-14
Identity = 154/711 (21.66%), Postives = 261/711 (36.71%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIE--GKMVEPGVCHFVYN-ISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGS-HQSCANSILRIYDGDSFQASSEL---CGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEIL 2633
            +SP +P  YPP   C +Q V      +   F   ++E     C+KD+L++       +  L+    LG+FC  TL   P  + +      + F+SD    Q  +Q  H+  L                        H   +    EG ++S    G +  +  C Y++     E+I++ F  ++L  Q+  C + H+ + D       I+    C  +    I S RN + IR                 +K++  L+ +  F  VY+ +    ++T E                      G+++SP YP   P  ++C + ++    + + +  +L F    I  +    C T  + I S               +L    ++  CGTD           PL +  +              +Y  F +    E  G M +          I +  +G+I SP    +YP    C + I+    H I + F++F L        ++H      C  D++ V                   CG S+P  L S   +NS+ L F++DS  ++ GF   Y+             EN       G  TS  +P  Y +N  C + +   ++S +I +HF +F  E +    C    + I DG  ++ S  L   CG+    P  IS SN + L+F +     G  GF   W   L
Sbjct:  599 KSPGYPGNYPPGRDCVWQVVTSPDLLITFTFGTLSLE-HHDDCSKDYLEI------RDGPLYQDPSLGKFC-TTLSVPP--LQTTGPFARVHFHSD---NQINDQGFHITYL------------------TSPSDLHCGGNYTDPEGLLSS-DLSGPFTHNRQCIYIIKQPLGEQIQVNFTHVELEGQSS-CSQSHIEVRD-----DKILLGKVCDNETLPHIKSIRNHIWIR-----------------LKIDASLV-RASFRAVYQVACG-GELTGE----------------------GVIRSPFYPNVYPGERICRWTIH----QPQSQVVILNFTAFGIESSA--HCDTDYIEIGS-------------SSILGSPENKKYCGTDI----------PLFITSVYN-----------FLYVIFVKSSSTENHGFMAKFSAADLACGEILTESTGIIQSPGHPNIYPHGINCTWHILVQPGHLIHLIFRKFHL--------EFH----YNCTNDYLEVYDT-------GSNTYLGRYCGKSIPPSLTSS--TNSLKLIFVADSDLAYEGFLINYEATDASSACMEDYTEN------SGTFTSPNFPNNYPNNWKCIYRITV-ETSQQIALHFTNFALEEAIGGQCVADFVEIRDG-GYETSPPLGTYCGSIPP-PRIISHSNKLWLQFTSDFLGSG-PGFSAYWDGSL 1159          

HSP 8 Score: 82.0333 bits (201), Expect = 4.034e-14
Identity = 69/247 (27.94%), Postives = 113/247 (45.75%), Query Frame = 3
Query:  495 IGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQ-EKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILS-TRNMLLIRFIT 1229
            I  N+     SP FP KYP N  C +   A+     + ++F+HF +E     C +DFL++      L+    +A   GR+CGH++ H    + S  + + L F SD       N D      GF+ T+         S+     + H        EG   SP YP +YPS++ C + +V +   R++L F    L   + DC  D V + +G+  +  ++G+ +CG    L   S   ++L IRF++
Sbjct: 1621 ILTNSFDTISSPLFPAKYPNNQNCSWVIQAQPPFNHITLSFDHFGLESSTT-CTQDFLEI------LDGDYDDAPLRGRYCGHSMPHP---ITSFSSALTLRFVSD----SRVNSD------GFHATYA-------ASSSACGGTFHM------AEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQL-EDSQDCSRDFVEVREGNA-TGHLVGR-YCGNVLPLNYSSIVGHILWIRFVS 1831          

HSP 9 Score: 75.0998 bits (183), Expect = 4.518e-12
Identity = 64/248 (25.81%), Postives = 110/248 (44.35%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            G + SP +   Y +N  C   +    NH I ++F  F + +            +S C  DF+ V      G   S P+  ++ CG+ +P P+ S  R+N + L F +DS  S+ G+   +   P        CG  +  +   G+ TS  YP  Y +N  C+W++ A  +   + + F+ F++      C  + L +YDG    + S    CG D+ I  F+++S+ V ++F      Y     +L W
Sbjct: 3401 GNLKSPGWPDNYDNNLDCTVILTAPQNHTISLFFHSFGIED------------SSECTHDFLEV----RNGSDSSSPLFGTY-CGTLLPDPIFS--RNNKLYLRFKTDSATSNRGYEIVWTSSP------SGCGGTLYGD--SGSFTSPGYPGTYPNNTDCEWAIIA-PAGRPVTVTFY-FISIDDPGDCVQNYLILYDGPDANSPSFGPYCGADTNIAPFVASSHRVFIKFHAEYAVY-PSAIRLTW 3618          

HSP 10 Score: 75.0998 bits (183), Expect = 4.713e-12
Identity = 154/718 (21.45%), Postives = 262/718 (36.49%), Query Frame = 3
Query:  459 ALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQN---DDCIEDHVTIYDGDTESSPIIGQPF---CGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGD-EIKMNPKLLQKKG-FNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRT-PKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTD-SAIPAFISTSNTVHLEF 2573
             L C  I +SD          +SP++PQ +P N RC +  +    +++ I+F++ F I      C   F+ ++   + +  +L     L   CG+     P  +++  N+ +  F S     Q ++               F+     N T                 GYI SP YP  Y +++NC+Y++  +    + L F    L  ++     C  D V I  G   SS     PF   CG +  L  ++    +L+ F        S   + D   K N K+    G FNV                                  ++G++KSP Y     P N  C Y + G  +R       LKF   ++   P   CS   L+IY                 + D      CG++     + +    L++ +   +++F +  G  +   TF++  G      + G   ++    +T +   +    N  Y  N  C + II   N  I++ F  F+L      ++         C  D+V    K+  G   +  +  +F CGS+VP P IS    N +++ F+SD      GF A Y        ++  CG    +     +I+S           +C W ++A        +    +  E   Q C  + L   D      S   ++CG + SA P F S+ +T  + F
Sbjct: 2799 TLGCGGILHSDN------GTIRSPHWPQNFPENSRCSWTVITHESKQLEISFDNNFRIPSGDGQCQNSFVKVWAGTEEVAESL-----LATGCGNV---APGSILTPRNVFIAVFQSQETPAQGFSA-------------SFVSRCGGNFTNP--------------SGYILSPNYPRQYDNNMNCTYIIEADPLSVVLLTFESFHLEARSAITGSCANDGVHIIRGSNLSS----TPFATVCGNE-ILSPVTILGPVLLNFY-------SNAHTTDLGFKFNYKITSCGGVFNV----------------------------------STGVIKSPAYSYSDYPNNIYCLYTIVGRDDR----VVQLKFSDFDV--VPSTFCSQDYLAIY-------------DGSNISDPLLGKFCGSNLPPNIKSSNHSMLLVFK---TDSFQTARGWKI---TFQQTLG-----PQQGCGGYLTGSDNTFASPDSDS--NGRYDKNLNCVWFIIAPVNKLIKLTFNTFALEAQSAMQR---------CIYDYV----KLYDGDSENANLAGTF-CGSTVPAPFISS--GNFLTVQFVSDVTLEREGFNATY------TTVDMPCGGTYNATWTPQSISSPNSSNPEVPLSMCMWFLEA---PPHQQVKITVWALELHSQDCDQNYLEFRDSPESNGSPGPQICGRNASATPTFYSSRSTAIVIF 3372          

HSP 11 Score: 72.4034 bits (176), Expect = 3.032e-11
Identity = 63/244 (25.82%), Postives = 110/244 (45.08%), Query Frame = 3
Query:  501 VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            +    + +SP +P  YP    C++       + V++NF  F IE     C+ D    YIE+ S  S++  +    ++CG     +P F+ S++N + + F       +S + ++H    GF   F   ++A      E               G I SP +P IYP  +NC++ ++      I L+FR   L  H N  C  D++ +Y  DT S+  +G+ +CG+     + S+ N L + F+ 
Sbjct:  817 LTGEGVIRSPFYPNVYPGERICRWTIHQPQSQVVILNFTAFGIESSAH-CDTD----YIEIGS--SSILGSPENKKYCG---TDIPLFITSVYNFLYVIFV------KSSSTENH----GFMAKFSAADLACGEILTEST-------------GIIQSPGHPNIYPHGINCTWHILVQPGHLIHLIFRKFHLEFHYN--CTNDYLEVY--DTGSNTYLGR-YCGKSIPPSLTSSTNSLKLIFVA 1022          

HSP 12 Score: 69.3218 bits (168), Expect = 2.449e-10
Identity = 60/236 (25.42%), Postives = 102/236 (43.22%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLK-ILSTRNMLLIRF 1223
             +SP +P  Y  N+ C     A     + + F  F IE     C  DFL++     S  S LF     G +CG  L   P+ + S +N + L F +D  T                   +  EI   +S      +   Y DS    G  TSP YPG YP++ +C + ++      + + F  + ++    DC+++++ +YDG   +SP  G P+CG    +   +++ + + I+F
Sbjct: 3403 LKSPGWPDNYDNNLDCTVILTAPQNHTISLFFHSFGIEDSSE-CTHDFLEVRNGSDS-SSPLF-----GTYCGTLL---PDPIFSRNNKLYLRFKTDSATSN-----------------RGYEIVWTSSPSGCGGT--LYGDS----GSFTSPGYPGTYPNNTDCEWAIIAPAGRPVTVTFYFISIDDPG-DCVQNYLILYDGPDANSPSFG-PYCGADTNIAPFVASSHRVFIKF 3603          
BLAST of Cubilin vs. TrEMBL
Match: A0A267FHN8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029467g1 PE=4 SV=1)

HSP 1 Score: 454.136 bits (1167), Expect = 2.754e-137
Identity = 285/833 (34.21%), Postives = 438/833 (52.58%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIA---PINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-----------HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITG-DFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKIT--NEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNK-CSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIIC----GTDYREIKEITCK--GPLVLLRLNTSNAFSSGIG--GFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL----YPSNTTCQYDIIGNN-NHRIRIYFQEFSLSE---DGVKRQKYHSLKNS--TCEGDFVRV--IQKIPKGPIISQPIE--TSFLCGSSVPGPLISDSRSNSISLTFISD---------SVQSHSGFYAQYDFIPIQDII-NHKCGENIISEIRGGNITSNRYPR-EYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFIS-TSNTVHLEFITSPKAYGQKGFKLIWSEILQ-RLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQ-----------GNIFKPLVDDSDEEHTCPVSSSYNLLH 2831
            SP +P+ YP ++RC+Y+ + +S EKV ++F  FN+EGL P C KDFLD++I++K   +++     LGRFCGHT+D +P  +VS H+++V+DFYSD NTQ+ YN D HM +LGF   + F+  A   P +        C + I S  EEG + S TYPG+YP +++C Y+      +R+RL+F DLDL            H  D C  D +  Y+   +   I G  FCG +P L I S+ + L + FI+G   + R+R  S D        +Q++GF + Y  S ++++I   + + K H+ GTECD  I+S  ++   L  P  PVR     +C  FL G+HNR K E   ++          + + C + ++S Y          ++ Q L +   PD   C     +     K I+ +  GP + L L T + FS+     GFV+ Y F  DYGI G  +   +C F Y+ S +  G+ NSP FN      YP+N TC    I +  +  +RI F  F + +   + +   K H    S  TC GD V +  I  +P G   ++P +   S  CG+S+PGP +S   +  + + F+S            ++ +GF  +YDF   + ++ NH CG  IIS   GG I   R P+ ++ S++IC+W +      N++ + F +F  EGS +SC+ +++RIY GDS   SSE+CG+D++IPAF   T   V L  IT+  + G +G K  W+E+L     +G CPGF C +TKHCI   LEC+ +P+CGT +  +            N  +   D+SDE+  C   ++Y + H
Sbjct:   80 SPGWPKHYPEDLRCRYKLIGRSDEKVRLDFVEFNVEGLGPLCKKDFLDVHIQLKEANASVETTPLLGRFCGHTIDAIPRTIVSQHSVLVMDFYSDKNTQRVYNNDMHMRVLGFKAKYTFVPKAKYEPGHRILGSTNECSYLI-SSPEEGTLLSATYPGLYPDNMHCVYIFQAKPNQRVRLVFEDLDLYEIAGESIEQSVHVIDSCPVDVIRFYNSREQRQQIQGD-FCGSRPNLTIFSSGSELRLDFISGVGRVSRTRDLSSDSESAE---IQRRGFRLKYTMSDEFLRIDSPSALMKYHLNGTECDFLIESQGRSQEQLFFP--PVR--PGTMCRIFLQGVHNRQKTEVVQVELNRFVRNSNSEKRACQSATISAY----------LKGQGL-MNSRPDSRFCQLQDDSAASTAKPISLRSEGPQMFLELRTGSEFSNSDSSKGFVLRYRFITDYGIPGVPLSEDICQFTYHSSQSSRGLTNSPLFNSRTKAHYPNNITCLLRFIADRPDELVRIRFTHFYVEDFYVESLNNDKRHHSTGSYVTCVGDRVELFDIYDVPNG---TEPRKDRVSTYCGTSIPGPYVSHLDTRELQVRFVSTWDKQPHEQYGRRTATGFQIEYDFPSKKSLMPNHYCGGKIISPKHGGIIKIPRDPKAQHASDVICEWKIHPNRPENKVFVQFPEFHLEGSTKSCSMAVVRIYRGDSHIPSSEICGSDNSIPAFYGETGQHVRLRLITTRGSRGGRGLKFAWTEVLNIESANGICPGFRCNRTKHCIDHSLECNRLPNCGTVVSNKVAENISGWNRWRNYSEYEADNSDEDMNCLKEATYQMFH 889          

HSP 2 Score: 64.3142 bits (155), Expect = 1.936e-6
Identity = 56/212 (26.42%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  954 EEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------DGDTESSPIIGQPFCGEK----PKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGT--ECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNI 1553
            E+ ++TSP +P  YP  L C Y L+G   E++RL F + ++      C +D + ++      +   E++P++G+ FCG      P+  I+S  ++L++ F +    +R        +  N   ++  GF   Y F    V        + I+G+  EC   I S E+  G L S  YP   P N  C Y      N    +   L F+ L++
Sbjct:   74 EDEFVTSPGWPKHYPEDLRCRYKLIGRSDEKVRLDFVEFNVEGLGPLCKKDFLDVHIQLKEANASVETTPLLGR-FCGHTIDAIPR-TIVSQHSVLVMDFYSDKNTQR--------VYNNDMHMRVLGFKAKYTF----VPKAKYEPGHRILGSTNECSYLISSPEE--GTLLSATYPGLYPDNMHCVYIFQAKPN----QRVRLVFEDLDL 265          
BLAST of Cubilin vs. TrEMBL
Match: A0A267GBW1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029467g2 PE=4 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 5.859e-137
Identity = 282/831 (33.94%), Postives = 434/831 (52.23%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIA---PINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-----------HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITG-DFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKIT--NEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNK-CSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIIC------GTDYREIKEITCKGPLVLLRLNTSNAFSSGIG--GFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL----YPSNTTCQYDIIGNN-NHRIRIYFQEFSLSE---DGVKRQKYHSLKNS--TCEGDFVRVIQKIPKGPIISQPIE--TSFLCGSSVPGPLISDSRSNSISLTFISD---------SVQSHSGFYAQYDFIPIQDII-NHKCGENIISEIRGGNITSNRYPR-EYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFIS-TSNTVHLEFITSPKAYGQKGFKLIWSEILQ-RLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQ-----------GNIFKPLVDDSDEEHTCPVSSSYNLLH 2831
            SP +P+ YP ++RC+Y+ + +S EKV ++F  FN+EGL P C KDFLD++I++K   +++     LGRFCGHT+D +P  +VS H+++V+DFYSD NTQ+ YN D HM +LGF   + F+  A   P +        C + I S  EEG + S TYPG+YP +++C Y+      +R+RL+F DLDL            H  D C  D +  Y+   +   I G  FCG +P L I S+ + L + FI+G   + R+R  S D        +Q++GF + Y  S ++++I   + + K H+ GTECD  I+S  ++   L  P  PVR     +C  FL G+HNR K E   ++          + + C + ++S Y          ++ Q L +   PD   C           +   +  +GP + L L T + FS+     GFV+ Y F  DYGI G  +   +C F Y+ S +  G+ NSP FN      YP+N TC    I +  +  +RI F  F + +   + +   K H    S  TC GD V +   I   P  ++P +   S  CG+S+PGP +S   +  + + F+S            ++ +GF  +YDF   + ++ NH CG  IIS   GG I   R P+ ++ S++IC+W +      N++ + F +F  EGS +SC+ +++RIY GDS   SSE+CG+D++IPAF   T   V L  IT+  + G +G K  W+E+L     +G CPGF C +TKHCI   LEC+ +P+CGT +  +            N  +   D+SDE+  C   ++Y + H
Sbjct:   80 SPGWPKHYPEDLRCRYKLIGRSDEKVRLDFVEFNVEGLGPLCKKDFLDVHIQLKEANASVETTPLLGRFCGHTIDAIPRTIVSQHSVLVMDFYSDKNTQRVYNNDMHMRVLGFKAKYTFVPKAKYEPGHRILGSANECSYLI-SSPEEGTVLSATYPGLYPDNMHCVYIFQAKPNQRVRLVFEDLDLYEIAGESIEQSVHVIDSCPVDVIRFYNSREQRQQIQGD-FCGSRPNLTIFSSGSELRLDFISGVGRVSRTRDLSSDSESAE---IQRRGFRLKYTMSDEFLRIDSPSALMKYHLNGTECDFLIESQGRSQEQLFFP--PVR--PGTMCRIFLQGVHNRQKTEVVQVELNRFVRDSNSEKRACQSATISAY----------LKGQGL-MNSRPDSRFCQLQDDSAASTAQPISLRSEGPQMFLELRTGSEFSNSDSSKGFVLRYRFITDYGIPGVPLSEDICQFTYHSSQSSRGLTNSPLFNSRTKAHYPNNITCLLRFIADRPDELVRIRFTHFYVEDFYVESLNNDKRHHSTGSYVTCVGDRVELFD-IYDVPNRTEPRKDRVSTYCGTSIPGPYVSHLDTRELQVRFVSTWDKQPHEQYGRRTATGFQIEYDFPSKKSLMPNHYCGGKIISPKHGGIIKIPRDPKAQHASDVICEWKIHPNRPENKVFVQFPEFHLEGSTKSCSMAVVRIYRGDSHIPSSEICGSDNSIPAFYGETGQHVRLRLITTRGSRGGRGLKFAWTEVLNIESANGICPGFRCNRTKHCIDHSLECNRLPNCGTVVSNKVAENISGWNRWRNYSEYEADNSDEDMNCLKEATYQMFH 889          

HSP 2 Score: 63.1586 bits (152), Expect = 4.483e-6
Identity = 55/212 (25.94%), Postives = 95/212 (44.81%), Query Frame = 3
Query:  954 EEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------DGDTESSPIIGQPFCGEK----PKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGT--ECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNI 1553
            E+ ++TSP +P  YP  L C Y L+G   E++RL F + ++      C +D + ++      +   E++P++G+ FCG      P+  I+S  ++L++ F +    +R        +  N   ++  GF   Y F    V        + I+G+  EC   I S E+  G + S  YP   P N  C Y      N    +   L F+ L++
Sbjct:   74 EDEFVTSPGWPKHYPEDLRCRYKLIGRSDEKVRLDFVEFNVEGLGPLCKKDFLDVHIQLKEANASVETTPLLGR-FCGHTIDAIPR-TIVSQHSVLVMDFYSDKNTQR--------VYNNDMHMRVLGFKAKYTF----VPKAKYEPGHRILGSANECSYLISSPEE--GTVLSATYPGLYPDNMHCVYIFQAKPN----QRVRLVFEDLDL 265          
BLAST of Cubilin vs. TrEMBL
Match: A0A267GY95 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012127g3 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 1.891e-134
Identity = 313/889 (35.21%), Postives = 466/889 (52.42%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGL---LGFNGTFKFIEIA---PINSTKEQKESCHFYIDSKKE--EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-----------NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITG-DFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTL---NIPPTPDNKCS--TGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIIC----------GTDYREIKEITCKGPLVLLRLNTSNAFSSGIG-GFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQL----YPSNTTCQYDIIGNN-NHRIRI-----YFQEFSLSEDGVKRQKYHSLKNST-CEGDFVRVIQKI--PK--GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISD---------SVQSHSGFYAQYDFIPIQDIINHK---CGENIISEIRGGNITSNRYPRE-YRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD-GSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIF-----------KPLVDDSDEE------------HTCPVSSSYNLLHXXXXXXXXXXXXXXXXXXXXXKEHRKQQNK 2921
            SP +P+ YP + RC+Y+FVA   EKV +NF  FN+EGL P C KDFLD+Y E++   ++L ++  LGRFCGH+L  VP  VVSLH+++VLDFY+D NTQ+ YN D+HM +   LGF   + F+  A   P         +C F +++     +G I SP YPG+YP +L+C+YL  G   +R+R+ F++LD+            H    C  D V IYD D     I    FCG+K  L ++ST + + + FITG   I RSR  +  ++      LQ+KGF + Y  S +Y++I   +  NH+ GTECD  I+S+  +    + P   VR    +LC  F  G+HN  + E ++L+   +         D +C    G L +Y+          R Q       PD   C          G    E +E    GP + L  +T +  +  +   F+I Y F  D+GI G       C F Y   + K+ G  NSPFFN +    YP NTTC Y  +    N R+RI     Y ++F + E G   +K+H++ +   C GD V + ++   PK  G    + I T   CG+S+PGP ++   +  + + F S            ++ SGF  +YDF     + ++K   CG NI S++ GG I   +  +  Y+ +LIC+W +      N++ + F +F  EGS +SC+ ++LR+Y+GDS   SSE+CG D+ IPAF  S S  V +  +T+  + G KGFK  W+E L+  P  G CPGF+C +T+HCI  +LEC+ +P+CG+        F           K   D+SDEE             T P  ++Y LLHVG+G+I+T+L+LI +V +VLY+EHRK  +K
Sbjct:   72 SPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLGPSCEKDFLDVYTELEQENASLLHSPLLGRFCGHSLASVPRTVVSLHSVLVLDFYTDGNTQKVYNNDNHMAMEVALGFKAQYSFVPKADYEPGPRLLAYSGNCSFLMETSSVDIDGVINSPGYPGLYPDNLHCNYLFRGFGNQRVRVHFKELDIYEIHAETFGEAGHTISSCPIDSVRIYDSDQRLRQIYSD-FCGQKAGLTVVSTGSRMRLEFITGAGRIPRSRTVTSADLGE----LQRKGFRLRYNISSEYLRIDRGLRSNHLTGTECDFLIESAGNSHDRFQFPS--VR--GGRLCRVFFQGVHNLQRSEMSLLRIDGMARITAGRRQDGRCPGLAGHLKVYA----------RGQG--ADAVPDADFCQAVGEASDGRGGSLGEPQEFRSSGPQLFLVFDTRHLETWQLAPAFIINYRFVPDFGIPGHQPNEDDCAFEYVSGADKAHGRTNSPFFNPVTKAHYPHNTTCSYRFVATEPNQRVRIRFTHFYVEDFFIEELG-NDKKHHTVGSYVPCAGDRVEIYERYESPKNSGRFRLEKILT--YCGTSIPGPYVTQFDTQELLVLFHSTWDKWAHPEYGKRTASGFQIEYDFPVRTSLFSNKFDVCGGNISSDMHGGVIQVPKNEQATYQPDLICEWHIYPSQPGNQVFVQFPEFHLEGSTKSCSMAVLRMYNGDSHVPSSEVCGADNGIPAFYGSGSEHVRIRLLTTAGSRGGKGFKFSWTEALKIHPGTGHCPGFQCKRTRHCIDHRLECNRLPNCGSRAVEYSADFDKDRLRWKNHTKHERDNSDEEINSEKCHSIYAKATGPTEAAYQLLHVGIGVIVTVLLLIAIVAFVLYREHRKSSSK 936          

HSP 2 Score: 71.633 bits (174), Expect = 1.093e-8
Identity = 68/270 (25.19%), Postives = 113/270 (41.85%), Query Frame = 3
Query: 1890 INSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK--GPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISD-------------SVQSHSGFYAQYDFIPIQD------IINHKCGENIISEIRG----GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDF---------VTEGSH--QSCANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITS 2582
            + SP + + YP +  C+Y  +   N ++R+ F  F++   G            +CE DF+ V  ++ +    ++  P+   F CG S+   P    S  + + L F +D             +++   GF AQY F+P  D      ++ +    + + E       G I S  YP  Y  NL C +  + F  + R+ +HF +            E  H   SC    +RIYD D    Q  S+ CG  + +   +ST + + LEFIT 
Sbjct:   70 VTSPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLG-----------PSCEKDFLDVYTELEQENASLLHSPLLGRF-CGHSLASVPRTVVSLHSVLVLDFYTDGNTQKVYNNDNHMAMEVALGFKAQYSFVPKADYEPGPRLLAYSGNCSFLMETSSVDIDGVINSPGYPGLYPDNLHCNYLFRGF-GNQRVRVHFKELDIYEIHAETFGEAGHTISSCPIDSVRIYDSDQRLRQIYSDFCGQKAGL-TVVSTGSRMRLEFITG 325          

HSP 3 Score: 66.2402 bits (160), Expect = 6.044e-7
Identity = 130/596 (21.81%), Postives = 212/596 (35.57%), Query Frame = 3
Query:  942 DSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------DGDTESSPIIGQPFCGEK----PKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRF--SVDYVKITNEMEKNHIIGTECDMWIK-SSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNR------NKMETAVLKFQTLNIPPTPDNKCSTGSLSIYS----IRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDI--IGNNNHRI-----------RIYFQ--------EFSLSE-DGVKRQKYHSLKNSTCEG--DFVRVIQK------IPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFIS---DSVQSHSGFYAQYDFIPIQDIINHKCGEN--IISEIRGGNITSNR---------YPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTE----------------GSHQSCANSILRIYD 2480
            D   EE ++TSP +P  YP    C Y  V  + E++RL F   ++      C +D + +Y      +     SP++G+ FCG      P+  ++S  ++L++ F T D   +    + + + M   L    GF   Y F    DY      +  +      C   ++ SS    G++ SPGYP   P N  C Y   G  N+       +++   +  +T        + C   S+ IY     +R  +     +   L +      +  G+  R ++ IT  G +   R  TS                       G++   G     YNISS    +      N L  + T C + I   GN++ R            R++FQ        E SL   DG+ R      ++  C G    ++V  +      +P         E S   G S+  P    S    + L F +   ++ Q    F   Y F+P   I  H+  E+      + G +    R             Y  N  C +   A + + R+ I F  F  E                GS+  CA   + IY+
Sbjct:   62 DCPDEETFVTSPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLGPSCEKDFLDVYTELEQENASLLHSPLLGR-FCGHSLASVPR-TVVSLHSVLVLDFYT-DGNTQKVYNNDNHMAMEVAL----GFKAQYSFVPKADYEPGPRLLAYS----GNCSFLMETSSVDIDGVINSPGYPGLYPDNLHCNYLFRGFGNQRVRVHFKELDIYEIHAETFGEAGHTISSCPIDSVRIYDSDQRLRQIYSDFCGQKAGLTV------VSTGSRMR-LEFITGAGRIPRSRTVTSADL--------------------GELQRKGF-RLRYNISSEYLRIDRGLRSNHL--TGTECDFLIESAGNSHDRFQFPSVRGGRLCRVFFQGVHNLQRSEMSLLRIDGMARITAGRRQDGRCPGLAGHLKVYARGQGADAVPDADFCQAVGEASDGRGGSLGEPQEFRSSGPQLFLVFDTRHLETWQLAPAFIINYRFVPDFGIPGHQPNEDDCAFEYVSGADKAHGRTNSPFFNPVTKAHYPHNTTCSYRFVATEPNQRVRIRFTHFYVEDFFIEELGNDKKHHTVGSYVPCAGDRVEIYE 616          
BLAST of Cubilin vs. TrEMBL
Match: A0A267F4R1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012127g1 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 1.486e-133
Identity = 312/888 (35.14%), Postives = 460/888 (51.80%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGL---LGFNGTFKFIEIA---PINSTKEQKESCHFYIDSKKE--EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-----------NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-GDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTL---NIPPTPDNKCS--TGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIIC----------GTDYREIKEITCKGPLVLLRLNTSNAFSSGIG-GFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQL----YPSNTTCQYDIIGNN-NHRIRIYFQEFSLS----EDGVKRQKYHSLKNST-CEGDFVRVIQKI--PK--GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISD---------SVQSHSGFYAQYDFIPIQDIINHK---CGENIISEIRGGNITSNRYPRE-YRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFIST-SNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD-GSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIF-----------KPLVDDSDEE------------HTCPVSSSYNLLHXXXXXXXXXXXXXXXXXXXXXKEHRKQQNK 2921
            SP +P+ YP + RC+Y+FVA   EKV +NF  FN+EGL P C KDFLD+Y E++   ++L ++  LGRFCGH L  VP  VVSLH+++VLDFY+D NTQ+ YN D+HM +   LGF   + F+  A   P         +C F +++     +G I SP YPG+YP +L+C+YL  G   +R+RL F +LD+            H    C  D V IYD D     I    FCG+K  L ++ST + + + FIT    I RSR  +  ++      LQ+KGF + Y  S +Y++I   +  NH+ GTECD  I+S+ K+    + P   VR    +LC  F  G+HN  + E  +L+   +         D +C    G L +Y+          R Q       PD   C          G    E +E    GP + L  +T +  +  +   F+I Y F  D+GI G       C F Y   + K+ G  NSPFFN +    YP NTTC Y  +    N R+RI F  F +     E+    +K+H++ +   C GD V + ++   PK  G    + I T   CG+S+PGP ++   +  + + F S            ++ SGF  +YDF     + ++K   CG NI S++ GG I   +  +  Y+ +LIC+W +      N++ + F +F  EGS +SC+ ++LR+Y+GDS   SSE+CG D+ IPAF    S  V +  +T+  + G KGFK  W+E L+  P  G CPGF+C +T+HCI  +LEC+ +P+CG+        F           K   D+SDEE             T P  ++Y LLHVG+G+I+T+L+LI +V +VLY+EHRK  +K
Sbjct:   72 SPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLGPSCEKDFLDVYTELEQENASLLHSPLLGRFCGHILASVPRTVVSLHSVLVLDFYTDGNTQKVYNNDNHMAMEAALGFKAQYSFVPKADYEPGPRLLAYSGNCSFLMETSSADIDGVINSPGYPGLYPDNLHCNYLFRGFGNQRVRLQFEELDIYEIHAETFGEAGHTISSCPIDSVRIYDSDQRLRQIHSD-FCGQKAGLTVVSTGSRMRLEFITSAGRIPRSRTVTSADLGE----LQRKGFRLRYNISSEYLRIDRGLRSNHLTGTECDFLIESAGKSHDRFQFPS--VR--GGRLCRVFFQGVHNLQRSEMTLLRIDGMAHITAGRRQDGRCPGLAGHLKVYA----------RGQG--ADAVPDADFCQAVGEASDGRGGSLGEPQEFRSSGPQLFLVFDTRHLETWQLAPAFIINYRFVPDFGIPGHQPNEDDCAFEYVSGADKAHGRTNSPFFNPVTKAHYPHNTTCSYRFVATEPNQRVRIRFTHFYVEDFFIEELGNDKKHHTVGSYVPCAGDRVEIYERYESPKNSGRFRLEKILT--YCGTSIPGPYVTQFDTQELLVLFHSTWDKWAHPEYDKRTASGFQIEYDFPVRTSLFSNKFDVCGGNISSDMHGGVIQVPKNEQATYQPDLICEWHIYPSQPGNQVFVQFPEFHLEGSTKSCSMAVLRMYNGDSHVPSSEVCGADNGIPAFYGRGSEHVRIRLLTTAGSRGGKGFKFSWTEALKIHPGTGHCPGFQCKRTRHCIDHRLECNRLPNCGSRAVEYSADFDKDRLRWKNHTKHERDNSDEEINSEKCHSIYAKATGPTEAAYQLLHVGIGVIVTVLLLIAIVAFVLYREHRKSSSK 936          

HSP 2 Score: 71.633 bits (174), Expect = 1.112e-8
Identity = 69/272 (25.37%), Postives = 117/272 (43.01%), Query Frame = 3
Query: 1890 INSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK--GPIISQPIETSFLCG---SSVPGPLISDSRSNSISLTFISD-------------SVQSHSGFYAQYDFIPIQD------IINHKCGENIISEIRG----GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDF---------VTEGSH--QSCANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITS 2582
            + SP + + YP +  C+Y  +   N ++R+ F  F++   G            +CE DF+ V  ++ +    ++  P+   F CG   +SVP  ++  S  + + L F +D             ++++  GF AQY F+P  D      ++ +    + + E       G I S  YP  Y  NL C +  + F  + R+ + F +            E  H   SC    +RIYD D    Q  S+ CG  + +   +ST + + LEFITS
Sbjct:   70 VTSPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLG-----------PSCEKDFLDVYTELEQENASLLHSPLLGRF-CGHILASVPRTVV--SLHSVLVLDFYTDGNTQKVYNNDNHMAMEAALGFKAQYSFVPKADYEPGPRLLAYSGNCSFLMETSSADIDGVINSPGYPGLYPDNLHCNYLFRGF-GNQRVRLQFEELDIYEIHAETFGEAGHTISSCPIDSVRIYDSDQRLRQIHSDFCGQKAGL-TVVSTGSRMRLEFITS 325          

HSP 3 Score: 67.781 bits (164), Expect = 2.041e-7
Identity = 58/217 (26.73%), Postives = 94/217 (43.32%), Query Frame = 3
Query:  942 DSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------DGDTESSPIIGQPFCG----EKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRF--SVDYVKITNEMEKNHIIGTECDMWIK-SSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNI 1553
            D   EE ++TSP +P  YP    C Y  V  + E++RL F   ++      C +D + +Y      +     SP++G+ FCG      P+  ++S  ++L++ F T D   +    + + + M   L    GF   Y F    DY      +  +      C   ++ SS    G++ SPGYP   P N  C Y   G  N    +   L+F+ L+I
Sbjct:   62 DCPDEETFVTSPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLGPSCEKDFLDVYTELEQENASLLHSPLLGR-FCGHILASVPR-TVVSLHSVLVLDFYT-DGNTQKVYNNDNHMAMEAAL----GFKAQYSFVPKADYEPGPRLLAYS----GNCSFLMETSSADIDGVINSPGYPGLYPDNLHCNYLFRGFGN----QRVRLQFEELDI 263          
BLAST of Cubilin vs. TrEMBL
Match: A0A1I8JCS6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 9.306e-133
Identity = 295/858 (34.38%), Postives = 434/858 (50.58%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGL---LGFNGTFKFIEIA---PINSTKEQKESCHFYIDSKKE--EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDL-----------NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-GDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTL---NIPPTPDNKCS--TGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIIC----------GTDYREIKEITCKGPLVLLRLNTSNAFSSGIG-GFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKS-GVINSPFFNQL----YPSNTTCQYDIIGNN-NHRIRIYFQEFSLS----EDGVKRQKYHSLKNST-CEGDFVRVIQKI--PK--GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISD---------SVQSHSGFYAQYDFIPIQDIINHK---CGENIISEIRGGNITSNRYPRE-YRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFIST-SNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD-GSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIF-----------KPLVDDSDEE------------HTCPVSSSYNLLH 2831
            SP +P+ YP + RC+Y+FVA   EKV +NF  FN+EGL P C KDFLD+Y E++   ++L ++  LGRFCGH L  VP  VVSLH+++VLDFY+D NTQ+ YN D+HM +   LGF   + F+  A   P         +C F +++     +G I SP YPG+YP +L+C+YL  G   +R+RL F +LD+            H    C  D V IYD D     I    FCG+K  L ++ST + + + FIT    I RSR  +  ++      LQ+KGF + Y  S +Y++I   +  NH+ GTECD  I+S+ K+    + P   VR    +LC  F  G+HN  + E  +L+   +         D +C    G L +Y+          R Q       PD   C          G    E +E    GP + L  +T +  +  +   F+I Y F  D+GI G       C F Y   + K+ G  NSPFFN +    YP NTTC Y  +    N R+RI F  F +     E+    +K+H++ +   C GD V + ++   PK  G    + I T   CG+S+PGP ++   +  + + F S            ++ SGF  +YDF     + ++K   CG NI S++ GG I   +  +  Y+ +LIC+W +      N++ + F +F  EGS +SC+ ++LR+Y+GDS   SSE+CG D+ IPAF    S  V +  +T+  + G KGFK  W+E L+  P  G CPGF+C +T+HCI  +LEC+ +P+CG+        F           K   D+SDEE             T P  ++Y LLH
Sbjct:   99 SPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLGPSCEKDFLDVYTELEQENASLLHSPLLGRFCGHILASVPRTVVSLHSVLVLDFYTDGNTQKVYNNDNHMAMEAALGFKAQYSFVPKADYEPGPRLLAYSGNCSFLMETSSADIDGVINSPGYPGLYPDNLHCNYLFRGFGNQRVRLQFEELDIYEIHAETFGEAGHTISSCPIDSVRIYDSDQRLRQIHSD-FCGQKAGLTVVSTGSRMRLEFITSAGRIPRSRTVTSADLGE----LQRKGFRLRYNISSEYLRIDRGLRSNHLTGTECDFLIESAGKSHDRFQFPS--VR--GGRLCRVFFQGVHNLQRSEMTLLRIDGMAHITAGRRQDGRCPGLAGHLKVYA----------RGQG--ADAVPDADFCQAVGEASDGRGGSLGEPQEFRSSGPQLFLVFDTRHLETWQLAPAFIINYRFVPDFGIPGHQPNEDDCAFEYVSGADKAHGRTNSPFFNPVTKAHYPHNTTCSYRFVATEPNQRVRIRFTHFYVEDFFIEELGNDKKHHTVGSYVPCAGDRVEIYERYESPKNSGRFRLEKILT--YCGTSIPGPYVTQFDTQELLVLFHSTWDKWAHPEYDKRTASGFQIEYDFPVRTSLFSNKFDVCGGNISSDMHGGVIQVPKNEQATYQPDLICEWHIYPSQPGNQVFVQFPEFHLEGSTKSCSMAVLRMYNGDSHVPSSEVCGADNGIPAFYGRGSEHVRIRLLTTAGSRGGKGFKFSWTEALKIHPGTGHCPGFQCKRTRHCIDHRLECNRLPNCGSRAVEYSADFDKDRLRWKNHTKHERDNSDEEINSEKCHSIYAKATGPTEAAYQLLH 933          

HSP 2 Score: 72.4034 bits (176), Expect = 8.010e-9
Identity = 69/272 (25.37%), Postives = 117/272 (43.01%), Query Frame = 3
Query: 1890 INSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK--GPIISQPIETSFLCG---SSVPGPLISDSRSNSISLTFISD-------------SVQSHSGFYAQYDFIPIQD------IINHKCGENIISEIRG----GNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDF---------VTEGSH--QSCANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITS 2582
            + SP + + YP +  C+Y  +   N ++R+ F  F++   G            +CE DF+ V  ++ +    ++  P+   F CG   +SVP  ++  S  + + L F +D             ++++  GF AQY F+P  D      ++ +    + + E       G I S  YP  Y  NL C +  + F  + R+ + F +            E  H   SC    +RIYD D    Q  S+ CG  + +   +ST + + LEFITS
Sbjct:   97 VTSPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLG-----------PSCEKDFLDVYTELEQENASLLHSPLLGRF-CGHILASVPRTVV--SLHSVLVLDFYTDGNTQKVYNNDNHMAMEAALGFKAQYSFVPKADYEPGPRLLAYSGNCSFLMETSSADIDGVINSPGYPGLYPDNLHCNYLFRGF-GNQRVRLQFEELDIYEIHAETFGEAGHTISSCPIDSVRIYDSDQRLRQIHSDFCGQKAGL-TVVSTGSRMRLEFITS 352          

HSP 3 Score: 68.1662 bits (165), Expect = 1.486e-7
Identity = 58/217 (26.73%), Postives = 94/217 (43.32%), Query Frame = 3
Query:  942 DSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------DGDTESSPIIGQPFCG----EKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRF--SVDYVKITNEMEKNHIIGTECDMWIK-SSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNI 1553
            D   EE ++TSP +P  YP    C Y  V  + E++RL F   ++      C +D + +Y      +     SP++G+ FCG      P+  ++S  ++L++ F T D   +    + + + M   L    GF   Y F    DY      +  +      C   ++ SS    G++ SPGYP   P N  C Y   G  N    +   L+F+ L+I
Sbjct:   89 DCPDEETFVTSPGWPRPYPEDARCRYKFVAGRNEKVRLNFLAFNVEGLGPSCEKDFLDVYTELEQENASLLHSPLLGR-FCGHILASVPR-TVVSLHSVLVLDFYT-DGNTQKVYNNDNHMAMEAAL----GFKAQYSFVPKADYEPGPRLLAYS----GNCSFLMETSSADIDGVINSPGYPGLYPDNLHCNYLFRGFGN----QRVRLQFEELDI 290          
BLAST of Cubilin vs. Ensembl Cavefish
Match: cubn (cubilin [Source:NCBI gene;Acc:103044622])

HSP 1 Score: 149.058 bits (375), Expect = 1.524e-35
Identity = 172/709 (24.26%), Postives = 281/709 (39.63%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYS----IRPFFVKL-EIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            F SPN+P  Y PN  C +     +   + +NFE F++E     C  D+L +Y      +    N + L + CG   + +PN + S  + + +   +D            +   GF  ++                +C   + + K  G I S  +P  YP +  CS+ +       I   F   DL   +  CI D++ +Y+G  E +P+IG+ FCG  P     +T + L + F        S L            +   GF +++                +  G   D+        SG   SP YP + P N+ C +++      +   +  +     +I   P   C    L +Y       P   +L   RP     P++P Q+            +  G  V +R   S+ + SG G    +   +   G  G ++ P             SG I+SP +   YP+N  C + I  +  HRI   F +  +              +S+C+ D+V V      GP  S P+    +CG SVP P+ S    N I + F SD   +H GF A++         +  CG  I+++  GG I S  YP  Y +N  C W + A +  N + + F DF  E  + +C++  + I DGD+  A S    CG D   P   S SN + + F+T   +  +KGF+  ++
Sbjct: 1185 FTSPNYPLPYHPNAECYWHIKVNAGSSIQLNFEDFHLESST-DCYYDYLAVY------DGNSTNDRQLAKLCG---NQIPNPITSTRDQMYVKLRTD----------SIISAGGFVASYT--------------SNCSGIVIANKTSGVIESQNFPNNYPFNARCSWTIQTTMGNTINYTFTAFDLEGLSPSCIYDYMLLYNGPNEEAPLIGR-FCGNTPPPAGATTSSSLHVIF-------NSDLS-----------ISLPGFRMLW----------------YQNGCGGDL-----SGPSGNFTSPDYPNKYPDNRECVWYI----QTSPGSSVTITIHEFDIESHP--SCDFDLLEVYGGPDLSSPRLAQLCTTRP-----PNNPLQV------------SSTGNTVTVRFK-SDEYISGRGFSASWQ--ETQGGCGGPIIAP-------------SGEIHSPQYPNNYPNNVDCSWVITVDQGHRILFNFTDVDIE------------SHSSCQWDYVDVHD----GPGDSSPLLAK-VCGFSVPAPIYS--TQNVIYVRFRSDISGNHRGFKAEF---------SEACGSTIMADDVGGAIASPNYPYPYPNNQNCNWIIIAQEPFNHVTLSFTDFELEMINSNCSHDAVEILDGDNSDAPSVGRYCGNDVPHPV-TSFSNALVVNFVTD-ASVTRKGFRATYT 1750          

HSP 2 Score: 137.887 bits (346), Expect = 4.122e-32
Identity = 171/711 (24.05%), Postives = 272/711 (38.26%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTS--NAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFI----PIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
             SP +P  YP N+ C +        +++ NF   +IE     C  D++D++      +    ++  L + CG +   VP  + S  N+I + F SDI+        +H G       FK           E  E+C   I +    G I SP YP  YP++ NC+++++  +    + L F D +L   N +C  D V I DGD   +P +G+ +CG      + S  N L++ F+T   + R                  KGF   Y  S         ME                   SG   SP YP   P N  C +                      I  +P N+          ++  FV  E++              C  DY EI+E    G LV      S  + ++S I G V++  F  D  + G        H   N  +  SG I SP + + YP N   ++ I  + +  I+I F +  + +  +    Y  L              KI  GP +   +     CG  +PG  +  S  ++++L F SD+V    GF  ++  I    P+  I    CG  ++       + S  +P EY  N  C W +++ DS+  + + F D   E    SC    L I DG++  +   + LCG    +P  I T+        TS  +   +GF   +S+
Sbjct: 1535 HSPQYPNNYPNNVDCSWVITVDQGHRILFNFTDVDIESH-SSCQWDYVDVH------DGPGDSSPLLAKVCGFS---VPAPIYSTQNVIYVRFRSDIS-------GNHRG-------FK----------AEFSEACGSTIMADDVGGAIASPNYPYPYPNNQNCNWIIIAQEPFNHVTLSFTDFELEMINSNCSHDAVEILDGDNSDAPSVGR-YCGNDVPHPVTSFSNALVVNFVTDASVTR------------------KGFRATYTASTSGCGGNLHME-------------------SGAFNSPNYPDAYPPNIECVW---------------------TIISSPGNR----------LQLSFVLFELQ----------QSTGCNNDYLEIREGNSTGALVGRFCGNSLPSNYTSLI-GHVLWVKFVSDSSVSGAGFRATFSHLYGNDITGTSGQIASPLYPRTYPVNADYRWTITVSGDSYIQIRFLDIDIED--LYDCYYDQL--------------KIFDGPNV-HALPLGVFCGLLLPG--LVRSSGSTVTLEFKSDTVIGGRGFLVEWTAIQNSGPLPTISPGACGGALMPGDTPRFLFSPGWPNEYEPNQECTWVIRSPDSTVELNLLFLDIEDEA---SCLYDSLVIRDGETNLSPELARLCGRQ--LPGSIHTTRDSMFLRFTSDYSINGRGFNASYSK 2107          

HSP 3 Score: 130.568 bits (327), Expect = 7.530e-30
Identity = 173/697 (24.82%), Postives = 264/697 (37.88%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINF-EHFNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEE--GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYP-VRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNIS--------STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGD-SFQASSELCG-TDSAIPAFIST 2549
            +R +  SPN+PQ Y PN  C +  +  S  +V + F   F ++G    C+  D+L+L     +   +L      GR CG +   VP    +  N + + F SD + +              NG FK I        +    +C   I+ K  +  GYITSP YP  YP +++C ++++    E ++L F D  +   N  C  D++ I DG    + +I +  CG        ST + + +RF T                   + +  KGF   Y  +V              IG             SG ++SPGYP    P N  C ++L G           L +  LN+      + STG                               C  DY EI+E    G L+      S   S   G    Y  F  D    G +  PG     Y  S        +  SG I+SP +  LYP N  C++ I      R+ +   +  L + G            +C  D+V VI     G + + P    F CG SVP      S  N++++ F +DS  S+ GF A Y            CG  + +    GN TS  Y    Y ++L C+W ++  +  N  ++   D +    HQ+C    L    GD + +    +CG T   +P  +ST
Sbjct: 2116 DRGVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTFLTPFQVQGYGTACSTGDYLELRNGPDADAPSLG-----GRLCGTS---VPAVTQTTDNHLHVRFVSDASNEG-------------NG-FKLI-------FEAHSTACGGTIELKDGDPPGYITSPDYPSNYPQNIDCVWIIMVPNGESVQLDFEDFYI-EPNTQCAYDYLEIRDGVNSDTDLIAK-LCGNTKPSTQHSTASAMYLRFRTD------------------QSVTHKGFKAKYSIAV---------CGGTYIG------------QSGTIRSPGYPDSNYPDNSNCEWYLEGPTGH----YLTLSYSALNL------QSSTG-------------------------------CVNDYVEIREYNASGRLLGRHCGMSLPLSVDTGDSFAYVKFVSD----GSVNAPGF-SLSYEASVEECGGDLNAASGTISSPNYPNLYPHNRVCRWRITVPQGRRVTLTINDLRLEDHG------------SCSFDYVEVI----NGLVANSPRLQRF-CG-SVPAGTQVKSSGNTMTVVFATDSSVSNGGFNADYSSDEAA-----VCGGVLDTP---GNFTSPDYGIGNYSNSLNCEWLIQNPNHVNSSIVVLIDDMHLEHHQTCEWDYLEFRLGDENAELLGRICGQTVPEVPIVVST 2670          

HSP 4 Score: 129.413 bits (324), Expect = 1.783e-29
Identity = 167/711 (23.49%), Postives = 286/711 (40.23%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYI-DSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI-ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGN----ITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
             F SPN+P  YPPNI C +  ++    ++ ++F  F ++    GCN D    Y+E++   ST      +GRFCG++L    N+   + +++ + F SD +   +          GF  TF                  H Y  D     G I SP YP  YP + +  + +  +    I++ F D+D+    D C  D + I+DG    +  +G  FCG      + S+ + + + F                   +  ++  +GF       V++  I N      I    C   +   + T   L SPG+P     N+ CT+ +     R+   T  L    L+I    +++ S            +  L IR  +  L  SP+   +CG   R++      G +   R +             ++  F  DY I G+            +  T  GV++SP + Q Y  N  C + ++  +  R+ + F         +   +      +   GD++    ++  GP    P     LCG+SVP   ++ +  N + + F+SD+    +GF        I +  +  CG  I  E++ G+    ITS  YP  Y  N+ C W +    +   + + F DF  E + Q CA   L I DG +      ++LCG ++      ST++ ++L F T  ++   KGFK  +S
Sbjct: 1766 AFNSPNYPDAYPPNIECVWTIISSPGNRLQLSFVLFELQQST-GCNND----YLEIREGNST---GALVGRFCGNSLPS--NYTSLIGHVLWVKFVSDSSVSGA----------GFRATFS-----------------HLYGNDITGTSGQIASPLYPRTYPVNADYRWTITVSGDSYIQIRFLDIDIEDLYD-CYYDQLKIFDGPNVHALPLGV-FCGLLLPGLVRSSGSTVTLEF------------------KSDTVIGGRGF------LVEWTAIQNSGPLPTISPGACGGALMPGD-TPRFLFSPGWPNEYEPNQECTWVI-----RSPDSTVELNLLFLDI----EDEASC----------LYDSLVIRDGETNL--SPELARLCG---RQLP-----GSIHTTRDS-------------MFLRFTSDYSINGRGFNASYSKGCGGLLHTDRGVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTF---------LTPFQVQGYGTACSTGDYL----ELRNGPDADAPSLGGRLCGTSVPA--VTQTTDNHLHVRFVSDASNEGNGFKL------IFEAHSTACGGTI--ELKDGDPPGYITSPDYPSNYPQNIDCVW-IIMVPNGESVQLDFEDFYIEPNTQ-CAYDYLEIRDGVNSDTDLIAKLCG-NTKPSTQHSTASAMYLRFRTD-QSVTHKGFKAKYS 2343          

HSP 5 Score: 128.642 bits (322), Expect = 2.767e-29
Identity = 181/719 (25.17%), Postives = 279/719 (38.80%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE--CDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAF--ISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            SP  P  YP    C +         + ++F  FN+E     CN D++++Y    +L   L     LGR+CG +   VP  + S  N++ + F SD            +   GF+  +       +N+T +         + +   G +TSP YP  YPS   C Y ++     +I L F D +L     +C  D+V I DG  E+SP+IG+ +C  +P   ++S  NML I F + DF   +R                 GF+                   H  GT+  C   + +S    G   SP YP+    N  C + +      N   +  L F+  ++  + D  C    L++Y             ++L         +CG        IT     + ++L T +  S+  GGFV  YT                C  +  I++  SGVI S  F   YP N  C + I     + I   F  F L  +G+           +C  D++ +      GP    P+   F CG++   P    + S+S+ + F SD   S  GF   +          + CG ++      GN TS  YP +Y  N  C W ++    S+ + I  H+F  E SH SC   +L +Y G    +   ++LC T          ST NTV + F +     G +GF   W E       G C G
Sbjct:  952 SPGHPTDYPHGANCTWYISVAPGNIIRLSFTTFNLE-YHTNCNYDYVEIYDNGTALTGNL-----LGRYCGRS---VPPSLTSTDNLMTILFVSD----------SSLSTEGFSANY-----VSLNATTDCSA------EYRTPTGVLTSPNYPSNYPSTRECVYKIIVEINMQIMLNFTDFEL-EGGSNCPFDYVEIRDGGFETSPLIGR-YCSNQPPPIVISHSNMLWILFKS-DFTATAR-----------------GFSA------------------HWDGTQTGCGGTLTTS---VGSFTSPNYPLPYHPNAECYWHI----KVNAGSSIQLNFEDFHLESSTD--CYYDYLAVYDGN------STNDRQLAK-------LCGNQIP--NPITSTRDQMYVKLRTDSIISA--GGFVASYTSN--------------CSGIV-IANKTSGVIESQNFPNNYPFNARCSWTIQTTMGNTINYTFTAFDL--EGLS---------PSCIYDYMLLY----NGPNEEAPLIGRF-CGNTP--PPAGATTSSSLHVIFNSDLSISLPGFRMLW--------YQNGCGGDLSGP--SGNFTSPDYPNKYPDNRECVWYIQTSPGSS-VTITIHEFDIE-SHPSCDFDLLEVYGGPDLSSPRLAQLCTTRPPNNPLQVSSTGNTVTVRFKSDEYISG-RGFSASWQET-----QGGCGG 1525          

HSP 6 Score: 127.872 bits (320), Expect = 4.151e-29
Identity = 178/761 (23.39%), Postives = 296/761 (38.90%), Query Frame = 3
Query:  441 TNYVVYALDCDII-------YYSDKIGVNNRRM-----FQSPNFP-QKYPPNIRCKY--QFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIM-IHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGF 2666
            T  VV+A D  +        Y SD+  V    +     F SP++    Y  ++ C++  Q        +V+  +  ++E     C  D+L+  +  +       NA+ LGR CG T+  VP  VVS   + V            +  D+ +  LGF  T+ F +             C  Y     E G ++SP YP  YPS   C +LL   +   I L F   ++  ++  C  D VTIY+G +  SPIIGQ +CG      I S  N L + F+    + R                   GF  +  ++ D       +  +                 SG +KSP YP   P N  C++ +   H  N +E   + F +    P    +C +  + ++S                 P + +  +  T            P  ++     +  + G G    +YT                C   +   S  +G + SP +  LYP+++ C Y I   +   I + F+ F +  +            STC  D V++        +   P+ T  LCG+++PGP  +      + L F SD + + +GF A+Y  IP   + N             G+++S  +    Y  N+ C + +    S+NRI+ + F+ F  E S  +CA   + +YDG +  A    + CGT+   P   +TSN + + F T     G+ G++  + E L   P+  C G+
Sbjct: 2553 TMTVVFATDSSVSNGGFNADYSSDEAAVCGGVLDTPGNFTSPDYGIGNYSNSLNCEWLIQNPNHVNSSIVVLIDDMHLEHHQT-CEWDYLEFRLGDE-------NAELLGRICGQTVPEVP-IVVSTPQLWV-----------HFRSDESVVDLGFKVTYYFSD-------------CGGY--QTGEGGTVSSPGYPDSYPSPSRCVWLLEAPEGHTITLTFTYFEV-EEHSQCSWDSVTIYNGASAGSPIIGQ-YCGHSSPGTIQSGSNKLTVVFLADHSVSRG------------------GF--IATWTTDSSGCGGTIHAD-----------------SGTIKSPNYPQNFPANVECSWTIIA-HEGNHLE---MGFASDFQIPDSSGQCQSSYIKVWS----------------GPRAENDALLATGCGSTAPPAVIAPYNVIHARFQSTETVGKGFSSSFYT---------------RCGANF---SASAGRVVSPNYPDLYPASSNCDYLINAGDQTVIFLTFRTFQIEAE------------STCVYDGVKIYSGT---SVNGNPVAT--LCGNTIPGPFTT---FGPMLLNFYSDFIINDNGFLAEYTAIPCGGVFNGT----------SGSVSSPTHAISNYHHNINCTYHITV--SNNRIIELKFNSFHLEAS-STCAFDYVALYDGPNTLAPLLGKFCGTELP-PTLKTTSNDLFIVFKTDSSVTGE-GWRASYRETLG--PEQGCGGY 3164          

HSP 7 Score: 119.783 bits (299), Expect = 1.192e-26
Identity = 158/682 (23.17%), Postives = 261/682 (38.27%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKE--ITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSF--QASSELCG 2516
            Y+D  G+       SPN+P  Y  N +C Y       E V++NF H  +E    GC  D++++   +   +        +G++CG TL   P  ++S +N + + F SD +   +          GF   ++               SC   +      G I +P +P  YP +  C +++   +   + L F   D+   +  C  D+V + DG T SSP++G+ FCG +    + ST+  + I F T   +                     GF   Y  ++     T                       +G + SPG+P   P    CT+++  +   N +    L F T N+               Y     +  +EI      L  +     CG   R +     +    + +L ++ S+  + G     +      D   E +               T +GV+ SP +   YPS   C Y II   N +I + F +F L E G           S C  D+V    +I  G   + P+   +   S+ P P++  S SN + + F SD   +  GF A +D           CG  + + +  G+ TS  YP  Y  N  C W +K  ++ + I ++F DF  E S   C    L +YDG+S   +  ++LCG
Sbjct:  715 YTDTEGI-----LISPNWPNNYAHNKQCVYLIRVARSETVLLNFTHMELE-PHSGCEFDYVEVRDGLAETDPL------IGKYCGSTL---PAPILSSYNHLWIRFKSDSSVSHA----------GFRAVYEI--------------SCGGTLSGS---GQIRTPLHPDAYPHNKKCEWVINQAEGYVVTLNFLTFDV-EDSAGCYFDYVEVRDGATSSSPLLGR-FCGTQVPPMLQSTQKQMYIVFNTDASVT------------------NHGFTAEYASAIQGCGDT-------------------LTDPTGTITSPGHPTDYPHGANCTWYI-SVAPGNIIR---LSFTTFNLE--------------YHTNCNYDYVEIYDNGTALTGNLLGRYCG---RSVPPSLTSTDNLMTILFVSDSSLSTEGFSANYVSLNATTDCSAEYR---------------TPTGVLTSPNYPSNYPSTRECVYKIIVEINMQIMLNFTDFEL-EGG-----------SNCPFDYV----EIRDGGFETSPLIGRYC--SNQPPPIVI-SHSNMLWILFKSDFTATARGFSAHWDG------TQTGCGGTLTTSV--GSFTSPNYPLPYHPNAECYWHIKV-NAGSSIQLNFEDFHLE-SSTDCYYDYLAVYDGNSTNDRQLAKLCG 1250          

HSP 8 Score: 107.071 bits (266), Expect = 9.399e-23
Identity = 165/723 (22.82%), Postives = 276/723 (38.17%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQP---FCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKL-CTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY----SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYY-TFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPF--FNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKA-FDSSNRIMIHFHDFVTEGSHQSCANSILRIYD---GDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRL 2642
            +SPN+PQ +P N+ C +  +A     + + F   F I      C   ++ ++   ++    L     L   CG T    P  V++ +N+I   F S     +           GF+ +F              +   +F        G + SP YP +YP+  NC YL+    +  I L FR   +  ++  C+ D V IY G +    + G P    CG        +T   +L+ F + DFI                 +   GF        +Y  I      N                TSG + SP + +    + + CTY +   +NR       LKF + ++  +  + C+   +++Y    ++ P   K                  CGT+     + T     ++ + ++S    +G G    Y  T   + G  G +             +  SG+  SP   +N  Y +   C + I  ++N  I + F  F L            + +S C  D+V++      G  ++ P+  +F CG++VP P +  S SN +++ F+SD   S  GF A Y        ++  CG    +      ITS  YP  Y +   C+W + A    + +IM+      +  S  S   + L + D   GD  QA  + CG+DS IP F S   T+HL F +     G  GF L +  +   +
Sbjct: 2825 KSPNYPQNFPANVECSWTIIAHEGNHLEMGFASDFQIPDSSGQCQSSYIKVWSGPRAENDAL-----LATGCGST---APPAVIAPYNVIHARFQSTETVGK-----------GFSSSFY------------TRCGANF----SASAGRVVSPNYPDLYPASSNCDYLINAGDQTVIFLTFRTFQIEAEST-CVYDGVKIYSGTS----VNGNPVATLCGNTIP-GPFTTFGPMLLNFYS-DFI-----------------INDNGF------LAEYTAIPCGGVFN---------------GTSGSVSSPTHAISNYHHNINCTYHITVSNNR----IIELKFNSFHLEAS--STCAFDYVALYDGPNTLAPLLGKF-----------------CGTELPPTLKTTSNDLFIVFKTDSS---VTGEGWRASYRETLGPEQGCGGYL-------------TASSGMFGSPDIDYNGKYENYMDCLWTITVSSNKAINLSFLTFEL----------EGMSSSVCRYDYVQIYD----GDSVNYPLVGTF-CGTTVPAPFV--SSSNFLTVHFVSDGSVSFRGFNATY------SAVDRLCGGIYNATSTPQTITSPYYPNAYPAFTSCRWVLDAPAQETVKIMVQQFQLQSSQSCSS---NYLEMKDWPVGDYGQA-HKFCGSDSHIPDFYSYDRTMHLTFQSDAFMSG-NGFSLTYQVLYHNI 3400          

HSP 9 Score: 101.679 bits (252), Expect = 4.151e-21
Identity = 169/712 (23.74%), Postives = 269/712 (37.78%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCH-FYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDY-----GIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIR--GGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCG---TDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +SP +P  YPPN  C +         +   F   ++E   P CN D+L++       +  L     L R+C       P  + +      + F+SD      Y   D     GF+ T+         +T      C   Y D+   EG + SP +P  Y  +  C YL+   + E + L F  ++L   +  C  D+V + DG  E+ P+IG+ +CG      ILS+ N L IRF +   +  +                  GF  VY  S                          +   SG +++P +P   P NK C + +    N+ +     L F T ++                S   +F  +E+R        SP     CGT    + + T K   ++   + S          V  + F  +Y     G    + +P             +G I SP     YP    C + I     + IR+ F  F+L        +YH+     C  D+V +      G  ++  +   + CG SVP  L S    N +++ F+SDS  S  GF A Y        ++     +  +E R   G +TS  YP  Y S   C + +   + + +IM++F DF  EG   +C    + I DG  F+ +S L G   ++   P  IS SN + + F +   A   +GF   W
Sbjct:  605 RSPGYPGNYPPNRDCYWTIDVGPGLLITFAFGTLSLE-HHPDCNYDYLEI------RDGLLPEDALLNRYCS---TGSPAPLQTTGPGAWIHFHSD------YVISDQ----GFHITY---------TTSPTDPGCGGTYTDT---EGILISPNWPNNYAHNKQCVYLIRVARSETVLLNFTHMEL-EPHSGCEFDYVEVRDGLAETDPLIGK-YCGSTLPAPILSSYNHLWIRFKSDSSVSHA------------------GFRAVYEISC-----------------------GGTLSGSGQIRTPLHPDAYPHNKKCEWVI----NQAEGYVVTLNFLTFDVED--------------SAGCYFDYVEVR--DGATSSSPLLGRFCGTQVPPMLQSTQKQMYIVFNTDAS----------VTNHGFTAEYASAIQGCGDTLTDP-------------TGTITSPGHPTDYPHGANCTWYISVAPGNIIRLSFTTFNL--------EYHT----NCNYDYVEIYDN---GTALTGNLLGRY-CGRSVPPSLTS--TDNLMTILFVSDSSLSTEGFSANY--------VSLNATTDCSAEYRTPTGVLTSPNYPSNYPSTRECVYKI-IVEINMQIMLNFTDFELEGG-SNCPFDYVEIRDG-GFE-TSPLIGRYCSNQPPPIVISHSNMLWILFKSDFTATA-RGFSAHW 1167          

HSP 10 Score: 95.5153 bits (236), Expect = 3.782e-19
Identity = 157/732 (21.45%), Postives = 267/732 (36.48%), Query Frame = 3
Query:  477 IYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYI-EMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKE----QKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVG-NQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYG--IEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCG--TDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQR 2639
            +Y +D  G + +    SP +P+ YP N   ++         + I F   +IE        D  D Y  ++K  +    +A  LG FCG  L   P  V S  + + L+F SD            +G  GF      +E   I ++         +C   +       ++ SP +P  Y  +  C++++   +    + LLF D++       C+ D + I DG+T  SP + +  CG +    I +TR+ + +RF T D+                  +  +GFN  Y      +  T+                       G+L SP YP     N+ C++ +          T +  FQ           CSTG             LE+R        S    +CGT    + + T     V      S+A + G G  +I+       G  IE K  +P              G I SP +   YP N  C + I+  N   +++ F++F +              N+ C  D++ +     +  + S     + LCG++ P      S ++++ L F +D   +H GF A+Y            CG   I +   G I S  YP   Y  N  C+W ++    +   +   +  +   S   C N  + I +   + AS  L G     ++P  + T ++       S  +    GF L +   ++ 
Sbjct: 1868 LYGNDITGTSGQ--IASPLYPRTYPVNADYRWTITVSGDSYIQIRFLDIDIE--------DLYDCYYDQLKIFDGPNVHALPLGVFCGLLL---PGLVRSSGSTVTLEFKSDT----------VIGGRGF-----LVEWTAIQNSGPLPTISPGACGGALMPGDTPRFLFSPGWPNEYEPNQECTWVIRSPDSTVELNLLFLDIE---DEASCLYDSLVIRDGETNLSPELAR-LCGRQLPGSIHTTRDSMFLRF-TSDYS-----------------INGRGFNASYSKGCGGLLHTDR----------------------GVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTFLTPFQVQGY----GTACSTGDY-----------LELRNGPDADAPSLGGRLCGTSVPAVTQTTDNHLHVRF---VSDASNEGNGFKLIFEAHSTACGGTIELKDGDP-------------PGYITSPDYPSNYPQNIDCVWIIMVPNGESVQLDFEDFYIE------------PNTQCAYDYLEI-----RDGVNSDTDLIAKLCGNTKPS--TQHSTASAMYLRFRTDQSVTHKGFKAKYSIA--------VCGGTYIGQ--SGTIRSPGYPDSNYPDNSNCEWYLEG--PTGHYLTLSYSALNLQSSTGCVNDYVEIRE---YNASGRLLGRHCGMSLPLSVDTGDSFAYVKFVSDGSVNAPGFSLSYEASVEE 2462          

HSP 11 Score: 89.3521 bits (220), Expect = 2.436e-17
Identity = 152/699 (21.75%), Postives = 264/699 (37.77%), Query Frame = 3
Query:  513 RMFQSPNFPQKYPPNIRCKYQFVAKSQEKVV-INFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLF-RDLDLNHQNDDC-IEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI--ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFF-NQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS----ELCGTDSAIPAFISTSNTVHLEFIT 2579
            R   SP +P +Y PN  C +  V +S +  V +N    +IE     C  D L     ++  E+ L  +  L R CG  L   P  + +  + + L F SD +              GFN ++               + C   + + +  G ++SP YP  Y  + +CS+ ++     R+ + F     +      C   D++ + +G    +P +G   CG        +T N L +RF++         ++ +E           GF +++         T E++                    G + SP YP   P+N  C + +  + N    E+  L F+   I   P+ +C+            +  LEIR    V  D+ D I  +CG      +  T     +  R + S          V +  FK  Y I        VC   Y     +SG I SP + +  YP N+ C++ + G   H + + +   +L              ++ C  D+V + +    G ++ +       CG S+  PL  D+  +   + F+SD   +  GF   Y      +    +CG ++      G I+S  YP  Y  N +C+W +       R+ +  +D   E  H SC+   + + +G    A+S      CG+  A     S+ NT+ + F T
Sbjct: 2006 RFLFSPGWPNEYEPNQECTW--VIRSPDSTVELNLLFLDIEDEA-SCLYDSL----VIRDGETNL--SPELARLCGRQL---PGSIHTTRDSMFLRFTSDYSINGR----------GFNASYS--------------KGCGGLLHTDR--GVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTFLTPFQVQGYGTACSTGDYLELRNGPDADAPSLGGRLCGTSVPAVTQTTDNHLHVRFVS---------DASNE---------GNGFKLIFEAHSTACGGTIELKDG---------------DPPGYITSPDYPSNYPQNIDCVWIIM-VPNG---ESVQLDFEDFYI--EPNTQCA------------YDYLEIR--DGVNSDT-DLIAKLCGNTKPSTQHSTASAMYLRFRTDQS----------VTHKGFKAKYSI-------AVCGGTY---IGQSGTIRSPGYPDSNYPDNSNCEWYLEGPTGHYLTLSYSALNLQ------------SSTGCVNDYVEIREYNASGRLLGR------HCGMSL--PLSVDTGDSFAYVKFVSDGSVNAPGFSLSY------EASVEECGGDL--NAASGTISSPNYPNLYPHNRVCRWRITV-PQGRRVTLTINDLRLE-DHGSCSFDYVEVING--LVANSPRLQRFCGSVPAGTQVKSSGNTMTVVFAT 2560          

HSP 12 Score: 85.5001 bits (210), Expect = 4.136e-16
Identity = 156/693 (22.51%), Postives = 261/693 (37.66%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVP--NFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYP-GIYPSHLNCSYLL--VGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEK-PKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYF-QEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEF 2573
             SPN+P  YP N  C+++       +V +      +E     C+ D++++      +   + N+  L RFCG     VP    V S  N + + F +D +              GFN  +          + ++   C   +D+    G  TSP Y  G Y + LNC +L+    +    I +L  D+ L H    C  D++    GD E++ ++G+  CG+  P++ I+ +   L + F       RS     DE  ++       GF V Y FS                  +C  +        G + SPGYP   P    C + L       +  T  L F    +     ++CS  S++IY+       +     +     SP  I  G++         K  +V L  +     S   GGF+  +T     G  G +                SG I SP + Q +P+N  C + II +  + + + F  +F + +            +  C+  +++V      GP        +  CGS+ P  +I  +  N I   F S       GF + +           +CG N       G + S  YP  Y ++  C + + A D +  I + F  F  E +  +C    ++IY G S   +  + LCG  + IP   +T   + L F
Sbjct: 2475 SSPNYPNLYPHNRVCRWRITVPQGRRVTLTINDLRLED-HGSCSFDYVEV------INGLVANSPRLQRFCG----SVPAGTQVKSSGNTMTVVFATDSSVSNG----------GFNADY----------SSDEAAVCGGVLDTP---GNFTSPDYGIGNYSNSLNCEWLIQNPNHVNSSIVVLIDDMHLEHHQ-TCEWDYLEFRLGD-ENAELLGR-ICGQTVPEVPIVVSTPQLWVHF-------RS-----DESVVD------LGFKVTYYFS------------------DCGGY---QTGEGGTVSSPGYPDSYPSPSRCVWLL----EAPEGHTITLTFTYFEV--EEHSQCSWDSVTIYNGASAGSPII---GQYCGHSSPGTIQSGSN---------KLTVVFLADH-----SVSRGGFIATWTTDSS-GCGGTI-------------HADSGTIKSPNYPQNFPANVECSWTIIAHEGNHLEMGFASDFQIPD-----------SSGQCQSSYIKVW----SGPRAENDALLATGCGSTAPPAVI--APYNVIHARFQSTETVGK-GFSSSF---------YTRCGANF--SASAGRVVSPNYPDLYPASSNCDYLINAGDQT-VIFLTFRTFQIE-AESTCVYDGVKIYSGTSVNGNPVATLCG--NTIPGPFTTFGPMLLNF 3021          

HSP 13 Score: 78.5666 bits (192), Expect = 5.216e-14
Identity = 127/574 (22.13%), Postives = 215/574 (37.46%), Query Frame = 3
Query:  948 KKEEGYITSPTYPG--IYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVY--RFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD 2648
            + + G  + P  PG   Y   ++C++++  +  + +R+ F   +L H    C  D + I+DG++ S+ ++G+ +CG     ++ S+ N L   F       RS             ++   GF V +  +  V    +TN                       G ++SPGYP   P N+ C + +    +          F TL++   PD                +  LEIR   L+  D+     C T      + T  GP   +  + S+   S  G  + Y T   D G  G   +               G++ SP +   Y  N  C Y I    +  + + F    L              +S CE D+V V   + +  P+I +       CGS++P P++  S  N + + F SDS  SH+GF A Y+           CG  +      G I +  +P  Y  N  C+W +   +    + ++F  F  E S   C    + + DG +  +      CGT    P   ST   +++ F T   +    GF   ++  +Q   D
Sbjct:  480 QGQAGTFSYPNTPGHDQYDHMVSCAWVIRTDADKILRVTFPYFELEHSTT-CSFDFLQIHDGESASAYMLGK-YCGTNAPAELFSSHNSLYFWF-------RSD-----------HIINSGGFTVSWTSQAPVCGGHLTNPY---------------------GDIRSPGYPGNYPPNRDCYWTI----DVGPGLLITFAFGTLSLEHHPDCN--------------YDYLEIR-DGLLPEDALLNRYCSTGSPAPLQTT--GPGAWIHFH-SDYVISDQGFHITYTTSPTDPGCGGTYTD-------------TEGILISPNWPNNYAHNKQCVYLIRVARSETVLLNFTHMELE------------PHSGCEFDYVEVRDGLAETDPLIGK------YCGSTLPAPIL--SSYNHLWIRFKSDSSVSHAGFRAVYEI---------SCGGTLSGS---GQIRTPLHPDAYPHNKKCEWVINQAEGY-VVTLNFLTFDVEDS-AGCYFDYVEVRDGATSSSPLLGRFCGTQ-VPPMLQSTQKQMYIVFNTD-ASVTNHGFTAEYASAIQGCGD 941          

HSP 14 Score: 76.2554 bits (186), Expect = 2.479e-13
Identity = 66/266 (24.81%), Postives = 105/266 (39.47%), Query Frame = 3
Query:  456 YALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKP---KLKILSTRNMLLIRFITGDFIK 1244
            Y  +C  I  ++K       + +S NFP  YP N RC +         +   F  F++EGL P C  D++ LY            A  +GRFCG+T         S  ++I             +N D  + L GF   +              +  C    D     G  TSP YP  YP +  C + +  +    + +   + D+   +  C  D + +Y G   SSP + Q  C  +P    L++ ST N + +RF + ++I 
Sbjct: 1283 YTSNCSGIVIANKT----SGVIESQNFPNNYPFNARCSWTIQTTMGNTINYTFTAFDLEGLSPSCIYDYMLLYNGPNE------EAPLIGRFCGNTPPPAGATTSSSLHVI-------------FNSDLSISLPGFRMLW-------------YQNGCGG--DLSGPSGNFTSPDYPNKYPDNRECVWYIQTSPGSSVTITIHEFDI-ESHPSCDFDLLEVYGGPDLSSPRLAQ-LCTTRPPNNPLQVSSTGNTVTVRFKSDEYIS 1508          

HSP 15 Score: 75.485 bits (184), Expect = 4.396e-13
Identity = 73/270 (27.04%), Postives = 116/270 (42.96%), Query Frame = 3
Query: 1878 KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEI-----LQRLPDGSCPG 2663
            +SG  NSP +   YP N  C + II +  +R+++ F  F L +            ++ C  D++ + +    G ++ +       CG+S+P    S    + + + F+SDS  S +GF A +  +   DI               G I S  YPR Y  N   +W++     S  I I F D   E  +  C    L+I+DG +  A      CG    +P  + S+ +TV LEF  S    G +GF + W+ I     L  +  G+C G
Sbjct: 1763 ESGAFNSPNYPDAYPPNIECVWTIISSPGNRLQLSFVLFELQQ------------STGCNNDYLEIREGNSTGALVGR------FCGNSLPSNYTS-LIGHVLWVKFVSDSSVSGAGFRATFSHLYGNDITGTS-----------GQIASPLYPRTYPVNADYRWTITVSGDS-YIQIRFLDIDIEDLYD-CYYDQLKIFDGPNVHALPLGVFCGL--LLPGLVRSSGSTVTLEF-KSDTVIGGRGFLVEWTAIQNSGPLPTISPGACGG 1997          

HSP 16 Score: 66.2402 bits (160), Expect = 2.717e-10
Identity = 61/239 (25.52%), Postives = 98/239 (41.00%), Query Frame = 3
Query: 1917 YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
            YP N  C   +    N  I ++F  F L              + +C  DF+    +I  G   S P+   + CGS++P P+    R N + L F SD   +  GF   +   P        CG  +  +   G+ TS  +P  Y +   C+W ++A   S R++    + +       C N+ L++YDG   S       CG ++ I  F ++S+ V + F          GF+L WS 
Sbjct: 3414 YPHNIDCTIVLRAPQNSSISLFFDNFDLE------------SHPSCSYDFL----EIRNGSTASAPLLGKY-CGSTLPSPIFP--RINELYLHFQSDFSSARDGFEITWTSSP------QGCGGTLYGD--HGSFTSPDFPGTYANGTHCEWDIRA--PSGRVVTVSFNQIAIDDPGDCQNNYLKLYDGPDASSPPVGPYCGAETNIAPFRASSHRVFIVFHAQSVVL-PSGFRLTWSS 3622          

HSP 17 Score: 62.7734 bits (151), Expect = 3.286e-9
Identity = 59/240 (24.58%), Postives = 97/240 (40.42%), Query Frame = 3
Query:  513 RMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYS-DINTQQSYNQDDHMGLLGFNGTFKFI--EIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            +   SP +P  YP    C++   A +QE V I      ++      ++     Y+EMK      +   H  +FCG +  H+P            DFYS D     ++  D  M   GF+ T++ +   I  +                     Y+ S  +P  YP +++C+ +L   Q   I L F + DL   +  C  D + I +G T S+P++G+ +CG      I    N L + F
Sbjct: 3292 QTITSPYYPNAYPAFTSCRWVLDAPAQETVKIM-----VQQFQLQSSQSCSSNYLEMKDWPVGDYGQAH--KFCG-SDSHIP------------DFYSYDRTMHLTFQSDAFMSGNGFSLTYQVLYHNIVFV---------------------YVYSTGWPATYPHNIDCTIVLRAPQNSSISLFFDNFDL-ESHPSCSYDFLEIRNGSTASAPLLGK-YCGSTLPSPIFPRINELYLHF 3488          

HSP 18 Score: 57.7658 bits (138), Expect = 1.109e-7
Identity = 45/184 (24.46%), Postives = 77/184 (41.85%), Query Frame = 3
Query:  516 MFQSPN--FPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG-CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLL 1058
            MF SP+  +  KY   + C +     S + + ++F  F +EG+    C  D++ +Y      +    N   +G FCG T   VP   VS  N + + F SD            +   GFN T+  ++             C    ++      ITSP YP  YP+  +C ++L    +E ++++
Sbjct: 3171 MFGSPDIDYNGKYENYMDCLWTITVSSNKAINLSFLTFELEGMSSSVCRYDYVQIY------DGDSVNYPLVGTFCGTT---VPAPFVSSSNFLTVHFVSD----------GSVSFRGFNATYSAVD-----------RLCGGIYNATSTPQTITSPYYPNAYPAFTSCRWVLDAPAQETVKIM 3324          

HSP 19 Score: 53.5286 bits (127), Expect = 2.184e-6
Identity = 59/238 (24.79%), Postives = 103/238 (43.28%), Query Frame = 3
Query: 1935 CQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA-SSELCGTDSAIPAFIST--SNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            C + II     NH + + F +F L            + NS C  D V ++       P + +       CG+ VP P+ S   SN++ + F++D+  +  GF A Y            CG N+   +  G   S  YP  Y  N+ C W++ +    NR+ + F  F  + S   C N  L I +G+S  A     CG  +++P+  ++   + + ++F++     G  GF+  +S +
Sbjct: 1664 CNWIIIAQEPFNH-VTLSFTDFELE-----------MINSNCSHDAVEILDGDNSDAPSVGR------YCGNDVPHPVTS--FSNALVVNFVTDASVTRKGFRATYT------ASTSGCGGNL--HMESGAFNSPNYPDAYPPNIECVWTIIS-SPGNRLQLSFVLFELQQS-TGCNNDYLEIREGNSTGALVGRFCG--NSLPSNYTSLIGHVLWVKFVSDSSVSG-AGFRATFSHL 1868          
BLAST of Cubilin vs. Ensembl Cavefish
Match: cubn (cubilin [Source:NCBI gene;Acc:103044622])

HSP 1 Score: 149.058 bits (375), Expect = 1.577e-35
Identity = 172/709 (24.26%), Postives = 281/709 (39.63%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYS----IRPFFVKL-EIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
            F SPN+P  Y PN  C +     +   + +NFE F++E     C  D+L +Y      +    N + L + CG   + +PN + S  + + +   +D            +   GF  ++                +C   + + K  G I S  +P  YP +  CS+ +       I   F   DL   +  CI D++ +Y+G  E +P+IG+ FCG  P     +T + L + F        S L            +   GF +++                +  G   D+        SG   SP YP + P N+ C +++      +   +  +     +I   P   C    L +Y       P   +L   RP     P++P Q+            +  G  V +R   S+ + SG G    +   +   G  G ++ P             SG I+SP +   YP+N  C + I  +  HRI   F +  +              +S+C+ D+V V      GP  S P+    +CG SVP P+ S    N I + F SD   +H GF A++         +  CG  I+++  GG I S  YP  Y +N  C W + A +  N + + F DF  E  + +C++  + I DGD+  A S    CG D   P   S SN + + F+T   +  +KGF+  ++
Sbjct: 1185 FTSPNYPLPYHPNAECYWHIKVNAGSSIQLNFEDFHLESST-DCYYDYLAVY------DGNSTNDRQLAKLCG---NQIPNPITSTRDQMYVKLRTD----------SIISAGGFVASYT--------------SNCSGIVIANKTSGVIESQNFPNNYPFNARCSWTIQTTMGNTINYTFTAFDLEGLSPSCIYDYMLLYNGPNEEAPLIGR-FCGNTPPPAGATTSSSLHVIF-------NSDLS-----------ISLPGFRMLW----------------YQNGCGGDL-----SGPSGNFTSPDYPNKYPDNRECVWYI----QTSPGSSVTITIHEFDIESHP--SCDFDLLEVYGGPDLSSPRLAQLCTTRP-----PNNPLQV------------SSTGNTVTVRFK-SDEYISGRGFSASWQ--ETQGGCGGPIIAP-------------SGEIHSPQYPNNYPNNVDCSWVITVDQGHRILFNFTDVDIE------------SHSSCQWDYVDVHD----GPGDSSPLLAK-VCGFSVPAPIYS--TQNVIYVRFRSDISGNHRGFKAEF---------SEACGSTIMADDVGGAIASPNYPYPYPNNQNCNWIIIAQEPFNHVTLSFTDFELEMINSNCSHDAVEILDGDNSDAPSVGRYCGNDVPHPV-TSFSNALVVNFVTD-ASVTRKGFRATYT 1750          

HSP 2 Score: 137.887 bits (346), Expect = 3.632e-32
Identity = 171/711 (24.05%), Postives = 272/711 (38.26%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTS--NAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFI----PIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
             SP +P  YP N+ C +        +++ NF   +IE     C  D++D++      +    ++  L + CG +   VP  + S  N+I + F SDI+        +H G       FK           E  E+C   I +    G I SP YP  YP++ NC+++++  +    + L F D +L   N +C  D V I DGD   +P +G+ +CG      + S  N L++ F+T   + R                  KGF   Y  S         ME                   SG   SP YP   P N  C +                      I  +P N+          ++  FV  E++              C  DY EI+E    G LV      S  + ++S I G V++  F  D  + G        H   N  +  SG I SP + + YP N   ++ I  + +  I+I F +  + +  +    Y  L              KI  GP +   +     CG  +PG  +  S  ++++L F SD+V    GF  ++  I    P+  I    CG  ++       + S  +P EY  N  C W +++ DS+  + + F D   E    SC    L I DG++  +   + LCG    +P  I T+        TS  +   +GF   +S+
Sbjct: 1535 HSPQYPNNYPNNVDCSWVITVDQGHRILFNFTDVDIESH-SSCQWDYVDVH------DGPGDSSPLLAKVCGFS---VPAPIYSTQNVIYVRFRSDIS-------GNHRG-------FK----------AEFSEACGSTIMADDVGGAIASPNYPYPYPNNQNCNWIIIAQEPFNHVTLSFTDFELEMINSNCSHDAVEILDGDNSDAPSVGR-YCGNDVPHPVTSFSNALVVNFVTDASVTR------------------KGFRATYTASTSGCGGNLHME-------------------SGAFNSPNYPDAYPPNIECVW---------------------TIISSPGNR----------LQLSFVLFELQ----------QSTGCNNDYLEIREGNSTGALVGRFCGNSLPSNYTSLI-GHVLWVKFVSDSSVSGAGFRATFSHLYGNDITGTSGQIASPLYPRTYPVNADYRWTITVSGDSYIQIRFLDIDIED--LYDCYYDQL--------------KIFDGPNV-HALPLGVFCGLLLPG--LVRSSGSTVTLEFKSDTVIGGRGFLVEWTAIQNSGPLPTISPGACGGALMPGDTPRFLFSPGWPNEYEPNQECTWVIRSPDSTVELNLLFLDIEDEA---SCLYDSLVIRDGETNLSPELARLCGRQ--LPGSIHTTRDSMFLRFTSDYSINGRGFNASYSK 2107          

HSP 3 Score: 130.568 bits (327), Expect = 6.524e-30
Identity = 176/714 (24.65%), Postives = 269/714 (37.68%), Query Frame = 3
Query:  456 YALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINF-EHFNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEE--GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYP-VRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNIS--------STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGD-SFQASSELCG-TDSAIPAFIST 2549
            Y+  C  + ++D      R +  SPN+PQ Y PN  C +  +  S  +V + F   F ++G    C+  D+L+L     +   +L      GR CG +   VP    +  N + + F SD + +              NG FK I        +    +C   I+ K  +  GYITSP YP  YP +++C ++++    E ++L F D  +   N  C  D++ I DG    + +I +  CG        ST + + +RF T   +                    KGF   Y  +V              IG             SG ++SPGYP    P N  C ++L G           L +  LN+      + STG                               C  DY EI+E    G L+      S   S   G    Y  F  D    G +  PG     Y  S        +  SG I+SP +  LYP N  C++ I      R+ +   +  L + G            +C  D+V VI     G + + P    F CG SVP      S  N++++ F +DS  S+ GF A Y            CG  + +    GN TS  Y    Y ++L C+W ++  +  N  ++   D +    HQ+C    L    GD + +    +CG T   +P  +ST
Sbjct: 2105 YSKGCGGLLHTD------RGVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTFLTPFQVQGYGTACSTGDYLELRNGPDADAPSLG-----GRLCGTS---VPAVTQTTDNHLHVRFVSDASNEG-------------NG-FKLI-------FEAHSTACGGTIELKDGDPPGYITSPDYPSNYPQNIDCVWIIMVPNGESVQLDFEDFYI-EPNTQCAYDYLEIRDGVNSDTDLIAK-LCGNTKPSTQHSTASAMYLRFRTDQSVTH------------------KGFKAKYSIAV---------CGGTYIG------------QSGTIRSPGYPDSNYPDNSNCEWYLEGPTGH----YLTLSYSALNL------QSSTG-------------------------------CVNDYVEIREYNASGRLLGRHCGMSLPLSVDTGDSFAYVKFVSD----GSVNAPGF-SLSYEASVEECGGDLNAASGTISSPNYPNLYPHNRVCRWRITVPQGRRVTLTINDLRLEDHG------------SCSFDYVEVI----NGLVANSPRLQRF-CG-SVPAGTQVKSSGNTMTVVFATDSSVSNGGFNADYSSDEAA-----VCGGVLDTP---GNFTSPDYGIGNYSNSLNCEWLIQNPNHVNSSIVVLIDDMHLEHHQTCEWDYLEFRLGDENAELLGRICGQTVPEVPIVVST 2670          

HSP 4 Score: 129.413 bits (324), Expect = 1.519e-29
Identity = 167/711 (23.49%), Postives = 286/711 (40.23%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYI-DSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI-ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGN----ITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWS 2624
             F SPN+P  YPPNI C +  ++    ++ ++F  F ++    GCN D    Y+E++   ST      +GRFCG++L    N+   + +++ + F SD +   +          GF  TF                  H Y  D     G I SP YP  YP + +  + +  +    I++ F D+D+    D C  D + I+DG    +  +G  FCG      + S+ + + + F                   +  ++  +GF       V++  I N      I    C   +   + T   L SPG+P     N+ CT+ +     R+   T  L    L+I    +++ S            +  L IR  +  L  SP+   +CG   R++      G +   R +             ++  F  DY I G+            +  T  GV++SP + Q Y  N  C + ++  +  R+ + F         +   +      +   GD++    ++  GP    P     LCG+SVP   ++ +  N + + F+SD+    +GF        I +  +  CG  I  E++ G+    ITS  YP  Y  N+ C W +    +   + + F DF  E + Q CA   L I DG +      ++LCG ++      ST++ ++L F T  ++   KGFK  +S
Sbjct: 1766 AFNSPNYPDAYPPNIECVWTIISSPGNRLQLSFVLFELQQST-GCNND----YLEIREGNST---GALVGRFCGNSLPS--NYTSLIGHVLWVKFVSDSSVSGA----------GFRATFS-----------------HLYGNDITGTSGQIASPLYPRTYPVNADYRWTITVSGDSYIQIRFLDIDIEDLYD-CYYDQLKIFDGPNVHALPLGV-FCGLLLPGLVRSSGSTVTLEF------------------KSDTVIGGRGF------LVEWTAIQNSGPLPTISPGACGGALMPGD-TPRFLFSPGWPNEYEPNQECTWVI-----RSPDSTVELNLLFLDI----EDEASC----------LYDSLVIRDGETNL--SPELARLCG---RQLP-----GSIHTTRDS-------------MFLRFTSDYSINGRGFNASYSKGCGGLLHTDRGVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTF---------LTPFQVQGYGTACSTGDYL----ELRNGPDADAPSLGGRLCGTSVPA--VTQTTDNHLHVRFVSDASNEGNGFKL------IFEAHSTACGGTI--ELKDGDPPGYITSPDYPSNYPQNIDCVW-IIMVPNGESVQLDFEDFYIEPNTQ-CAYDYLEIRDGVNSDTDLIAKLCG-NTKPSTQHSTASAMYLRFRTD-QSVTHKGFKAKYS 2343          

HSP 5 Score: 129.028 bits (323), Expect = 2.357e-29
Identity = 181/719 (25.17%), Postives = 279/719 (38.80%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTE--CDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAF--ISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            SP  P  YP    C +         + ++F  FN+E     CN D++++Y    +L   L     LGR+CG +   VP  + S  N++ + F SD            +   GF+  +       +N+T +         + +   G +TSP YP  YPS   C Y ++     +I L F D +L     +C  D+V I DG  E+SP+IG+ +C  +P   ++S  NML I F + DF   +R                 GF+                   H  GT+  C   + +S    G   SP YP+    N  C + +      N   +  L F+  ++  + D  C    L++Y             ++L         +CG        IT     + ++L T +  S+  GGFV  YT                C  +  I++  SGVI S  F   YP N  C + I     + I   F  F L  +G+           +C  D++ +      GP    P+   F CG++   P    + S+S+ + F SD   S  GF   +          + CG ++      GN TS  YP +Y  N  C W ++    S+ + I  H+F  E SH SC   +L +Y G    +   ++LC T          ST NTV + F +     G +GF   W E       G C G
Sbjct:  952 SPGHPTDYPHGANCTWYISVAPGNIIRLSFTTFNLE-YHTNCNYDYVEIYDNGTALTGNL-----LGRYCGRS---VPPSLTSTDNLMTILFVSD----------SSLSTEGFSANY-----VSLNATTDCSA------EYRTPTGVLTSPNYPSNYPSTRECVYKIIVEINMQIMLNFTDFEL-EGGSNCPFDYVEIRDGGFETSPLIGR-YCSNQPPPIVISHSNMLWILFKS-DFTATAR-----------------GFSA------------------HWDGTQTGCGGTLTTS---VGSFTSPNYPLPYHPNAECYWHI----KVNAGSSIQLNFEDFHLESSTD--CYYDYLAVYDGN------STNDRQLAK-------LCGNQIP--NPITSTRDQMYVKLRTDSIISA--GGFVASYTSN--------------CSGIV-IANKTSGVIESQNFPNNYPFNARCSWTIQTTMGNTINYTFTAFDL--EGLS---------PSCIYDYMLLY----NGPNEEAPLIGRF-CGNTP--PPAGATTSSSLHVIFNSDLSISLPGFRMLW--------YQNGCGGDLSGP--SGNFTSPDYPNKYPDNRECVWYIQTSPGSS-VTITIHEFDIE-SHPSCDFDLLEVYGGPDLSSPRLAQLCTTRPPNNPLQVSSTGNTVTVRFKSDEYISG-RGFSASWQET-----QGGCGG 1525          

HSP 6 Score: 128.257 bits (321), Expect = 3.783e-29
Identity = 179/762 (23.49%), Postives = 295/762 (38.71%), Query Frame = 3
Query:  441 TNYVVYALDCDII-------YYSDKIGVNNRRM-----FQSPNFP-QKYPPNIRCKY--QFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLK-FQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIM-IHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGF 2666
            T  VV+A D  +        Y SD+  V    +     F SP++    Y  ++ C++  Q        +V+  +  ++E     C  D+L+  +  +       NA+ LGR CG T+  VP  VVS   + V            +  D+ +  LGF  T+ F +             C  Y     E G ++SP YP  YPS   C +LL   +   I L F   ++  ++  C  D VTIY+G +  SPIIGQ +CG      I S  N L + F+    + R                   GF  +  ++ D       +  +                 SG +KSP YP   P N  C++ +   H  N +E      FQ     P    +C +  + ++S                 P + +  +  T            P  ++     +  + G G    +YT                C   +   S  +G + SP +  LYP+++ C Y I   +   I + F+ F +  +            STC  D V++        +   P+ T  LCG+++PGP  +      + L F SD + + +GF A+Y  IP   + N             G+++S  +    Y  N+ C + +    S+NRI+ + F+ F  E S  +CA   + +YDG +  A    + CGT+   P   +TSN + + F T     G+ G++  + E L   P+  C G+
Sbjct: 2553 TMTVVFATDSSVSNGGFNADYSSDEAAVCGGVLDTPGNFTSPDYGIGNYSNSLNCEWLIQNPNHVNSSIVVLIDDMHLEHHQT-CEWDYLEFRLGDE-------NAELLGRICGQTVPEVP-IVVSTPQLWV-----------HFRSDESVVDLGFKVTYYFSD-------------CGGY--QTGEGGTVSSPGYPDSYPSPSRCVWLLEAPEGHTITLTFTYFEV-EEHSQCSWDSVTIYNGASAGSPIIGQ-YCGHSSPGTIQSGSNKLTVVFLADHSVSRG------------------GF--IATWTTDSSGCGGTIHAD-----------------SGTIKSPNYPQNFPANVECSWTIIA-HEGNHLEMGFASDFQI----PDSSGQCQSSYIKVWS----------------GPRAENDALLATGCGSTAPPAVIAPYNVIHARFQSTETVGKGFSSSFYT---------------RCGANF---SASAGRVVSPNYPDLYPASSNCDYLINAGDQTVIFLTFRTFQIEAE------------STCVYDGVKIYSGT---SVNGNPVAT--LCGNTIPGPFTT---FGPMLLNFYSDFIINDNGFLAEYTAIPCGGVFNGT----------SGSVSSPTHAISNYHHNINCTYHITV--SNNRIIELKFNSFHLEAS-STCAFDYVALYDGPNTLAPLLGKFCGTELP-PTLKTTSNDLFIVFKTDSSVTGE-GWRASYRETLG--PEQGCGGY 3164          

HSP 7 Score: 120.168 bits (300), Expect = 9.096e-27
Identity = 158/682 (23.17%), Postives = 261/682 (38.27%), Query Frame = 3
Query:  483 YSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKE--ITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSF--QASSELCG 2516
            Y+D  G+       SPN+P  Y  N +C Y       E V++NF H  +E    GC  D++++   +   +        +G++CG TL   P  ++S +N + + F SD +   +          GF   ++               SC   +      G I +P +P  YP +  C +++   +   + L F   D+   +  C  D+V + DG T SSP++G+ FCG +    + ST+  + I F T   +                     GF   Y  ++     T                       +G + SPG+P   P    CT+++  +   N +    L F T N+               Y     +  +EI      L  +     CG   R +     +    + +L ++ S+  + G     +      D   E +               T +GV+ SP +   YPS   C Y II   N +I + F +F L E G           S C  D+V    +I  G   + P+   +   S+ P P++  S SN + + F SD   +  GF A +D           CG  + + +  G+ TS  YP  Y  N  C W +K  ++ + I ++F DF  E S   C    L +YDG+S   +  ++LCG
Sbjct:  715 YTDTEGI-----LISPNWPNNYAHNKQCVYLIRVARSETVLLNFTHMELE-PHSGCEFDYVEVRDGLAETDPL------IGKYCGSTL---PAPILSSYNHLWIRFKSDSSVSHA----------GFRAVYEI--------------SCGGTLSGS---GQIRTPLHPDAYPHNKKCEWVINQAEGYVVTLNFLTFDV-EDSAGCYFDYVEVRDGATSSSPLLGR-FCGTQVPPMLQSTQKQMYIVFNTDASVT------------------NHGFTAEYASAIQGCGDT-------------------LTDPTGTITSPGHPTDYPHGANCTWYI-SVAPGNIIR---LSFTTFNLE--------------YHTNCNYDYVEIYDNGTALTGNLLGRYCG---RSVPPSLTSTDNLMTILFVSDSSLSTEGFSANYVSLNATTDCSAEYR---------------TPTGVLTSPNYPSNYPSTRECVYKIIVEINMQIMLNFTDFEL-EGG-----------SNCPFDYV----EIRDGGFETSPLIGRYC--SNQPPPIVI-SHSNMLWILFKSDFTATARGFSAHWDG------TQTGCGGTLTTSV--GSFTSPNYPLPYHPNAECYWHIKV-NAGSSIQLNFEDFHLE-SSTDCYYDYLAVYDGNSTNDRQLAKLCG 1250          

HSP 8 Score: 107.071 bits (266), Expect = 9.805e-23
Identity = 165/716 (23.04%), Postives = 274/716 (38.27%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQP---FCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKL-CTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY----SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYY-TFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPF--FNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKA-FDSSNRIMIHFHDFVTEGSHQSCANSILRIYD---GDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +SPN+PQ +P N+ C +  +A     + + F   F I      C   ++ ++   ++    L     L   CG T    P  V++ +N+I   F S     +           GF+ +F              +   +F        G + SP YP +YP+  NC YL+    +  I L FR   +  ++  C+ D V IY G +    + G P    CG        +T   +L+ F + DFI                 +   GF        +Y  I      N                TSG + SP + +    + + CTY +   +NR       LKF + ++  +  + C+   +++Y    ++ P   K                  CGT+     + T     ++ + ++S    +G G    Y  T   + G  G +             +  SG+  SP   +N  Y +   C + I  ++N  I + F  F L            + +S C  D+V++      G  ++ P+  +F CG++VP P +  S SN +++ F+SD   S  GF A Y        ++  CG    +      ITS  YP  Y +   C+W + A    + +IM+      +  S  S   + L + D   GD  QA  + CG+DS IP F S   T+HL F +     G  GF L +
Sbjct: 2825 KSPNYPQNFPANVECSWTIIAHEGNHLEMGFASDFQIPDSSGQCQSSYIKVWSGPRAENDAL-----LATGCGST---APPAVIAPYNVIHARFQSTETVGK-----------GFSSSFY------------TRCGANF----SASAGRVVSPNYPDLYPASSNCDYLINAGDQTVIFLTFRTFQIEAEST-CVYDGVKIYSGTS----VNGNPVATLCGNTIP-GPFTTFGPMLLNFYS-DFI-----------------INDNGF------LAEYTAIPCGGVFN---------------GTSGSVSSPTHAISNYHHNINCTYHITVSNNR----IIELKFNSFHLEAS--STCAFDYVALYDGPNTLAPLLGKF-----------------CGTELPPTLKTTSNDLFIVFKTDSS---VTGEGWRASYRETLGPEQGCGGYL-------------TASSGMFGSPDIDYNGKYENYMDCLWTITVSSNKAINLSFLTFEL----------EGMSSSVCRYDYVQIYD----GDSVNYPLVGTF-CGTTVPAPFV--SSSNFLTVHFVSDGSVSFRGFNATY------SAVDRLCGGIYNATSTPQTITSPYYPNAYPAFTSCRWVLDAPAQETVKIMVQQFQLQSSQSCSS---NYLEMKDWPVGDYGQA-HKFCGSDSHIPDFYSYDRTMHLTFQSDAFMSG-NGFSLTY 3393          

HSP 9 Score: 107.071 bits (266), Expect = 1.067e-22
Identity = 163/733 (22.24%), Postives = 270/733 (36.83%), Query Frame = 3
Query:  480 YYSDKIG--VNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFR-DLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFN-QLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY--DFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQS-CANSILRIYDGDS--FQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDG 2651
            Y+SD  G          SP +P  YP   RC +   A     + + F +F +E     C+ D + +Y    +       +  +G++CGH+    P  + S  N + + F +D +  +           GF  T+                 C   I    + G I SP YP  +P+++ CS+ ++ ++   + + F  D  +   +  C   ++ ++ G    +  +    CG      +++  N++  RF + + +                    KGF+  +                    T C     +S   +G + SP YP   P +  C Y +    N        L F+T  I    ++ C    + IYS                +  +P   +CG         T  GP++   LN  + F     GF+  YT                C  V+N     SG ++SP      Y  N  C Y I  +NN  I + F  F            H   +STC  D+V +      GP    P+   F CG+ +P  L   + SN + + F +DS  +  G+ A Y     P Q      CG  + +           Y  +Y + + C W++    S+  I + F  F  EG   S C    ++IYDGDS  +      CGT    P F+S+SN + + F+ S  +   +GF   +S +  RL  G
Sbjct: 2693 YFSDCGGYQTGEGGTVSSPGYPDSYPSPSRCVWLLEAPEGHTITLTFTYFEVE-EHSQCSWDSVTIYNGASA------GSPIIGQYCGHS---SPGTIQSGSNKLTVVFLADHSVSRG----------GFIATWT-----------TDSSGCGGTI--HADSGTIKSPNYPQNFPANVECSWTIIAHEGNHLEMGFASDFQIPDSSGQCQSSYIKVWSGPRAENDALLATGCGSTAPPAVIAPYNVIHARFQSTETVG-------------------KGFSSSFY-------------------TRCGANFSAS---AGRVVSPNYPDLYPASSNCDYLI----NAGDQTVIFLTFRTFQI--EAESTCVYDGVKIYS-------------GTSVNGNPVATLCGNTIP--GPFTTFGPML---LNFYSDFIINDNGFLAEYTAIP-------------CGGVFN---GTSGSVSSPTHAISNYHHNINCTYHITVSNNRIIELKFNSF------------HLEASSTCAFDYVALYD----GPNTLAPLLGKF-CGTELPPTL--KTTSNDLFIVFKTDSSVTGEGWRASYRETLGPEQ-----GCGGYLTASSGMFGSPDIDYNGKYENYMDCLWTITV-SSNKAINLSFLTFELEGMSSSVCRYDYVQIYDGDSVNYPLVGTFCGTTVPAP-FVSSSNFLTVHFV-SDGSVSFRGFNATYSAV-DRLCGG 3283          

HSP 10 Score: 103.605 bits (257), Expect = 1.024e-21
Identity = 159/698 (22.78%), Postives = 263/698 (37.68%), Query Frame = 3
Query:  555 NIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPT--YPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDD-CIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDS--PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
            NI C Y     +   + + F  F++E     C  D++ LY    +L      A  LG+FCG  L   P    + +++ ++           +  D  +   G+  +++         T   ++ C  Y+ +    G   SP   Y G Y ++++C + +  +  + I L F   +L   +   C  D+V IYDGD+ + P++G  FCG       +S+ N     F+T  F+    +               +GFN  Y  +VD            + G      I ++  T   + SP YP   P    C + L    +    ET  +  Q   +         + S +   ++ + V    +  K    DS  PD       Y     +T +          S+AF SG G       F   Y + G       C  VY  S    G + SP +   YP N  C   +    N  I ++F  F L              + +C  DF+    +I  G   S P+   + CGS++P P+    R N + L F SD   +  GF   +   P        CG  +  +   G+ TS  +P  Y +   C+W ++A   S R++    + +       C N+ L++YDG   S       CG ++ I  F ++S+ V + F          GF+L WS 
Sbjct: 3065 NINCTYHITVSNNRIIELKFNSFHLEASST-CAFDYVALYDGPNTL------APLLGKFCGTELP--PTLKTTSNDLFIV-----------FKTDSSVTGEGWRASYR--------ETLGPEQGCGGYLTASS--GMFGSPDIDYNGKYENYMDCLWTITVSSNKAINLSFLTFELEGMSSSVCRYDYVQIYDGDSVNYPLVGT-FCGTTVPAPFVSSSN-----FLTVHFVSDGSVS-------------FRGFNATYS-AVD-----------RLCGG-----IYNATSTPQTITSPYYPNAYPAFTSCRWVL----DAPAQETVKIMVQQFQL-----QSSQSCSSNYLEMKDWPVGDYGQAHKFCGSDSHIPDFY----SYDRTMHLTFQ----------SDAFMSGNG-------FSLTYQVAG-------CSRVYEQSY---GYLKSPGWPATYPHNIDCTIVLRAPQNSSISLFFDNFDLE------------SHPSCSYDFL----EIRNGSTASAPLLGKY-CGSTLPSPIFP--RINELYLHFQSDFSSARDGFEITWTSSP------QGCGGTLYGD--HGSFTSPDFPGTYANGTHCEWDIRA--PSGRVVTVSFNQIAIDDPGDCQNNYLKLYDGPDASSPPVGPYCGAETNIAPFRASSHRVFIVFHAQSVVL-PSGFRLTWSS 3626          

HSP 11 Score: 102.064 bits (253), Expect = 3.597e-21
Identity = 169/712 (23.74%), Postives = 269/712 (37.78%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCH-FYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDY-----GIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIR--GGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCG---TDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
            +SP +P  YPPN  C +         +   F   ++E   P CN D+L++       +  L     L R+C       P  + +      + F+SD      Y   D     GF+ T+         +T      C   Y D+   EG + SP +P  Y  +  C YL+   + E + L F  ++L   +  C  D+V + DG  E+ P+IG+ +CG      ILS+ N L IRF +   +  +                  GF  VY  S                          +   SG +++P +P   P NK C + +    N+ +     L F T ++                S   +F  +E+R        SP     CGT    + + T K   ++   + S          V  + F  +Y     G    + +P             +G I SP     YP    C + I     + IR+ F  F+L        +YH+     C  D+V +      G  ++  +   + CG SVP  L S    N +++ F+SDS  S  GF A Y        ++     +  +E R   G +TS  YP  Y S   C + +   + + +IM++F DF  EG   +C    + I DG  F+ +S L G   ++   P  IS SN + + F +   A   +GF   W
Sbjct:  605 RSPGYPGNYPPNRDCYWTIDVGPGLLITFAFGTLSLE-HHPDCNYDYLEI------RDGLLPEDALLNRYCS---TGSPAPLQTTGPGAWIHFHSD------YVISDQ----GFHITY---------TTSPTDPGCGGTYTDT---EGILISPNWPNNYAHNKQCVYLIRVARSETVLLNFTHMEL-EPHSGCEFDYVEVRDGLAETDPLIGK-YCGSTLPAPILSSYNHLWIRFKSDSSVSHA------------------GFRAVYEISC-----------------------GGTLSGSGQIRTPLHPDAYPHNKKCEWVI----NQAEGYVVTLNFLTFDVED--------------SAGCYFDYVEVR--DGATSSSPLLGRFCGTQVPPMLQSTQKQMYIVFNTDAS----------VTNHGFTAEYASAIQGCGDTLTDP-------------TGTITSPGHPTDYPHGANCTWYISVAPGNIIRLSFTTFNL--------EYHT----NCNYDYVEIYDN---GTALTGNLLGRY-CGRSVPPSLTS--TDNLMTILFVSDSSLSTEGFSANY--------VSLNATTDCSAEYRTPTGVLTSPNYPSNYPSTRECVYKI-IVEINMQIMLNFTDFELEGG-SNCPFDYVEIRDG-GFE-TSPLIGRYCSNQPPPIVISHSNMLWILFKSDFTATA-RGFSAHW 1167          

HSP 12 Score: 95.5153 bits (236), Expect = 2.962e-19
Identity = 157/732 (21.45%), Postives = 267/732 (36.48%), Query Frame = 3
Query:  477 IYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYI-EMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKE----QKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVG-NQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYG--IEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYP-REYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCG--TDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQR 2639
            +Y +D  G + +    SP +P+ YP N   ++         + I F   +IE        D  D Y  ++K  +    +A  LG FCG  L   P  V S  + + L+F SD            +G  GF      +E   I ++         +C   +       ++ SP +P  Y  +  C++++   +    + LLF D++       C+ D + I DG+T  SP + +  CG +    I +TR+ + +RF T D+                  +  +GFN  Y      +  T+                       G+L SP YP     N+ C++ +          T +  FQ           CSTG             LE+R        S    +CGT    + + T     V      S+A + G G  +I+       G  IE K  +P              G I SP +   YP N  C + I+  N   +++ F++F +              N+ C  D++ +     +  + S     + LCG++ P      S ++++ L F +D   +H GF A+Y            CG   I +   G I S  YP   Y  N  C+W ++    +   +   +  +   S   C N  + I +   + AS  L G     ++P  + T ++       S  +    GF L +   ++ 
Sbjct: 1868 LYGNDITGTSGQ--IASPLYPRTYPVNADYRWTITVSGDSYIQIRFLDIDIE--------DLYDCYYDQLKIFDGPNVHALPLGVFCGLLL---PGLVRSSGSTVTLEFKSDT----------VIGGRGF-----LVEWTAIQNSGPLPTISPGACGGALMPGDTPRFLFSPGWPNEYEPNQECTWVIRSPDSTVELNLLFLDIE---DEASCLYDSLVIRDGETNLSPELAR-LCGRQLPGSIHTTRDSMFLRF-TSDYS-----------------INGRGFNASYSKGCGGLLHTDR----------------------GVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTFLTPFQVQGY----GTACSTGDY-----------LELRNGPDADAPSLGGRLCGTSVPAVTQTTDNHLHVRF---VSDASNEGNGFKLIFEAHSTACGGTIELKDGDP-------------PGYITSPDYPSNYPQNIDCVWIIMVPNGESVQLDFEDFYIE------------PNTQCAYDYLEI-----RDGVNSDTDLIAKLCGNTKPS--TQHSTASAMYLRFRTDQSVTHKGFKAKYSIA--------VCGGTYIGQ--SGTIRSPGYPDSNYPDNSNCEWYLEG--PTGHYLTLSYSALNLQSSTGCVNDYVEIRE---YNASGRLLGRHCGMSLPLSVDTGDSFAYVKFVSDGSVNAPGFSLSYEASVEE 2462          

HSP 13 Score: 89.7373 bits (221), Expect = 2.058e-17
Identity = 152/699 (21.75%), Postives = 264/699 (37.77%), Query Frame = 3
Query:  513 RMFQSPNFPQKYPPNIRCKYQFVAKSQEKVV-INFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLF-RDLDLNHQNDDC-IEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQI--ICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFF-NQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS----ELCGTDSAIPAFISTSNTVHLEFIT 2579
            R   SP +P +Y PN  C +  V +S +  V +N    +IE     C  D L     ++  E+ L  +  L R CG  L   P  + +  + + L F SD +              GFN ++               + C   + + +  G ++SP YP  Y  + +CS+ ++     R+ + F     +      C   D++ + +G    +P +G   CG        +T N L +RF++         ++ +E           GF +++         T E++                    G + SP YP   P+N  C + +  + N    E+  L F+   I   P+ +C+            +  LEIR    V  D+ D I  +CG      +  T     +  R + S          V +  FK  Y I        VC   Y     +SG I SP + +  YP N+ C++ + G   H + + +   +L              ++ C  D+V + +    G ++ +       CG S+  PL  D+  +   + F+SD   +  GF   Y      +    +CG ++      G I+S  YP  Y  N +C+W +       R+ +  +D   E  H SC+   + + +G    A+S      CG+  A     S+ NT+ + F T
Sbjct: 2006 RFLFSPGWPNEYEPNQECTW--VIRSPDSTVELNLLFLDIEDEA-SCLYDSL----VIRDGETNL--SPELARLCGRQL---PGSIHTTRDSMFLRFTSDYSINGR----------GFNASYS--------------KGCGGLLHTDR--GVLSSPNYPQNYKPNQDCSWHVMVTSGFRVSVTFLTPFQVQGYGTACSTGDYLELRNGPDADAPSLGGRLCGTSVPAVTQTTDNHLHVRFVS---------DASNE---------GNGFKLIFEAHSTACGGTIELKDG---------------DPPGYITSPDYPSNYPQNIDCVWIIM-VPNG---ESVQLDFEDFYI--EPNTQCA------------YDYLEIR--DGVNSDT-DLIAKLCGNTKPSTQHSTASAMYLRFRTDQS----------VTHKGFKAKYSI-------AVCGGTY---IGQSGTIRSPGYPDSNYPDNSNCEWYLEGPTGHYLTLSYSALNLQ------------SSTGCVNDYVEIREYNASGRLLGR------HCGMSL--PLSVDTGDSFAYVKFVSDGSVNAPGFSLSY------EASVEECGGDL--NAASGTISSPNYPNLYPHNRVCRWRITV-PQGRRVTLTINDLRLE-DHGSCSFDYVEVING--LVANSPRLQRFCGSVPAGTQVKSSGNTMTVVFAT 2560          

HSP 14 Score: 85.5001 bits (210), Expect = 3.645e-16
Identity = 156/692 (22.54%), Postives = 261/692 (37.72%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVP--NFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYP-GIYPSHLNCSYLL--VGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEK-PKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYF-QEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEF 2573
            SPN+P  YP N  C+++       +V +      +E     C+ D++++      +   + N+  L RFCG     VP    V S  N + + F +D +              GFN  +          + ++   C   +D+    G  TSP Y  G Y + LNC +L+    +    I +L  D+ L H    C  D++    GD E++ ++G+  CG+  P++ I+ +   L + F       RS     DE  ++       GF V Y FS                  +C  +        G + SPGYP   P    C + L       +  T  L F    +     ++CS  S++IY+       +     +     SP  I  G++         K  +V L  +     S   GGF+  +T     G  G +                SG I SP + Q +P+N  C + II +  + + + F  +F + +            +  C+  +++V      GP        +  CGS+ P  +I  +  N I   F S       GF + +           +CG N       G + S  YP  Y ++  C + + A D +  I + F  F  E +  +C    ++IY G S   +  + LCG  + IP   +T   + L F
Sbjct: 2476 SPNYPNLYPHNRVCRWRITVPQGRRVTLTINDLRLED-HGSCSFDYVEV------INGLVANSPRLQRFCG----SVPAGTQVKSSGNTMTVVFATDSSVSNG----------GFNADY----------SSDEAAVCGGVLDTP---GNFTSPDYGIGNYSNSLNCEWLIQNPNHVNSSIVVLIDDMHLEHHQ-TCEWDYLEFRLGD-ENAELLGR-ICGQTVPEVPIVVSTPQLWVHF-------RS-----DESVVD------LGFKVTYYFS------------------DCGGY---QTGEGGTVSSPGYPDSYPSPSRCVWLL----EAPEGHTITLTFTYFEV--EEHSQCSWDSVTIYNGASAGSPII---GQYCGHSSPGTIQSGSN---------KLTVVFLADH-----SVSRGGFIATWTTDSS-GCGGTI-------------HADSGTIKSPNYPQNFPANVECSWTIIAHEGNHLEMGFASDFQIPD-----------SSGQCQSSYIKVW----SGPRAENDALLATGCGSTAPPAVI--APYNVIHARFQSTETVGK-GFSSSF---------YTRCGANF--SASAGRVVSPNYPDLYPASSNCDYLINAGDQT-VIFLTFRTFQIE-AESTCVYDGVKIYSGTSVNGNPVATLCG--NTIPGPFTTFGPMLLNF 3021          

HSP 15 Score: 78.5666 bits (192), Expect = 4.597e-14
Identity = 129/574 (22.47%), Postives = 217/574 (37.80%), Query Frame = 3
Query:  948 KKEEGYITSPTYPG--IYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVY--RFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPK-GPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD 2648
            + + G  + P  PG   Y   ++C++++  +  + +R+ F   +L H    C  D + I+DG++ S+ ++G+ +CG     ++ S+ N L   F       RS             ++   GF V +  +  V    +TN                       G ++SPGYP   P N+ C + +    +          F TL++   PD                +  LEIR   L+  D+     C T      + T  GP   +  ++    S    GF I YT            +PG C   Y   +   G++ SP +   Y  N  C Y I    +  + + F    L              +S CE D+V V   + +  P+I +       CGS++P P++  S  N + + F SDS  SH+GF A Y+           CG  +      G I +  +P  Y  N  C+W +   +    + ++F  F  E S   C    + + DG +  +      CGT    P   ST   +++ F T   +    GF   ++  +Q   D
Sbjct:  480 QGQAGTFSYPNTPGHDQYDHMVSCAWVIRTDADKILRVTFPYFELEHSTT-CSFDFLQIHDGESASAYMLGK-YCGTNAPAELFSSHNSLYFWF-------RSD-----------HIINSGGFTVSWTSQAPVCGGHLTNPY---------------------GDIRSPGYPGNYPPNRDCYWTI----DVGPGLLITFAFGTLSLEHHPDCN--------------YDYLEIR-DGLLPEDALLNRYCSTGSPAPLQTT--GPGAWIHFHSDYVISD--QGFHITYTTSP--------TDPG-CGGTY---TDTEGILISPNWPNNYAHNKQCVYLIRVARSETVLLNFTHMELE------------PHSGCEFDYVEVRDGLAETDPLIGK------YCGSTLPAPIL--SSYNHLWIRFKSDSSVSHAGFRAVYEI---------SCGGTLSGS---GQIRTPLHPDAYPHNKKCEWVINQAEGY-VVTLNFLTFDVEDS-AGCYFDYVEVRDGATSSSPLLGRFCGTQ-VPPMLQSTQKQMYIVFNTD-ASVTNHGFTAEYASAIQGCGD 941          

HSP 16 Score: 76.2554 bits (186), Expect = 2.279e-13
Identity = 66/266 (24.81%), Postives = 105/266 (39.47%), Query Frame = 3
Query:  456 YALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKP---KLKILSTRNMLLIRFITGDFIK 1244
            Y  +C  I  ++K       + +S NFP  YP N RC +         +   F  F++EGL P C  D++ LY            A  +GRFCG+T         S  ++I             +N D  + L GF   +              +  C    D     G  TSP YP  YP +  C + +  +    + +   + D+   +  C  D + +Y G   SSP + Q  C  +P    L++ ST N + +RF + ++I 
Sbjct: 1283 YTSNCSGIVIANKT----SGVIESQNFPNNYPFNARCSWTIQTTMGNTINYTFTAFDLEGLSPSCIYDYMLLYNGPNE------EAPLIGRFCGNTPPPAGATTSSSLHVI-------------FNSDLSISLPGFRMLW-------------YQNGCGG--DLSGPSGNFTSPDYPNKYPDNRECVWYIQTSPGSSVTITIHEFDI-ESHPSCDFDLLEVYGGPDLSSPRLAQ-LCTTRPPNNPLQVSSTGNTVTVRFKSDEYIS 1508          

HSP 17 Score: 75.485 bits (184), Expect = 4.215e-13
Identity = 73/270 (27.04%), Postives = 116/270 (42.96%), Query Frame = 3
Query: 1878 KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEI-----LQRLPDGSCPG 2663
            +SG  NSP +   YP N  C + II +  +R+++ F  F L +            ++ C  D++ + +    G ++ +       CG+S+P    S    + + + F+SDS  S +GF A +  +   DI               G I S  YPR Y  N   +W++     S  I I F D   E  +  C    L+I+DG +  A      CG    +P  + S+ +TV LEF  S    G +GF + W+ I     L  +  G+C G
Sbjct: 1763 ESGAFNSPNYPDAYPPNIECVWTIISSPGNRLQLSFVLFELQQ------------STGCNNDYLEIREGNSTGALVGR------FCGNSLPSNYTS-LIGHVLWVKFVSDSSVSGAGFRATFSHLYGNDITGTS-----------GQIASPLYPRTYPVNADYRWTITVSGDS-YIQIRFLDIDIEDLYD-CYYDQLKIFDGPNVHALPLGVFCGL--LLPGLVRSSGSTVTLEF-KSDTVIGGRGFLVEWTAIQNSGPLPTISPGACGG 1997          

HSP 18 Score: 73.9442 bits (180), Expect = 1.260e-12
Identity = 63/238 (26.47%), Postives = 101/238 (42.44%), Query Frame = 3
Query:  513 RMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYS-DINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            +   SP +P  YP    C++   A +QE V I      ++      ++     Y+EMK      +   H  +FCG +  H+P            DFYS D     ++  D  M   GF+ T+   ++A  +   EQ              GY+ SP +P  YP +++C+ +L   Q   I L F + DL   +  C  D + I +G T S+P++G+ +CG      I    N L + F
Sbjct: 3292 QTITSPYYPNAYPAFTSCRWVLDAPAQETVKIM-----VQQFQLQSSQSCSSNYLEMKDWPVGDYGQAH--KFCG-SDSHIP------------DFYSYDRTMHLTFQSDAFMSGNGFSLTY---QVAGCSRVYEQSY------------GYLKSPGWPATYPHNIDCTIVLRAPQNSSISLFFDNFDL-ESHPSCSYDFLEIRNGSTASAPLLGK-YCGSTLPSPIFPRINELYLHF 3492          

HSP 19 Score: 73.9442 bits (180), Expect = 1.325e-12
Identity = 57/223 (25.56%), Postives = 99/223 (44.39%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLK 1187
             +SP +P  YP NI C     A     + + F++F++E   P C+ DFL++         +  +A  LG++CG TL   P+ +    N + L F SD ++ +           GF  T+         ++  Q      Y D     G  TSP +PG Y +  +C + +       + + F  + ++    DC  +++ +YDG   SSP +G P+CG +  + 
Sbjct: 3409 LKSPGWPATYPHNIDCTIVLRAPQNSSISLFFDNFDLES-HPSCSYDFLEI------RNGSTASAPLLGKYCGSTL---PSPIFPRINELYLHFQSDFSSARD----------GFEITW---------TSSPQGCGGTLYGD----HGSFTSPDFPGTYANGTHCEWDIRAPSGRVVTVSFNQIAIDDPG-DCQNNYLKLYDGPDASSPPVG-PYCGAETNIA 3596          

HSP 20 Score: 62.003 bits (149), Expect = 5.007e-9
Identity = 113/515 (21.94%), Postives = 181/515 (35.15%), Query Frame = 3
Query:  516 MFQSPN--FPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG-CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYD---GDTESSPIIGQPFCGEKPKL-KILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSL 2039
            MF SP+  +  KY   + C +     S + + ++F  F +EG+    C  D++ +Y      +    N   +G FCG T   VP   VS  N + + F SD            +   GFN T+  ++             C    ++      ITSP YP  YP+  +C ++L    +E ++++ +   L         +++ + D   GD   +      FCG    +    S    + + F +  F+      SG+   +     Q  G + VY  S  Y                              LKSPG+P   P N  CT  L    N     +  L F   ++   P   CS   L I +       L  +     LP SP        +  I E         L L+  + FSS   GF I +T     G  G +                 G   SP F   Y + T C++DI   +   + + F + ++ + G  +  Y  L
Sbjct: 3171 MFGSPDIDYNGKYENYMDCLWTITVSSNKAINLSFLTFELEGMSSSVCRYDYVQIY------DGDSVNYPLVGTFCGTT---VPAPFVSSSNFLTVHFVSD----------GSVSFRGFNATYSAVD-----------RLCGGIYNATSTPQTITSPYYPNAYPAFTSCRWVLDAPAQETVKIMVQQFQLQSSQSC-SSNYLEMKDWPVGDYGQA----HKFCGSDSHIPDFYSYDRTMHLTFQSDAFM------SGNGFSLT---YQVAGCSRVYEQSYGY------------------------------LKSPGWPATYPHNIDCTIVLRAPQN----SSISLFFDNFDLESHP--SCSYDFLEIRNGSTASAPLLGKYCGSTLP-SP-------IFPRINE---------LYLHFQSDFSSARDGFEITWT-SSPQGCGGTLYG-------------DHGSFTSPDFPGTYANGTHCEWDIRAPSGRVVTVSFNQIAIDDPGDCQNNYLKL 3574          

HSP 21 Score: 53.5286 bits (127), Expect = 2.148e-6
Identity = 59/238 (24.79%), Postives = 103/238 (43.28%), Query Frame = 3
Query: 1935 CQYDIIGNN--NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA-SSELCGTDSAIPAFIST--SNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            C + II     NH + + F +F L            + NS C  D V ++       P + +       CG+ VP P+ S   SN++ + F++D+  +  GF A Y            CG N+   +  G   S  YP  Y  N+ C W++ +    NR+ + F  F  + S   C N  L I +G+S  A     CG  +++P+  ++   + + ++F++     G  GF+  +S +
Sbjct: 1664 CNWIIIAQEPFNH-VTLSFTDFELE-----------MINSNCSHDAVEILDGDNSDAPSVGR------YCGNDVPHPVTS--FSNALVVNFVTDASVTRKGFRATYT------ASTSGCGGNL--HMESGAFNSPNYPDAYPPNIECVWTIIS-SPGNRLQLSFVLFELQQS-TGCNNDYLEIREGNSTGALVGRFCG--NSLPSNYTSLIGHVLWVKFVSDSSVSG-AGFRATFSHL 1868          
BLAST of Cubilin vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 143.665 bits (361), Expect = 2.562e-34
Identity = 172/727 (23.66%), Postives = 282/727 (38.79%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPP--TPDNK-----CSTGSLSIYSIRPFFVKLEIRPQKLVLPDS------PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            F SP +P  YP    C ++      EK+V+NF   ++        K  L  Y  ++  +     A  LGRFCG   D VP  ++S  + + ++F S  N              GF   ++ I                   D  K+ G I SP YP  Y     C + +  ++   + L F+  ++  ++D C  D++ + DG +ESSP+IG+ FCG      I ST N L ++F++   + ++        E  + +K +    +++  N +  F                    C   +    K +G + +PG+P   P NK C + +      R  M+  V K+  + +    + D+K     C T    + + +   +++E +    V           D+  C  D          G      +NT  ++        + +  K D        E    H ++    + SG I+SP +   YPS   C +DI     HRI+I F EF + +   +   Y  L+    E D         K  I+S+      LCGS +P PLI  S  N + L FISD+     GF A +         + +CG  + +E R  N+ S      N YP     +  C+W + A ++   I + F  F  E     C    + +YDG    A      CG+        S  +TV + F  S     +KGF +
Sbjct:  254 FSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL-------YKSSLCWYDYIEVRDGYWRKAPLLGRFCG---DKVPEMLISTESRMWIEFRSSSNWVGK----------GFAAVYEAICGG----------------DVTKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEIE-RHDSCAYDYLEVRDGLSESSPLIGR-FCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECVKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLS---KLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEVCKYDFVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKD---------NGGCQHECINTIGSYVCQCRNGFVLHENKHD------CKEAECEHTIH----SPSGTISSPNWPDKYPSRKECTWDITATPGHRIKITFNEFEIEQH--QECAYDHLEAFDGESD---------KSSILSR------LCGSKIPEPLI--STGNKMYLRFISDASVQRKGFQATH---------STECGGRLKAEARQKNLYSHAQFGDNNYP----GHTDCEWLITA-EAGYSIELTFTTFEVE-EEADCGYDYIELYDGHDTSAHKLGRFCGS-GPREELYSAGDTVLIHF-HSDDTISKKGFHI 884          

HSP 2 Score: 65.855 bits (159), Expect = 2.391e-10
Identity = 68/236 (28.81%), Postives = 99/236 (41.95%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFI-STSNTVHLEFIT 2579
            G  +SP +   YPS T C + I      +I + F    L             K+S C  D++ V      K P++ +       CG  VP  LIS    + + + F S S     GF A Y+ I         CG ++  +   G I S  YP +YR +  C W +   +  N + + F  F  E  H SCA   L + DG  +S       CG D   P  I STSNT+ ++F++
Sbjct:  252 GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL------------YKSSLCWYDYIEVRDGYWRKAPLLGR------FCGDKVPEMLIS--TESRMWIEFRSSSNWVGKGFAAVYEAI---------CGGDVTKD--SGQIQSPNYPDDYRPSKECVWRITVSEGYN-VGLSFQAFEIE-RHDSCAYDYLEVRDGLSESSPLIGRFCGYDK--PEDIRSTSNTLWMKFVS 452          

HSP 3 Score: 56.6102 bits (135), Expect = 2.009e-7
Identity = 29/88 (32.95%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            G  +SP YP  YPS+ +C + +     E+I L F  +DL +++  C  D++ + DG    +P++G+ FCG+K    ++ST + + I F
Sbjct:  252 GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL-YKSSLCWYDYIEVRDGYWRKAPLLGR-FCGDKVPEMLISTESRMWIEF 337          
BLAST of Cubilin vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 143.28 bits (360), Expect = 4.086e-34
Identity = 172/727 (23.66%), Postives = 282/727 (38.79%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPP--TPDNK-----CSTGSLSIYSIRPFFVKLEIRPQKLVLPDS------PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            F SP +P  YP    C ++      EK+V+NF   ++        K  L  Y  ++  +     A  LGRFCG   D VP  ++S  + + ++F S  N              GF   ++ I                   D  K+ G I SP YP  Y     C + +  ++   + L F+  ++  ++D C  D++ + DG +ESSP+IG+ FCG      I ST N L ++F++   + ++        E  + +K +    +++  N +  F                    C   +    K +G + +PG+P   P NK C + +      R  M+  V K+  + +    + D+K     C T    + + +   +++E +    V           D+  C  D          G      +NT  ++        + +  K D        E    H ++    + SG I+SP +   YPS   C +DI     HRI+I F EF + +   +   Y  L+    E D         K  I+S+      LCGS +P PLI  S  N + L FISD+     GF A +         + +CG  + +E R  N+ S      N YP     +  C+W + A ++   I + F  F  E     C    + +YDG    A      CG+        S  +TV + F  S     +KGF +
Sbjct:  298 FSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL-------YKSSLCWYDYIEVRDGYWRKAPLLGRFCG---DKVPEMLISTESRMWIEFRSSSNWVGK----------GFAAVYEAICGG----------------DVTKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEIE-RHDSCAYDYLEVRDGLSESSPLIGR-FCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECVKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLS---KLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEVCKYDFVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKD---------NGGCQHECINTIGSYVCQCRNGFVLHENKHD------CKEAECEHTIH----SPSGTISSPNWPDKYPSRKECTWDITATPGHRIKITFNEFEIEQH--QECAYDHLEAFDGESD---------KSSILSR------LCGSKIPEPLI--STGNKMYLRFISDASVQRKGFQATH---------STECGGRLKAEARQKNLYSHAQFGDNNYP----GHTDCEWLITA-EAGYSIELTFTTFEVE-EEADCGYDYIELYDGHDTSAHKLGRFCGS-GPREELYSAGDTVLIHF-HSDDTISKKGFHI 928          

HSP 2 Score: 66.2402 bits (160), Expect = 1.923e-10
Identity = 68/236 (28.81%), Postives = 99/236 (41.95%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFI-STSNTVHLEFIT 2579
            G  +SP +   YPS T C + I      +I + F    L             K+S C  D++ V      K P++ +       CG  VP  LIS    + + + F S S     GF A Y+ I         CG ++  +   G I S  YP +YR +  C W +   +  N + + F  F  E  H SCA   L + DG  +S       CG D   P  I STSNT+ ++F++
Sbjct:  296 GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL------------YKSSLCWYDYIEVRDGYWRKAPLLGR------FCGDKVPEMLIS--TESRMWIEFRSSSNWVGKGFAAVYEAI---------CGGDVTKD--SGQIQSPNYPDDYRPSKECVWRITVSEGYN-VGLSFQAFEIE-RHDSCAYDYLEVRDGLSESSPLIGRFCGYDK--PEDIRSTSNTLWMKFVS 496          

HSP 3 Score: 56.6102 bits (135), Expect = 2.040e-7
Identity = 29/88 (32.95%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            G  +SP YP  YPS+ +C + +     E+I L F  +DL +++  C  D++ + DG    +P++G+ FCG+K    ++ST + + I F
Sbjct:  296 GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL-YKSSLCWYDYIEVRDGYWRKAPLLGR-FCGDKVPEMLISTESRMWIEF 381          
BLAST of Cubilin vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 143.28 bits (360), Expect = 4.228e-34
Identity = 172/727 (23.66%), Postives = 282/727 (38.79%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRL------ESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPP--TPDNK-----CSTGSLSIYSIRPFFVKLEIRPQKLVLPDS------PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            F SP +P  YP    C ++      EK+V+NF   ++        K  L  Y  ++  +     A  LGRFCG   D VP  ++S  + + ++F S  N              GF   ++ I                   D  K+ G I SP YP  Y     C + +  ++   + L F+  ++  ++D C  D++ + DG +ESSP+IG+ FCG      I ST N L ++F++   + ++        E  + +K +    +++  N +  F                    C   +    K +G + +PG+P   P NK C + +      R  M+  V K+  + +    + D+K     C T    + + +   +++E +    V           D+  C  D          G      +NT  ++        + +  K D        E    H ++    + SG I+SP +   YPS   C +DI     HRI+I F EF + +   +   Y  L+    E D         K  I+S+      LCGS +P PLI  S  N + L FISD+     GF A +         + +CG  + +E R  N+ S      N YP     +  C+W + A ++   I + F  F  E     C    + +YDG    A      CG+        S  +TV + F  S     +KGF +
Sbjct:  377 FSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL-------YKSSLCWYDYIEVRDGYWRKAPLLGRFCG---DKVPEMLISTESRMWIEFRSSSNWVGK----------GFAAVYEAICGG----------------DVTKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEIE-RHDSCAYDYLEVRDGLSESSPLIGR-FCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECVKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLS---KLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEVCKYDFVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKD---------NGGCQHECINTIGSYVCQCRNGFVLHENKHD------CKEAECEHTIH----SPSGTISSPNWPDKYPSRKECTWDITATPGHRIKITFNEFEIEQH--QECAYDHLEAFDGESD---------KSSILSR------LCGSKIPEPLI--STGNKMYLRFISDASVQRKGFQATH---------STECGGRLKAEARQKNLYSHAQFGDNNYP----GHTDCEWLITA-EAGYSIELTFTTFEVE-EEADCGYDYIELYDGHDTSAHKLGRFCGS-GPREELYSAGDTVLIHF-HSDDTISKKGFHI 1007          

HSP 2 Score: 66.2402 bits (160), Expect = 1.884e-10
Identity = 68/236 (28.81%), Postives = 99/236 (41.95%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK-IPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFI-STSNTVHLEFIT 2579
            G  +SP +   YPS T C + I      +I + F    L             K+S C  D++ V      K P++ +       CG  VP  LIS    + + + F S S     GF A Y+ I         CG ++  +   G I S  YP +YR +  C W +   +  N + + F  F  E  H SCA   L + DG  +S       CG D   P  I STSNT+ ++F++
Sbjct:  375 GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL------------YKSSLCWYDYIEVRDGYWRKAPLLGR------FCGDKVPEMLIS--TESRMWIEFRSSSNWVGKGFAAVYEAI---------CGGDVTKD--SGQIQSPNYPDDYRPSKECVWRITVSEGYN-VGLSFQAFEIE-RHDSCAYDYLEVRDGLSESSPLIGRFCGYDK--PEDIRSTSNTLWMKFVS 575          

HSP 3 Score: 56.225 bits (134), Expect = 2.125e-7
Identity = 29/88 (32.95%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            G  +SP YP  YPS+ +C + +     E+I L F  +DL +++  C  D++ + DG    +P++G+ FCG+K    ++ST + + I F
Sbjct:  375 GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDL-YKSSLCWYDYIEVRDGYWRKAPLLGR-FCGDKVPEMLISTESRMWIEF 460          
BLAST of Cubilin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007253.1 (pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1 gene:ENSPMAG00000006538.1 transcript:ENSPMAT00000007253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 1.887e-26
Identity = 162/735 (22.04%), Postives = 284/735 (38.64%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DE-IKMNPKLLQKKGFNVV--YRFSVD--YVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG-IHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEI------RPQKLVLPDSPDQIICGTDYR-----EIKEITC-KGPLVLLRLNTSNAFSSGI-GGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPRE-----------YRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQA--SSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
            F SP FP  YP    C ++      EK+ +NF   ++        K  L  Y  ++  +     A  LGR CG   D +P  +VS  + + ++F S  N              GF+  ++ I    +N                +E G I SP YP  Y     C + +   +   + L F+  ++  ++D+C  D++ + DGD +SS +IG+ +CG +    I S+ N L ++F++   + ++   +      DE  + +    ++   N +  YR + D  Y    ++       G   +       K +G + SPG+P   P NK C + +      R  ++    + +  ++      +  +G  S   +   F   E+      +   L L    D  +    ++     +  E +   G      +NT  ++S     GF+++     + G + K V    C    N   +  GVI+SP +   YP+   C ++I     HR+++ F EF + +            +  C  D + V      K PI+ +       CGS  P  ++  S  N + L F+SD+     GF A                  I S + GG + ++  PRE           Y   L C W + A D    + + F  F  E     C    + +YDG S  A      CG+      + S+ +++ + F  S    G+KGF
Sbjct:  225 FSSPGFPNGYPSYSHCVWKISVTPGEKITLNFTSLDV-------FKSRLCWYDYIEVRDGFWRKAPLLGRVCG---DKLPEPLVSTSSWMWIEFRSSSNWVGR----------GFSAAYEAICGGEVN----------------RENGQIQSPNYPDDYRPSKECVWKISVTEGFIVGLTFQAFEI-EKHDNCAYDYLEVRDGDNDSSQLIGR-YCGYEKPDDIKSSSNKLWMKFVSDSSVNKAGFAANFFKEIDECARPDNGGCEQNCVNTLGSYRCACDPGYELAPDKRSCEAACGGFLN-------KLNGTMTSPGWPKEYPPNKHCVWQVVAPAQYRISLQFEFFELEGNDVCKYDYVEIRSGLSSESKLHGKFCGTELPDVITSQNNNLRLEFKSDNTVSKKGFKVHFFSDKDECSQHNGGCQHDCINTLGSYSCQCRNGFMLH-----ENGHDCKEVSTAGCEHKIN---SAEGVISSPNWPDKYPNRRECTWEISATPGHRVKLTFSEFEVEQ------------HQECAYDHLEVYDGSSEKAPILGR------FCGSKKPEAVL--STLNKMYLRFMSDASVQKRGFQA------------------IHSTVCGGKLRADVAPRELYSHAQFGDNNYPGQLDCDWVITAEDGYG-VELTFLTFEIE-EEADCGYDYMELYDGYSADALRLGRFCGSGPPEEVY-SSGDSIMIRF-HSDDTIGKKGF 864          

HSP 2 Score: 90.8929 bits (224), Expect = 1.194e-18
Identity = 132/628 (21.02%), Postives = 235/628 (37.42%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEI----APINSTKEQ----------------------KESCHFYIDS--KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLE-----SGDEIKMNPKLLQKKGFNVVYRFSVD----YVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGF-VIYYTFKRDYGIEGK---MVEPGVCHFVYNIS-STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHK 2279
            QSPN+P  Y P+  C ++        V + F+ F IE     C  D    Y+E++  ++   +++ +GR+CG+     P+ + S  N + + F SD +  ++          GF   F F EI     P N   EQ                      K SC         K  G +TSP +P  YP + +C + +V   + RI L F   +L   ND C  D+V I  G +  S + G+ FCG +    I S  N L + F + + + +   +       DE   +    Q    N +  +S      ++   N  +   +    C+  I S+E   G++ SP +P + P  + CT+                      I  TP ++          ++  F + E+   +           C  D+ E+ + + +   +L R   S    + +     +Y  F  D  ++ +    +   VC        + +    ++ F +  YP    C + I   + + + + F  F + E+            + C  D++ +          +  +     CGS  P  + S    +SI + F SD      GF+A+Y     QD ++ K
Sbjct:  339 QSPNYPDDYRPSKECVWKISVTEGFIVGLTFQAFEIE-KHDNCAYD----YLEVRDGDND--SSQLIGRYCGY---EKPDDIKSSSNKLWMKFVSDSSVNKA----------GFAANF-FKEIDECARPDNGGCEQNCVNTLGSYRCACDPGYELAPDKRSCEAACGGFLNKLNGTMTSPGWPKEYPPNKHCVWQVVAPAQYRISLQFEFFEL-EGNDVCKYDYVEIRSGLSSESKLHGK-FCGTELPDVITSQNNNLRLEFKSDNTVSKKGFKVHFFSDKDECSQHNGGCQHDCINTLGSYSCQCRNGFMLHENGHDCKEVSTAGCEHKINSAE---GVISSPNWPDKYPNRRECTW---------------------EISATPGHR----------VKLTFSEFEVEQHQE----------CAYDHLEVYDGSSEKAPILGRFCGSKKPEAVLSTLNKMYLRFMSDASVQKRGFQAIHSTVCGGKLRADVAPRELYSHAQFGDNNYPGQLDCDWVITAEDGYGVELTFLTFEIEEE------------ADCGYDYMELYDGYS-----ADALRLGRFCGSGPPEEVYSS--GDSIMIRFHSDDTIGKKGFHARYTSTKFQDALHAK 880          

HSP 3 Score: 82.4185 bits (202), Expect = 4.064e-16
Identity = 64/244 (26.23%), Postives = 107/244 (43.85%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKR 1247
            +  SPN+P KYP    C ++  A    +V + F  F +E     C  D L++Y      + +   A  LGRFCG      P  V+S  N + L F SD + Q+   Q  H  + G  G  +  ++AP                    E Y  +      YP  L+C +++       + L F   ++  +  DC  D++ +YDG +  +  +G+ FCG  P  ++ S+ + ++IRF + D I +
Sbjct:  652 VISSPNWPDKYPNRRECTWEISATPGHRVKLTFSEFEVEQHQE-CAYDHLEVY------DGSSEKAPILGRFCG---SKKPEAVLSTLNKMYLRFMSDASVQKRGFQAIHSTVCG--GKLR-ADVAP-------------------RELYSHAQFGDNNYPGQLDCDWVITAEDGYGVELTFLTFEIEEEA-DCGYDYMELYDGYSADALRLGR-FCGSGPPEEVYSSGDSIMIRFHSDDTIGK 861          

HSP 4 Score: 62.003 bits (149), Expect = 8.140e-10
Identity = 64/236 (27.12%), Postives = 99/236 (41.95%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFI-STSNTVHLEFIT 2579
            G  +SP F   YPS + C + I      +I + F    +             K+  C  D++ V      K P++ +      +CG  +P PL+S S  + + + F S S     GF A Y+ I         CG  +  E   G I S  YP +YR +  C W +   +    + + F  F  E  H +CA   L + DG  DS Q     CG +   P  I S+SN + ++F++
Sbjct:  223 GNFSSPGFPNGYPSYSHCVWKISVTPGEKITLNFTSLDV------------FKSRLCWYDYIEVRDGFWRKAPLLGR------VCGDKLPEPLVSTS--SWMWIEFRSSSNWVGRGFSAAYEAI---------CGGEVNRE--NGQIQSPNYPDDYRPSKECVWKISVTEGF-IVGLTFQAFEIE-KHDNCAYDYLEVRDGDNDSSQLIGRYCGYEK--PDDIKSSSNKLWMKFVS 423          

HSP 5 Score: 50.0618 bits (118), Expect = 3.698e-6
Identity = 27/88 (30.68%), Postives = 49/88 (55.68%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            G  +SP +P  YPS+ +C + +     E+I L F  LD+  ++  C  D++ + DG    +P++G+  CG+K    ++ST + + I F
Sbjct:  223 GNFSSPGFPNGYPSYSHCVWKISVTPGEKITLNFTSLDV-FKSRLCWYDYIEVRDGFWRKAPLLGR-VCGDKLPEPLVSTSSWMWIEF 308          
BLAST of Cubilin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010323.1 (pep scaffold:Pmarinus_7.0:GL476365:125003:472029:-1 gene:ENSPMAG00000009333.1 transcript:ENSPMAT00000010323.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 1.159e-14
Identity = 98/394 (24.87%), Postives = 160/394 (40.61%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQ--------QSYNQDD-----------------HMG-LLGFNGTFKFI--EIAPINSTKEQKESCHFYIDSKKEE-----------GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT-------GDFIKRSRLESGDEIKMNPKLL---QKKGF------------NVVYRFSVDYVKITNE-MEKNHIIGT---ECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRN 1511
            SPN+P+ Y  N+ C +  VA +  ++ + F  F +E        DFL +       +    +A  LG F G     VP  +VS  N   L+F SD +T          ++  +D                 H+G ++ F     FI  E + I +   +  +  +  +  K E           G I SP +PG+Y   L+C +++   Q   IRL+F+       N D ++    IYDG + SSP+ G  F G +    + ST N LL+ F T       G  I    +     + ++P +    Q+ G             N  Y  S +   I ++ ++ +H + +    C  +I +S   SGI+ SPGYP   P    CT+ +   H + 
Sbjct:  572 SPNYPEHYGSNMNCIWLIVAPAGSRIRLVFADFEVESQF-----DFLAVK------DGDRHDAPLLGTFSG---ADVPGNLVSASNTFRLEFLSDHSTPGRGFNISYTTFGHNDCYDPGNPVNGRRFGTKFHLGSMVSFTCEKGFIRTEGSEILTCVSRDGNIEWNENVPKCEAPCGGHLTSLAGIILSPGWPGLYKDSLSCEWIIEAQQGHAIRLIFKSRFQTEVNYDVLQ----IYDGASTSSPLTGS-FHGTQVPEFLASTGNTLLLHFTTDNSRSNVGFQILYESITLSTHLCLDPGVPVHGQRHGTEMSVGSMVTFSCNSGYTLSHEEALICDKNLQWSHPMASCDAPCGGYIHAS---SGIILSPGYPDYYPNTLNCTWTVEVSHGKG 943          

HSP 2 Score: 67.3958 bits (163), Expect = 2.312e-11
Identity = 73/287 (25.44%), Postives = 113/287 (39.37%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVV-INFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLG--RFCGHTLD--HVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIA---------PINSTKE-----QKESCHFYIDSKKEE---------------------------------GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            SPNFP +Y  N +C +   A    KV+ INFE F++E       + F  L         T+ + + +G  R   H L    VP+ VVS+   + L   +D          D  G LGF   ++  EIA         P +  +E      ++S  F   +  E                                  G + SP YP  Y S++NC +L+V     RIRL+F D ++  Q      D + + DGD   +P++G  F G      ++S  N   + F++
Sbjct:  399 SPNFPVQYDNNAQCVWTITASRPSKVIEINFEEFDLE-------RGFDTL---------TVGDGEEVGDPRMVLHVLTGTSVPDLVVSMTGHMWLHLQTD----------DSAGSLGFKIIYR--EIAERSCGDPGVPQHGRREGSGFSHRDSLTFECQAAFELVGEKTITCQSNNQWSANVPHCIFPCVFNFTSPIGIVLSPNYPEHYGSNMNCIWLIVAPAGSRIRLVFADFEVESQ-----FDFLAVKDGDRHDAPLLGT-FSGADVPGNLVSASNTFRLEFLS 651          
BLAST of Cubilin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008741.1 (pep scaffold:Pmarinus_7.0:GL478849:6130:19306:1 gene:ENSPMAG00000007913.1 transcript:ENSPMAT00000008741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 3.516e-13
Identity = 62/265 (23.40%), Postives = 106/265 (40.00%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKS--QEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDL----------------DLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES 1262
             SP FP +Y P   C++   A    Q   VI   HF++EG    C  D    Y+E++  +    +A  +GR+CG      P  +VS  + + + F SD   Q +          GF+  ++          K   + C +   +    G ++SP +P  Y  +L C+Y +    +  + L F                    L     DC  D + ++DG +   P+IG  +CG +    + S+  +L +RF T   + R    +
Sbjct:   15 SSPGFPNEYLPRQHCEWVLRAPGPDQRLSVIFNPHFDLEGH--NCRFD----YVELRDGDGP--SADIIGRYCGMV---APGLLVSSGSALFVRFESDYAHQGA----------GFSLHYEI--------HKSGSDDCSWNFTAPS--GVLSSPGFPDKYSHYLECTYTVWAGPRRDLVLRFTHFHVEGVSRGPPGAGPNPHLAGGVTDCPYDRLEVWDGLSNVGPLIGH-YCGRRAPWVLRSSTGVLSLRFFTDAAVARDGFSA 247          
BLAST of Cubilin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008025.1 (pep scaffold:Pmarinus_7.0:GL476353:328552:336612:1 gene:ENSPMAG00000007257.1 transcript:ENSPMAT00000008025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 2.156e-12
Identity = 61/243 (25.10%), Postives = 92/243 (37.86%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSL----ESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQND--DCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            F SP +P  YP    C +     +     + F    +E    GC  D++ +Y   +          FN   L           P FV      +++ F+SD N          +G  GF   +               + C   + +   +G + SP YPG YP  + C +LL      R+RL FRD  L   ++   C  D V ++DG+TE+       FCG +      ST + LLI   T
Sbjct:  147 FASPAYPSHYPNGADCVWALGHSAASVTALAFRDLLLEEG-EGCGFDYVAVYAGGEEAGGDGSERCFNGTDL-----------PTFVSPPGRRLLVVFHSDYN----------IGARGFLAEY-------------HTDECQRTLTAL--QGDVHSPRYPGPYPGGVRCRWLLAVPPPLRLRLSFRDFHLEESDERGHCGYDQVALFDGETENENSSLGRFCGSRMPPATTSTSSKLLITMHT 352          

HSP 2 Score: 58.9214 bits (141), Expect = 5.168e-9
Identity = 52/212 (24.53%), Postives = 80/212 (37.74%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDH------------VPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY 1121
            +SP  P  YP    C +  VA +  ++ + F  F++E   P C  D L L+         L      GR+CG    +             P  ++S  +++ L F+SD +  +S          GF   F               E C   +      G   SP YP  YP+  +C + L  +      L FRDL L  + + C  D+V +Y
Sbjct:   18 RSPRHPAPYPALADCLWLLVAPAGARLTLAFSAFSLEPH-PACAYDALTLWDGQPGTAGAL-----RGRYCGERGRNGSEEAPRPPGVIPPAALISSGHVVGLQFHSDKHVSRS----------GFLIAF-------------DTEDCGGPLSGPS--GSFASPAYPSHYPNGADCVWALGHSAASVTALAFRDL-LLEEGEGCGFDYVAVY 197          
BLAST of Cubilin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007646.1 (pep scaffold:Pmarinus_7.0:GL489134:1272:7172:1 gene:ENSPMAG00000006907.1 transcript:ENSPMAT00000007646.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.295e-11
Identity = 40/113 (35.40%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  885 EIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            +IAP   T+E+   C  + DSK   G  TSP YP  YP + +C Y+L    ++RI L F        + DC  DH+ + DG    SP+IG+ FCG      + ST   + ++F
Sbjct:    3 QIAP---TREETARCGVWTDSK-WGGTFTSPKYPDPYPPNQDCIYILEAPARQRIELSFSAPYSLEPSWDCKFDHIEVRDGPFGFSPLIGR-FCGHVLPRPVNSTGRFMWVKF 110          

HSP 2 Score: 46.9802 bits (110), Expect = 6.715e-6
Identity = 40/153 (26.14%), Postives = 66/153 (43.14%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITS 974
            F SP +P  YPPN  C Y   A +++++ ++F   +++E   P  +  F   +IE++  +     +  +GRFCGH L   P  V S    + + F++          D  +  LGF   F FI      +       C F +     EG + S
Sbjct:   26 FTSPKYPDPYPPNQDCIYILEAPARQRIELSFSAPYSLE---PSWDCKF--DHIEVR--DGPFGFSPLIGRFCGHVL---PRPVNSTGRFMWVKFFA----------DSELEALGFRARFTFIPDPDFKTLGSPMPDCEFEMSGT--EGVVRS 156          
BLAST of Cubilin vs. Ensembl Nematostella
Match: EDO41783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3J5])

HSP 1 Score: 106.686 bits (265), Expect = 2.403e-23
Identity = 161/730 (22.05%), Postives = 270/730 (36.99%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGL-LPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSY-LLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLE-SGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSS-EKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQII---CGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGK----------------MVEPGV--------CHFVYNISSTK---SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENI--ISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPA------FISTSNTVHLEFIT 2579
             F SP +P  YP    C+++      E++V+NF  F+++      C  DF+++  +    ES L     +GRFCG     VP  + S  + + + F SD    +           GF   ++     PI                +K  G I SP YP  YPS   C + + +  +  R+ + F   D+   ++ C  D++ ++DG  E +P IG+ FCG++   ++ S  + L I+F +   I +     S    +            +      +Y        + H  G  C+          +G + SP YP   PKNK C + + G       +   LKF    +    +  C             +  +E+R       D  ++I+   CG+   E    T   P  ++ +   +  +    GF   Y    D   E K                  +PG         C    +  ST    +G+I SP F  +Y     C + I       + + F+   + E               C  D+V V           Q      +CG+++P P    SR++ + + F SDS+ +  GF A+Y            CG N+  +S+ R            Y   + C W++ A   +  I + F +F  E     C+   + I DG+S   SS L G             F+ST N +++EF+T
Sbjct:  220 AFTSPGYPSPYPLGRHCEWRISVTPGERIVLNFTVFHLKKTSFNKCKNDFVEVR-DGHGRESNL-----IGRFCG---TRVPPSIWSTGSRLWIKFKSDGVESRP----------GFKAVYETRCGGPI----------------RKAHGTIQSPKYPSWYPSSKECVWTIALPGKGSRVGMRFVAFDVE-DHEQCHYDYLQLFDGQDEWAPSIGK-FCGKEIPGEVRSNSSYLTIKFKSDASINKPGFYLSFFSERNECNNNNGGCSQICQNTLGNYKCACYPGYELHSDGKNCEAACGGVLSNGNGTITSPSYPASYPKNKRCLWRITGPSG----QRISLKFNDFRLEGNGNGVCR------------YDYVEVR-------DHENKILGRYCGSKNPE----TVTSPSNVMWVEFRSDHTQSRRGFSAKYYADEDECRERKGGCQHICVNTIGSYRCTCKPGFVLHPDQHSCKEASDCGSTVTSLTGLIMSPNFPGVYQHKKDCTWKITVTPGSHVELNFRFLQIEE------------AKECRYDYVEVFSGTGH-----QAESLGRICGNNLPSPF--RSRAHKMLIKFHSDSLIAKRGFKARY---------TAHCGANLNAVSQKRIFYSHPAYGDDNYGPKMKCNWTLTA--RNGFIKLRFKEFDIE-KEAYCSYDYVNIRDGNS--TSSPLLGKQCGSSGKKGPLEFVSTGNKMYIEFVT 852          

HSP 2 Score: 86.6557 bits (213), Expect = 3.586e-17
Identity = 151/672 (22.47%), Postives = 240/672 (35.71%), Query Frame = 3
Query:  762 FVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQN-DDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQ--KLVLPDSPDQIICGTDYREIK---EITCKGPLVLLRL------------NTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY--------------DFIPIQDIINHK---------------------CGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFK 2612
            F  SL+++ +L   S  +   +  Q +H+ L     T K         T ++              G  TSP YP  YP   +C + +     ERI L F    L   + + C  D V + DG    S +IG+ FCG +    I ST + L I+F +            D ++  P      GF  VY                    T C   I+   K  G ++SP YP   P +K C   ++ I    K     ++F   ++      +C    L +     F  + E  P   K    + P ++   + Y  IK   + +   P   L                S    + +G +        +   +GK  E         + S  +G I SP +   YP N  C + I G +  RI + F +F L  +G          N  C  D+V V     K  I+ +       CGS  P  + S   SN + + F SD  QS  GF A+Y                I +  I +++                     CG  + S    G I S  +P  Y+    C W +     S+ + ++F  F+     + C    + ++ G   QA S   +CG +   P F S ++ + ++F  S     ++GFK
Sbjct:  166 FATSLNHVTILPKRSG-DMVPAIGQREHLSLGDIRQTIKMYRCPECGRTLQEPS------------GAFTSPGYPSPYPLGRHCEWRISVTPGERIVLNFTVFHLKKTSFNKCKNDFVEVRDGHGRESNLIGR-FCGTRVPPSIWSTGSRLWIKFKS------------DGVESRP------GFKAVYE-------------------TRCGGPIR---KAHGTIQSPKYPSWYPSSKEC---VWTIALPGKGSRVGMRFVAFDV--EDHEQCHYDYLQL-----FDGQDEWAPSIGKFCGKEIPGEVRSNSSYLTIKFKSDASINKPGFYLSFFSERNECNNNNGGCSQICQNTLGNYKCACYPGYELHSDGKNCEAACG----GVLSNGNGTITSPSYPASYPKNKRCLWRITGPSGQRISLKFNDFRLEGNG----------NGVCRYDYVEVRDHENK--ILGR------YCGSKNPETVTSP--SNVMWVEFRSDHTQSRRGFSAKYYADEDECRERKGGCQHICVNTIGSYRCTCKPGFVLHPDQHSCKEASDCGSTVTSLT--GLIMSPNFPGVYQHKKDCTWKITVTPGSH-VELNFR-FLQIEEAKECRYDYVEVFSGTGHQAESLGRICGNNLPSP-FRSRAHKMLIKF-HSDSLIAKRGFK 743          

HSP 3 Score: 73.1738 bits (178), Expect = 4.719e-13
Identity = 64/272 (23.53%), Postives = 115/272 (42.28%), Query Frame = 3
Query:  504 NNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG-CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSD-INTQQSYNQD---DHMGLLGFNGTFKFIEIAPINSTK----------EQKESCHFYIDSKKE----EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLES 1262
            N      SP++P  YP N RC ++    S +++ + F  F +EG   G C  D    Y+E++  E+ +     LGR+CG      P  V S  N++ ++F SD   +++ ++     D        G  + I +  I S +            + SC    D         G I SP +PG+Y    +C++ +       + L FR L +  +  +C  D+V ++ G    +  +G+  CG        S  + +LI+F +   I +   ++
Sbjct:  487 NGNGTITSPSYPASYPKNKRCLWRITGPSGQRISLKFNDFRLEGNGNGVCRYD----YVEVRDHENKI-----LGRYCG---SKNPETVTSPSNVMWVEFRSDHTQSRRGFSAKYYADEDECRERKGGCQHICVNTIGSYRCTCKPGFVLHPDQHSCKEASDCGSTVTSLTGLIMSPNFPGVYQHKKDCTWKITVTPGSHVELNFRFLQIE-EAKECRYDYVEVFSGTGHQAESLGR-ICGNNLPSPFRSRAHKMLIKFHSDSLIAKRGFKA 744          

HSP 4 Score: 63.929 bits (154), Expect = 3.639e-10
Identity = 63/247 (25.51%), Postives = 100/247 (40.49%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKL 2615
            SG   SP +   YP    C++ I      RI + F  F L +    +          C+ DFV V     +   +         CG+ VP  + S    + + + F SD V+S  GF A Y+          +CG  I      G I S +YP  Y S+  C W++      +R+ + F  F  E  H+ C    L+++DG    A S  + CG +  IP  + ++++       S  +  + GF L
Sbjct:  218 SGAFTSPGYPSPYPLGRHCEWRISVTPGERIVLNFTVFHLKKTSFNK----------CKNDFVEVRDGHGRESNL-----IGRFCGTRVPPSIWSTG--SRLWIKFKSDGVESRPGFKAVYE---------TRCGGPIRKAH--GTIQSPKYPSWYPSSKECVWTIALPGKGSRVGMRFVAFDVE-DHEQCHYDYLQLFDGQDEWAPSIGKFCGKE--IPGEVRSNSSYLTIKFKSDASINKPGFYL 433          
BLAST of Cubilin vs. Ensembl Nematostella
Match: EDO39007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD3])

HSP 1 Score: 93.5893 bits (231), Expect = 2.574e-20
Identity = 83/347 (23.92%), Postives = 145/347 (41.79%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIP 1556
             F SP +PQ YP + RC +  +A +   V + F HF++E   P C  D +++Y      + +      +G++CGH  + +P    S  + ++++  +D++        DH    GFN ++  +           K   +  I    ++G   SP YP  Y  +  C + +      R+RL F        N  C  D+V + DG   +SP+ G+ FCG      + S+ + L IRF T                   K  ++KGF   Y          N++++                  SG + SP YP   P N  CT+ +  +  +N++E   L+F+ +++P
Sbjct:    8 FFTSPFYPQNYPNSTRCTWLILAPNDYTVTLIFHHFDVEAASP-CIFDAVNIY------DGSSIRDIQIGKYCGH--NKLPPIQKSTGSAMLVELITDVS--------DH--FTGFNCSYHVV-----------KRDINRNIRLSGKQGIFFSPNYPSFYNPNFECVWTITVPHPWRVRLSFDTFSTEGYN--CAYDYVEVRDGLGSNSPLSGK-FCGSTKPRDVYSSSSQLWIRFTTD------------------KSTEQKGFLASYS--------NNDLQE---------------AGHSGFILSPNYPSTYPTNIQCTWKI-TVPVQNQVE---LRFENISLP 276          

HSP 2 Score: 82.4185 bits (202), Expect = 1.325e-16
Identity = 68/269 (25.28%), Postives = 121/269 (44.98%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVY 1322
            +F SPN+P  Y PN  C +        +V ++F+ F+ EG    C  D++++   + S      N+   G+FCG T    P  V S  + + + F +D +T+Q           GF  ++         S  + +E+ H         G+I SP YP  YP+++ C++ +    + ++ L F ++ L      C E HV + DG +    ++G  +CG+   + I ST N++ + F++      S  + GD           +GFN+ Y
Sbjct:  127 IFFSPNYPSFYNPNFECVWTITVPHPWRVRLSFDTFSTEGY--NCAYDYVEVRDGLGS------NSPLSGKFCGSTK---PRDVYSSSSQLWIRFTTDKSTEQK----------GFLASY---------SNNDLQEAGH--------SGFILSPNYPSTYPTNIQCTWKITVPVQNQVELRFENISLPSW---CQEAHVKVIDGKSLFGNLLGT-YCGDDVPVYIHSTSNIITVMFMS------SSEDPGD----------YRGFNISY 337          

HSP 3 Score: 66.2402 bits (160), Expect = 2.834e-11
Identity = 98/413 (23.73%), Postives = 163/413 (39.47%), Query Frame = 3
Query: 1416 KTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY---SIRPFFVKLEIRPQKLVLPDSPDQIICGTD-YREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQ-KGFKLIWSEI 2630
            KTSG   SP YP   P +  CT+ +   ++     T  L F   ++     + C   +++IY   SIR      +I+  K           CG +    I++ T    LV L  + S+ F+   G    Y+  KRD     ++             S K G+  SP +   Y  N  C + I   +  R+R+ F  F             S +   C  D+V V   +      + P+   F CGS+ P  + S   S+ + + F +D      GF A Y    +Q+                G I S  YP  Y +N+ C W +      N++ + F +         C  + +++ DG S   +     CG D  +P +I STSN + + F++S +  G  +GF + ++ +
Sbjct:    4 KTSGFFTSPFYPQNYPNSTRCTWLILAPNDY----TVTLIFHHFDVEAA--SPCIFDAVNIYDGSSIR------DIQIGKY----------CGHNKLPPIQKSTGSAMLVELITDVSDHFT---GFNCSYHVVKRDINRNIRL-------------SGKQGIFFSPNYPSFYNPNFECVWTITVPHPWRVRLSFDTF-------------STEGYNCAYDYVEVRDGLGS----NSPLSGKF-CGSTKPRDVYSS--SSQLWIRFTTDKSTEQKGFLASYSNNDLQE------------AGHSGFILSPNYPSTYPTNIQCTWKITV-PVQNQVELRFENISLP---SWCQEAHVKVIDGKSLFGNLLGTYCGDD--VPVYIHSTSNIITVMFMSSSEDPGDYRGFNISYNAV 340          

HSP 4 Score: 56.225 bits (134), Expect = 4.449e-8
Identity = 101/439 (23.01%), Postives = 163/439 (37.13%), Query Frame = 3
Query:  951 KEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKIL-STRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSP-DQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQ--SHSGFYAQYDFI 2252
            K  G+ TSP YP  YP+   C++L++      + L+F   D+   +  CI D V IYDG +     IG+ +CG      I  ST + +L+  IT         +  D            GFN  Y                H++  + +  I+ S K  GI  SP YP     N  C +                   T+ +P     + S  + S       +  +E+R    +  +SP     CG+   + +++      + +R  T    S+   GF+  Y+          + E G            SG I SP +   YP+N  C + I     +++ + F+  SL               S C+   V+VI  K   G ++         CG  V  P+   S SN I++ F+S S     + GF   Y+ +
Sbjct:    4 KTSGFFTSPFYPQNYPNSTRCTWLILAPNDYTVTLIFHHFDVEAAS-PCIFDAVNIYDGSSIRDIQIGK-YCGHNKLPPIQKSTGSAMLVELIT---------DVSDHF---------TGFNCSY----------------HVVKRDINRNIRLSGK-QGIFFSPNYPSFYNPNFECVW-------------------TITVPHPWRVRLSFDTFSTEGYNCAYDYVEVRDG--LGSNSPLSGKFCGS--TKPRDVYSSSSQLWIRFTTDK--STEQKGFLASYS-------NNDLQEAG-----------HSGFILSPNYPSTYPTNIQCTWKITVPVQNQVELRFENISLP--------------SWCQEAHVKVIDGKSLFGNLLGT------YCGDDV--PVYIHSTSNIITVMFMSSSEDPGDYRGFNISYNAV 340          
BLAST of Cubilin vs. Ensembl Nematostella
Match: EDO49858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV9])

HSP 1 Score: 93.9745 bits (232), Expect = 1.374e-19
Identity = 72/251 (28.69%), Postives = 116/251 (46.22%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG------CNKDFLDLYIEMKSLESTLFN------AKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGD 1235
            F SP FP  Y PNI C Y   A    ++ I F  F++E  LPG      C  D    Y+E+K +E   ++      +    R+CG+ L   P    +L + I L F SD + +            GF+  F+ + +         + SC   +  K+  G++ S  YP ++P +  CS+ +   +   I L F   + +  +  CI  +V +YDG   +S +IGQ FCG     K++S  N L++R ++GD
Sbjct:  153 FASPGFPNLYAPNIECVYTIFAP-LGRIKIEFGTFDLE-TLPGQTQTTECESD----YVEVKEIEHVEYSTSISKPSARFRRYCGNQLP--PTVYSTLGSHIWLRFKSDSSGESK----------GFSARFRTVSVG--------EGSCEGKLSGKR--GHLFSQNYPFLFPRNKECSWEIEVEKNMHIHLFFDTFNFSRHHQQCIYGYVQVYDGPGHAS-VIGQ-FCGAVMPTKVVSRSNKLVVRALSGD 373          

HSP 2 Score: 70.8626 bits (172), Expect = 2.301e-12
Identity = 107/451 (23.73%), Postives = 158/451 (35.03%), Query Frame = 3
Query:  948 KKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEI-------TCKGPLVLLRLNTSNAFSSGIG---GFVIYYTFKRDYGIEGK---------MVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY 2243
            ++E G + SP           C YLL      RI+ +F DL L      C  D V + DG++ +S +IG+ FC +     I ST N L +RF + DF  R+ +E+                    +F + Y  I             C     SS   SG   SPG+P     N  C Y ++    R K+E      +TL                                    P       C +DY E+KEI       +   P    R    N     +    G  I+  FK D   E K          V  G C       S K G + S  +  L+P N  C ++I    N  I ++F  F+ S       ++H      C   +V+V        +I Q       CG+ +P  ++  SRSN + +  +S    +   F A+Y
Sbjct:   32 EQETGVLRSPASGRNIGEITQCDYLLQVPYGRRIKAVFIDLVLRTPCCSCKHDFVELRDGNSVNSSLIGR-FCAQNLPKIIYSTSNTLWLRFQS-DF--RTEIEN--------------------KFRLTYTAI-------------CGRHFTSS---SGSFASPGFPNLYAPNIECVYTIFAPLGRIKIEFGTFDLETL------------------------------------PGQTQTTECESDYVEVKEIEHVEYSTSISKPSARFRRYCGNQLPPTVYSTLGSHIWLRFKSDSSGESKGFSARFRTVSVGEGSCE---GKLSGKRGHLFSQNYPFLFPRNKECSWEIEVEKNMHIHLFFDTFNFS-------RHH----QQCIYGYVQVYDGPGHASVIGQ------FCGAVMPTKVV--SRSNKLVVRALSGDGANTGWFSARY 384          

HSP 3 Score: 65.855 bits (159), Expect = 7.904e-11
Identity = 86/318 (27.04%), Postives = 136/318 (42.77%), Query Frame = 3
Query: 1713 TCKGPLVLLRLNTSNAFSSGIGGF-------VIYYT-------FKRDYGIE----GKMVEPGVC--HFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRV--IQKIPKGPIISQP-IETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS-SELCGTDSAIPA-FISTSNTVHLEFITSPKA 2591
            +CK   V LR + ++  SS IG F       +IY T       F+ D+  E     ++    +C  HF     ++ SG   SP F  LY  N  C Y I      RI+I F  F L     + Q       + CE D+V V  I+ +     IS+P       CG+ +P P +  +  + I L F SDS     GF A++  + + +     C E  +S  RG ++ S  YP  +  N  C W ++  + +  I + F  F     HQ C    +++YDG    +   + CG  + +P   +S SN + +  ++   A
Sbjct:   80 SCKHDFVELR-DGNSVNSSLIGRFCAQNLPKIIYSTSNTLWLRFQSDFRTEIENKFRLTYTAICGRHF-----TSSSGSFASPGFPNLYAPNIECVYTIFAPLG-RIKIEFGTFDLETLPGQTQ------TTECESDYVEVKEIEHVEYSTSISKPSARFRRYCGNQLP-PTVYSTLGSHIWLRFKSDSSGESKGFSARFRTVSVGE---GSC-EGKLSGKRG-HLFSQNYPFLFPRNKECSWEIEV-EKNMHIHLFFDTFNFSRHHQQCIYGYVQVYDGPGHASVIGQFCG--AVMPTKVVSRSNKLVVRALSGDGA 375          
BLAST of Cubilin vs. Ensembl Nematostella
Match: EDO49966 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES8])

HSP 1 Score: 84.7297 bits (208), Expect = 6.735e-18
Identity = 60/246 (24.39%), Postives = 103/246 (41.87%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIE-GLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSR 1253
             +SP +P+ YPPN  C +   A     V +      +E G    C  D+L++       +    + + L R CG T    P   VS    + + F+S+            +G  GF G++   +  PI + K       +Y            P YP  YP+ L+C + +   +  RIR  F   D+ +    C  D++++ DG++  +P +G+  CG +      +T N  L+ F T D  ++ R
Sbjct:   20 LRSPGYPRPYPPNQDCVWVLTAPEGHNVRLTLRSSRLETGTATNCPNDYLEI------RDGPDASNRMLDRLCGSTF---PRTFVSSGQSLWVKFHSNY----------RIGYKGFYGSWTATQETPIKALKGDVNDLPYY------------PGYPNKYPAGLDCQWKVFARKDRRIRFWFGIFDI-YDERWCRYDYLSLRDGESSMAPSLGR-HCGNRKPGPFETTGNSFLVNFRTADSHRQQR 232          

HSP 2 Score: 65.4698 bits (158), Expect = 1.897e-11
Identity = 70/260 (26.92%), Postives = 104/260 (40.00%), Query Frame = 3
Query: 1872 STKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAF-DSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQK-GFKLIWSEILQR 2639
            S  SG + SP + + YP N  C + +     H +R+  +   L E G           + C  D++    +I  GP  S  +    LCGS+ P   +S  +S  + + F S+    + GFY  +       I   K   N +    G       YP +Y + L CQW V A  D   R      D   E   + C    L + DG+S  A S    CG     P F +T N+  + F T+     Q+ GF L+W+    R
Sbjct:   14 SGTSGRLRSPGYPRPYPPNQDCVWVLTAPEGHNVRLTLRSSRL-ETGTA---------TNCPNDYL----EIRDGPDASNRM-LDRLCGSTFPRTFVSSGQS--LWVKFHSNYRIGYKGFYGSWTATQETPIKALKGDVNDLPYYPG-------YPNKYPAGLDCQWKVFARKDRRIRFWFGIFDIYDE---RWCRYDYLSLRDGESSMAPSLGRHCGNRKPGP-FETTGNSFLVNFRTADSHRQQRQGFMLVWTSYRSR 245          
BLAST of Cubilin vs. Ensembl Nematostella
Match: EDO47778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL16])

HSP 1 Score: 82.0333 bits (201), Expect = 2.433e-16
Identity = 61/244 (25.00%), Postives = 110/244 (45.08%), Query Frame = 3
Query:  504 NNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGL-LPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDD---CIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            +N   F SP FP  YP +++C ++  A     V ++F  F++E      C  D +      +S E+++     + R+CGH+    PN V S    + + F          + D+     GF   ++  +   + S+K    S           G + SP Y   YPS + C +++    + RIRL F    + + ++    C  DH+T+ DG+T S+ +IG+ +CG +  + + S+   L + F
Sbjct:   40 DNGGSFSSPRFPDLYPMDLQCVWEITAPESLHVKVSFLSFDVEECGKQACECDAVTFLDVSESGETSV-----IARYCGHS---TPNAVYSRGRTLRVVF----------STDEGDSGFGFRAKYEATQRGFVCSSKPLVIS---------NGGTLASPDYDTTYPSLVECKWIIKSPPETRIRLKFLKFSIQNCSNSRAQCTCDHLTLRDGNTSSADVIGR-YCGNELPMDLYSSGRYLWLEF 255          

HSP 2 Score: 62.7734 bits (151), Expect = 4.040e-10
Identity = 71/268 (26.49%), Postives = 115/268 (42.91%), Query Frame = 3
Query: 1884 GVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFL---CGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTE---GSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQ-KGFKLIWSEILQRLPDGSCP 2660
            G  +SP F  LYP +  C ++I    +  +++ F  F + E G +           CE D V  +        +S+  ETS +   CG S P  +   SR  ++ + F +D   S  GF A+Y+      + + K    +IS   GG + S  Y   Y S + C+W +K+     RI + F  F  +    S   C    L + DG++  A      CG +  +  + S+   + LEF +     G+ KGF   +S   +R  + SCP
Sbjct:   43 GSFSSPRFPDLYPMDLQCVWEITAPESLHVKVSFLSFDVEECGKQ----------ACECDAVTFLD-------VSESGETSVIARYCGHSTPNAVY--SRGRTLRVVFSTDEGDSGFGFRAKYEATQRGFVCSSK--PLVISN--GGTLASPDYDTTYPSLVECKWIIKS-PPETRIRLKFLKFSIQNCSNSRAQCTCDHLTLRDGNTSSADVIGRYCGNELPMDLY-SSGRYLWLEFSSDENVNGKGKGFIAEFSS--RRNGESSCP 283          
BLAST of Cubilin vs. Ensembl Medaka
Match: cubn (cubilin [Source:NCBI gene;Acc:105353827])

HSP 1 Score: 175.637 bits (444), Expect = 1.302e-43
Identity = 183/745 (24.56%), Postives = 301/745 (40.40%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSS-----EKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFIST-SNTVHLEFITSPKAYGQKGFKLIWSE---------ILQ-------RLPDGSCPGFECLKT 2681
            F SPN+P  Y PN  C +        +V + F  F++E    GC+ D+L ++      +     A  L + CG  L   P+   S H +     Y  + T  S N        GF        +A  NS       C   + S +  G + SP +P  YP++  CS+ +  +    I   F   DL      C  D++ +Y+G  E +P+IG  +CG+ P     +T + L + F T   I  S                  GF +                          MW ++          G   SPGYP + P+N+ C +++      +   +  L     ++    D  CS   L +Y         ++   +L         +C T    + +++  G L+ +R   S+A+ SG G    +   +   G  G +  P             SG I+SP +   YP+N  C + I  ++NHR+ + F +  +              ++ C  D+V     I  GP IS P+  + +CGSS+P  + S    N+I + F SDS + H GF A++         +  CG  I+++  GG I S RYP  Y  N  C W +KA +  N + + F DF  E    +C++  + I DGD++ A S    CG  S +P  +++ S+ + + FIT   +  ++GF+ ++S          ++Q         PD   P  EC+ T
Sbjct: 1164 FSSPNYPLPYHPNAECYWNIRINHGNQVELRFSDFHLESSQ-GCSFDYLAVH------DGDSAGAPLLAKLCGTELP--PSINSSSHQL-----YIKLRTDSSVNTG------GF--------LASYNS------RCEGILISGRHRGMVESPNFPNTYPANAMCSWTIQASSGNTINYTFIAFDLEASFTSCTYDYIKLYNGPNEQAPLIGT-YCGQAPPPASSTTGSALTLVFRTDSSIFMS------------------GFQM--------------------------MWFQNGCGEELTGPGGSFSSPGYPNKYPENRECIWYI----TTSAGSSITLTIHEFDVEFHQD--CSFDVLEVYG------GPDLSAPQLAK-------LCTTTTSPM-QVSSTGNLLTVRFK-SDAYVSGRGFNASWAEVQG--GCGGPITAP-------------SGEIHSPLYPNSYPANVDCSWVISVDHNHRVFLNFTDLDIE------------LHTNCTWDYV----AIHDGPSISSPL-LAHICGSSLPTSITS--TQNTIYVRFRSDSSRDHRGFSARF---------SEACGATIVTDDVGGAIASPRYPAPYPPNQNCSWFIKAQEPFNHVTLSFTDFELEAIDSNCSHDAVEILDGDNYLAPSIGRFCG--SVVPHPVTSFSSAMVVNFITD-VSVSRRGFRAVYSASTSSCGGEMVMQSGAFNSPNYPDAYPPNLECVWT 1762          

HSP 2 Score: 155.992 bits (393), Expect = 1.330e-37
Identity = 177/724 (24.45%), Postives = 291/724 (40.19%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLN-HQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG-DSFQAS-SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQR-----LPDGSCPG 2663
            F SP +P KYP N  C +     +   + +    F++E     C+ D L++Y           +A  L + C  T    P  V S  N++ + F SD           ++   GFN ++            E +  C   I +   E  I SP YP  YP++++CS+++  +   R+ L F DLD+  H N  C  D+V I+DG + SSP++    CG      I ST+N + +RF         R +S  +          +GF+  +  +     +T+++                     G + SP YP   P N+ C++F+      N +  +   F+   I    D+ CS  ++ I     +      R    V+P                 +T     +++   T  + S    GF   Y+        G+MV              +SG  NSP +   YP N  C + I  +  +R+++ F  F L  D            S+CE D++ + +    G ++ +       CGSS+P    S S  + + + F+SDS  S +GF A +         +H  G ++  E   G I S  YPR Y +N   +W++   +  + + I F D   E  +  C    L+I+DG D +       CG   A+P  I S+ +TV L F T     G +GF L W+ +        +P G+C G
Sbjct: 1394 FSSPGYPNKYPENRECIWYITTSAGSSITLTIHEFDVE-FHQDCSFDVLEVYGGPD------LSAPQLAKLC--TTTTSPMQVSSTGNLLTVRFKSDA----------YVSGRGFNASWA-----------EVQGGCGGPITAPSGE--IHSPLYPNSYPANVDCSWVISVDHNHRVFLNFTDLDIELHTN--CTWDYVAIHDGPSISSPLLAH-ICGSSLPTSITSTQNTIYVRF---------RSDSSRD---------HRGFSARFSEACGATIVTDDV--------------------GGAIASPRYPAPYPPNQNCSWFIKAQEPFNHVTLSFTDFELEAI----DSNCSHDAVEILDGDNYLAPSIGRFCGSVVP---------------HPVTSFSSAMVVNFITDVSVSRR--GFRAVYSASTS-SCGGEMV-------------MQSGAFNSPNYPDAYPPNLECVWTIRSSPGNRVQLSFLTFHLQGD------------SSCENDYLEIREGNSTGALVGR------FCGSSLPSNYTSVS-GHILWVKFVSDSSDSGAGFRATF---------SHLYGIDVTGE--SGQIASPLYPRTYPNNAHYRWTINV-EGDSYVQIRFLDMDIEDLYD-CYYDHLKIFDGPDVYHYPLGTFCGL--ALPHLIRSSGSTVTLLFKTD-TVVGGRGFLLEWTAVQNSGPSPTIPPGACGG 1974          

HSP 3 Score: 144.436 bits (363), Expect = 4.212e-34
Identity = 172/719 (23.92%), Postives = 285/719 (39.64%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIY----SIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPG 2663
            SP  P  YP    C +    +    + + F  FN+E     CN D+L++Y        T+   K +GR+CG +   VP  + S    + L F SD +          + L GF+ ++       IN+T +  E+           G+ TSP YP  YP++ +C++ ++     +I L F +  L      C  D V I DG  E+SP+IG+ FCGE+    ++S  N L +RF +      S                  GF   +  +      T                            SP YP+    N  C Y+   I++ N++E   L+F   ++  +    CS   L+++    +  P   KL                 CGT+      I      + ++L T ++ ++  GGF+  Y  +     EG +           IS    G++ SP F   YP+N  C + I  ++ + I   F  F L               ++C  D++    K+  GP    P+  ++ CG +   P  S +  ++++L F +DS    SGF   +          + CGE +     GG+ +S  YP +Y  N  C W +    + + I +  H+F  E  HQ C+  +L +Y G    A   ++LC T ++     ST N + + F +     G +GF   W+E+      G C G
Sbjct:  930 SPGHPTSYPHGANCTWFISVQPGNLIRLTFNSFNLEYHY-DCNYDYLEVYDN-----GTVETGKKIGRYCGRS---VPPSLTSSERQLTLLFVSDYS----------LSLEGFSASY-----VSINATTDCGET------FTSPTGFFTSPNYPDYYPNNRDCTFKIIVELNMQILLNFTNFHLEGFPPSCNFDFVEIRDGGYETSPLIGK-FCGEQKPPALVSHSNRLWVRFHSDSTTSHS------------------GFTAHWDGTQTGCGGTLTTATG-------------------GFSSPNYPLPYHPNAEC-YWNIRINHGNQVE---LRFSDFHLESS--QGCSFDYLAVHDGDSAGAPLLAKL-----------------CGTELP--PSINSSSHQLYIKLRTDSSVNT--GGFLASYNSR----CEGIL-----------ISGRHRGMVESPNFPNTYPANAMCSWTIQASSGNTINYTFIAFDLEA-----------SFTSCTYDYI----KLYNGPNEQAPLIGTY-CGQAP--PPASSTTGSALTLVFRTDSSIFMSGFQMMW--------FQNGCGEELTGP--GGSFSSPGYPNKYPENRECIWYITT-SAGSSITLTIHEFDVE-FHQDCSFDVLEVYGGPDLSAPQLAKLCTTTTSPMQVSSTGNLLTVRFKSDAYVSG-RGFNASWAEV-----QGGCGG 1502          

HSP 4 Score: 132.88 bits (333), Expect = 1.463e-30
Identity = 183/724 (25.28%), Postives = 271/724 (37.43%), Query Frame = 3
Query:  519 FQSPNF-PQKYPPNIRCKY--QFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKME-TAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVL-LRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIM-IHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGF 2666
            F SP +    Y  N+ C++  Q        +V+  E  ++E     C  D+L   +          N   L +FCG T   VP  VVS   + V            +  D   G LGF   + F E     +                EEG ++SP YP +YPS   C++LL       I L F   +L H +  C  D VTI++G +  SPIIGQ +CG      I S  N L I F+    +                   K GF   +         T+      II              +G +KSP +P   P +  C++ +   H  N +E T    FQ     P     C    + ++S R         P+ L+         CG+           GP+V    + T+   SSG       Y+F    G                  S  SG + SP +   YP N+ C Y I       I + FQ F L              +STC  D +++       P+ S  + T  LCGSSVPGP+   S    + + F SDS+ + +GF A+Y  IP     N   G      +   N         Y  N  C + ++    ++R++ + F+ F  E S  SC    + ++DG    A      CGT +  P   S+SN + + FIT     G  G++  ++E L   P+  C G+
Sbjct: 2572 FTSPGYLVSNYSNNLNCEWLIQNPHHINSSIVVLIEDLHLENHQT-CESDYLQFRLGDS-------NGDLLAKFCGQTTPSVP-IVVSTSELWV-----------HFQSDSSQGDLGFKAKYMFSECGGWQT---------------GEEGVLSSPNYPAMYPSPSRCAWLLEAPVGSTITLTFTYFNLEHHST-CSWDSVTIFNGGSPGSPIIGQ-YCGTTSPGTIQSGSNTLAIVFLADHSVS------------------KGGFLASWS--------TDSSGCGGII-----------HGDTGTIKSPNFPQNFPAHVECSWQIIA-HEGNHLEMTFSPDFQI----PDSSGTCQESYIKVWSGR------TQTPEALLASH------CGS--------VAPGPIVAPYNMITTRFQSSGDTAKGFSYSFSTRCGAN---------------FSAPSGRVVSPNYPADYPDNSNCNYTIDAGEQTVIILTFQVFQLE------------AHSTCFYDGLKIYNL----PVSSTAVAT--LCGSSVPGPI---STFGPMLVHFYSDSISTDTGFMAEYTAIPCGGFFNSTTGTVSSPALSIIN---------YHHNTNCTFHIRV--RADRVVNLRFNTFHLEAS-SSCRYDSVSVHDGQDSLAPLLGRFCGT-ALPPDLRSSSNELFIVFITDSSVNG-IGWRATYAETLG--PEQGCGGY 3144          

HSP 5 Score: 127.872 bits (320), Expect = 4.561e-29
Identity = 170/712 (23.88%), Postives = 273/712 (38.34%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTS-NAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISST-KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGP-IISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFI----PIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
             SP +P  YP N+ C +        +V +NF   +IE L   C  D++ ++ +  S+ S L     L   CG +L   P  + S  N I + F SD       +  DH G   F+  F               E+C   I +    G I SP YP  YP + NCS+ +   +    + L F D +L   + +C  D V I DGD   +P IG+ FCG      + S  + +++ FIT   + R                  +GF  VY  S         M+                   SG   SP YP   P N  C +                      I  +P N+          ++  F+   ++              C  DY EI+E    G LV     +S  +  + + G +++  F  D    G        H +Y I  T +SG I SP + + YP+N   ++ I    +  ++I F +  + +  +    Y  L              KI  GP +   P+ T   CG ++P  LI  S S +++L F +D+V    GF  ++  +    P   I    CG  +++      + S  +P +Y  N  C W +++  S     +   D   EGS   C    + I DG +  +   + LCG +    +F ST +++ + F +  +  GQ GF   +S+
Sbjct: 1512 HSPLYPNSYPANVDCSWVISVDHNHRVFLNFTDLDIE-LHTNCTWDYVAIH-DGPSISSPL-----LAHICGSSL---PTSITSTQNTIYVRFRSD-------SSRDHRG---FSARFS--------------EACGATIVTDDVGGAIASPRYPAPYPPNQNCSWFIKAQEPFNHVTLSFTDFELEAIDSNCSHDAVEILDGDNYLAPSIGR-FCGSVVPHPVTSFSSAMVVNFITDVSVSR------------------RGFRAVYSASTSSCGGEMVMQ-------------------SGAFNSPNYPDAYPPNLECVW---------------------TIRSSPGNR----------VQLSFLTFHLQGDS----------SCENDYLEIREGNSTGALVGRFCGSSLPSNYTSVSGHILWVKFVSDSSDSGAGFRATFSH-LYGIDVTGESGQIASPLYPRTYPNNAHYRWTINVEGDSYVQIRFLDMDIED--LYDCYYDHL--------------KIFDGPDVYHYPLGT--FCGLALPH-LIRSSGS-TVTLLFKTDTVVGGRGFLLEWTAVQNSGPSPTIPPGACGGQLVAGETPAFLFSPAWPGQYPPNQECTWLIRSPGSVVEFNVLSLDI--EGS-TPCYFDRMVIRDGATSVSPVIASLCGREPP-GSFHSTGDSMFIHFSSDSQVSGQ-GFNASYSK 2084          

HSP 6 Score: 126.331 bits (316), Expect = 1.514e-28
Identity = 175/707 (24.75%), Postives = 263/707 (37.20%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCH-FYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQK--IPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS---SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIW 2621
              SP +P  YPP   C +         +   F   N+E   P C+ DFL++       +  L     LG+FC       P  + +      L F+SD++              GF+ T+         +T      C   + DS   EG I SP +P  Y  +  C YL+     E++ L F  +DL   +  C  D+V + DG  E++P+IG+ +CG      I+S+ N L IRF + + + RS                  GF  VY  +                          +   SG  +SP +P   P NKLC + +      N+ E  V+    L             S  +      F  +E+R           +  CGT+     + T +   +  R + S +      GF   Y    D  IEG            +  +  SG I SP     YP    C + I     + IR+ F  F+L        +YH      C  D++ V     +  G  I +       CG SVP  L S  R   ++L F+SD   S  GF A Y    +       CGE   S    G  TS  YP  Y +N  C + +   + + +I+++F +F  EG   SC    + I DG  ++ S    + CG +   PA +S SN + + F  S       GF   W
Sbjct:  583 LNSPGYPGNYPPGRDCYWMVTVNPGLLITFAFGTLNLESH-PNCSYDFLEI------RDGLLPGDPVLGKFCS---TGTPAPLQTTGPFAWLHFHSDLSVSDR----------GFHITY---------TTSPSDPGCGGTFTDS---EGVIISPNWPNNYAHNRQCIYLIQLPANEKVALNFTHMDL-ETHSGCSFDYVEVRDGRVEAAPLIGK-YCGTSLPAPIVSSSNTLWIRFKSDNTVTRS------------------GFRAVYTLAC-----------------------GGTLSGSGQFRSPYHPNNYPHNKLCEWVI------NQPEGYVVTLDFL-------------SFDVEGGSCLFDFVEVRDGSSSSSPLLGK-FCGTNIPARLQSTQRSMYIQFRTDASVSNH----GFEAVY----DSAIEG----------CGDTLTGPSGTITSPGHPTSYPHGANCTWFISVQPGNLIRLTFNSFNL--------EYH----YDCNYDYLEVYDNGTVETGKKIGR------YCGRSVPPSLTSSER--QLTLLFVSDYSLSLEGFSASY----VSINATTDCGETFTSPT--GFFTSPNYPDYYPNNRDCTFKI-IVELNMQILLNFTNFHLEGFPPSCNFDFVEIRDG-GYETSPLIGKFCG-EQKPPALVSHSNRLWVRF-HSDSTTSHSGFTAHW 1146          

HSP 7 Score: 119.783 bits (299), Expect = 1.474e-26
Identity = 168/730 (23.01%), Postives = 284/730 (38.90%), Query Frame = 3
Query:  507 NRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNK-DFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEE--GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRT-PKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLV--------LLRLNTSNAF---------SSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKI-PKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRY-PREYRSNLICQWSVKAFDSSN-RIMIHFHDFVTEGSHQSCANSILRIYDGDS-FQASSELCG-TDSAIPAFISTSN-TVHLEFITSPKAYGQKGFK 2612
            +R +  SP++PQ Y P + C +  +     ++ + F+  F I G    CN  DFL++        S L       R CG T    P+ + +  N I  +F SD +T+ S          GF  TF+              ++C  +I+ +  +  GYITSP YP  YP +++C +++     E +++ F +         C+ D++ I DG T +S ++ +  CG        STR                           P      G  ++ RF  D        +  + I      +I  +    G + SPG+P    P    C ++L G           L+F   ++      + S+G                               C  DY EI+E    GPL+           ++TS++F         S+   GF +++    +    G++             +  SG I+SP +  LYP +  C+++++   + R+ +   +  L   G           ++C  D+V V+  +    P + +       CG +VP      S  NS+++ F +D+  S+ GF A Y            CG  I+    GGN TS  Y    Y +NL C+W ++     N  I++   D   E +HQ+C +  L+   GDS     ++ CG T  ++P  +STS   VH +   S  + G  GFK
Sbjct: 2093 DRGVLNSPHYPQNYQPGLNCSWFVMVTPGFRISVTFQSPFQISGSGTSCNSGDFLEVR-NGPDASSPLLGE----RLCGST---PPSLLQTTDNQIYFNFVSDGSTEAS----------GFKLTFE-----------AHSKACGGFIELRDLDPPGYITSPNYPQNYPQNIDCIWVIKVPNGEAVQIDFENEFYIESTASCLYDYLEIRDGSTLNSDLVSR-LCG--------STR---------------------------PSTQHSTGSAMLLRFRTDGSVTHIGFKAKYSIAICGGTFIGQT----GSIHSPGFPGSNYPDMSSCEWYLEGPTGH----YLTLRFSNFSL------QTSSG-------------------------------CSQDYVEIREYNATGPLLNRHCGDDLPAPIDTSDSFAFVKFVSDASTSAPGFQLFFEASVE-ACGGEL-------------NALSGTISSPNYPNLYPHSRVCRWEVVAPPDRRVTLTINDLRLEASG-----------TSCMFDYVEVLNGLGADAPRLQR------FCG-TVPAGTQVHSSGNSMAIVFRTDASISNGGFMASY-----SSDEPAVCG-GILDNPSGGNFTSPGYLVSNYSNNLNCEWLIQNPHHINSSIVVLIEDLHLE-NHQTCESDYLQFRLGDSNGDLLAKFCGQTTPSVPIVVSTSELWVHFQ---SDSSQGDLGFK 2670          

HSP 8 Score: 108.227 bits (269), Expect = 3.914e-23
Identity = 156/697 (22.38%), Postives = 259/697 (37.16%), Query Frame = 3
Query:  555 NIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPD-SPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISST---KSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDG--DSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSE 2627
            N  C +    ++   V + F  F++E     C  D + ++    SL      A  LGRFCG  L   P+   S + + ++           +  D  +  +G+  T+          T   ++ C  Y+           P   G Y   +NC + +       I L F   +L   +  C  D+V +YDG     P++G  FCG       +ST N L I+F+T   +                  Q++GFN  YR    +   T                  ++  T   L SP +P   P +  C + L    +    ET  +  QT  +   PD  CST  L I+                 L D       C +D     +    G  VL+    S+ F +G G   + +TF+                 + N S T   + G + SP +   YP +  C   +    N+ I  +F  F +              + +C  D++    +I  G   S P+   F CGS++P P+    +SN++ L   SD   +  GF   +   P      + CG  +  +   G+++S  YP  Y +   C+W++ A     R++      ++      C N+ L++YDG   S       CG ++ I  F ++S+ V + F  S  +    GF+L WS 
Sbjct: 3045 NTNCTFHIRVRADRVVNLRFNTFHLEAS-SSCRYDSVSVHDGQDSL------APLLGRFCGTALP--PDLRSSSNELFIV-----------FITDSSVNGIGWRATYA--------ETLGPEQGCGGYLSMPMGMLGSPDPNLDGRYEPSMNCVWTIEMPVNRAINLTFSSFEL-ESSATCRYDYVKVYDGHNMDFPLVGT-FCGTSIPAFFMSTGNFLTIQFVTDSSV------------------QRQGFNATYRAVPLFCGGT-----------------LNATTTIQTLTSPSFPNTYPPHTSCRWTL----DAPGQETIKVSVQTFVL--QPDQSCSTNYLQIH--------------DWPLGDFGQSHTFCASDMHP-PDFYSYGRTVLVDFK-SDHFMTGNG---LSFTFQ-----------------IANCSRTYEQEFGYLKSPGWPDTYPHDVDCTIILKAPTNNSISFFFNAFDVE------------SHDSCNFDYL----EIRNGSTASSPLIGRF-CGSTLPSPIFP--QSNTLYLHCKSDFSSTRDGFDVTWTSSP------NGCGGILYGD--HGSLSSPNYPGTYPNQSHCEWNIVA--PRGRVVTVTFGQISIDDPGDCQNNFLKLYDGPDSSSLPVGPYCGVETNIAPFRASSHQVFIVF-QSQFSILPSGFRLTWSS 3604          

HSP 9 Score: 103.219 bits (256), Expect = 1.644e-21
Identity = 157/718 (21.87%), Postives = 273/718 (38.02%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKH-----LGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFR-DLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQL-YPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY--DFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDS--FQASSELCGTDSAIPA-FISTSNTVHLEFITSPKAYGQKGFKLIWSEI 2630
            +  SPN+P  YP   RC +   A     + + F +FN+E     C+ D +           T+FN        +G++CG T    P  + S  N + + F +D +  +           GF           + S       C   I    + G I SP +P  +P+H+ CS+ ++ ++   + + F  D  +   +  C E ++ ++ G T++   +    CG      I++  NM+  RF +          SGD           KGF+  Y FS                 T C     +    SG + SP YP   P N  C Y +    +  +    +L FQ   +     + C    L IY               L +  +    +CG+       I+  GP+++   + S +  +   GF+  YT                C   +N   + +G ++SP  + + Y  NT C + I    +  + + F  F            H   +S+C  D V V   +    P++ +       CG+++P  L   S SN + + FI+DS  +  G+ A Y     P Q      CG  +   +             Y  ++ C W+++    +  I + F  F  E S  +C    +++YDG +  F      CGT  +IPA F+ST N + ++F+T   +  ++GF   +  +
Sbjct: 2688 VLSSPNYPAMYPSPSRCAWLLEAPVGSTITLTFTYFNLE-HHSTCSWDSV-----------TIFNGGSPGSPIIGQYCGTT---SPGTIQSGSNTLAIVFLADHSVSKG----------GF-----------LASWSTDSSGCGGII--HGDTGTIKSPNFPQNFPAHVECSWQIIAHEGNHLEMTFSPDFQIPDSSGTCQESYIKVWSGRTQTPEALLASHCGSVAPGPIVAPYNMITTRFQS----------SGD---------TAKGFS--YSFS-----------------TRCG---ANFSAPSGRVVSPNYPADYPDNSNCNYTI----DAGEQTVIILTFQVFQL--EAHSTCFYDGLKIY--------------NLPVSSTAVATLCGSSVP--GPISTFGPMLVHFYSDSISTDT---GFMAEYTAIP-------------CGGFFN---STTGTVSSPALSIINYHHNTNCTFHIRVRADRVVNLRFNTF------------HLEASSSCRYDSVSVHDGQDSLAPLLGR------FCGTALPPDL--RSSSNELFIVFITDSSVNGIGWRATYAETLGPEQ-----GCGGYLSMPMGMLGSPDPNLDGRYEPSMNCVWTIE-MPVNRAINLTFSSFELE-SSATCRYDYVKVYDGHNMDFPLVGTFCGT--SIPAFFMSTGNFLTIQFVTD-SSVQRQGFNATYRAV 3255          

HSP 10 Score: 102.064 bits (253), Expect = 3.602e-21
Identity = 162/694 (23.34%), Postives = 262/694 (37.75%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTY-PGIYPSHLNCSYLLVGNQ--KERIRLLFRDLDL-NHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEK-PKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQ-EFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ---KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGD-SFQASSELCGTDSAIPAFISTSNTVHLEF 2573
             SPN+P  YP +  C+++ VA    +V +      +E     C  D++++      L     +A  L RFCG         V S  N + + F +D +              GF  ++          + ++   C   +D     G  TSP Y    Y ++LNC +L+         I +L  DL L NHQ   C  D++    GD+    +    FCG+  P + I+ + + L + F       +S    GD            GF   Y FS                  EC  W    E   G+L SP YP   P    C + L          T  L F   N+     + CS  S++I++                   SP   I G         T +     L +      S   GGF+   ++  D    G ++               +G I SP F Q +P++  C + II +  + + + F  +F + +            + TC+  +++V     + P+  + S        CGS  PGP+++    N I+  F S S  +  GF   Y F       + +CG N  +    G + S  YP +Y  N  C +++ A + +  I++ F  F  E +H +C    L+IY+   S  A + LCG  S++P  IST   + + F
Sbjct: 2453 SSPNYPNLYPHSRVCRWEVVAPPDRRVTLTINDLRLEASGTSCMFDYVEV------LNGLGADAPRLQRFCGTVPAGTQ--VHSSGNSMAIVFRTDASISNG----------GFMASY----------SSDEPAVCGGILD-NPSGGNFTSPGYLVSNYSNNLNCEWLIQNPHHINSSIVVLIEDLHLENHQT--CESDYLQFRLGDSNGDLL--AKFCGQTTPSVPIVVSTSELWVHF-------QSDSSQGD-----------LGFKAKYMFS------------------ECGGWQTGEE---GVLSSPNYPAMYPSPSRCAWLL----EAPVGSTITLTFTYFNL--EHHSTCSWDSVTIFN-----------------GGSPGSPIIGQYCGTTSPGTIQSGSNTLAIVFLADHSVSKGGFLA--SWSTDSSGCGGIIH------------GDTGTIKSPNFPQNFPAHVECSWQIIAHEGNHLEMTFSPDFQIPD-----------SSGTCQESYIKVWSGRTQTPEALLASH-------CGSVAPGPIVAP--YNMITTRFQS-SGDTAKGF--SYSF-------STRCGANFSAP--SGRVVSPNYPADYPDNSNCNYTIDAGEQT-VIILTFQVFQLE-AHSTCFYDGLKIYNLPVSSTAVATLCG--SSVPGPISTFGPMLVHF 3001          

HSP 11 Score: 98.2117 bits (243), Expect = 4.562e-20
Identity = 141/576 (24.48%), Postives = 224/576 (38.89%), Query Frame = 3
Query:  942 DSKKEEGYITSPTYPG--IYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPD-QIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPD 2648
            D     G  + P  PG   Y   ++C+++L  +  + +R+ F    L  Q+  CI D + I+DGD+  S +IG+ +CG+    ++ S+ N L   F         R +S +            GF V ++             ++ + G E            G L SPGYP   P  + C    Y +   N        F TLN+   P+  CS            +  LEIR    +LP  P     C T      + T  GP   L  + S+   S  G  + Y T   D G  G   +               GVI SP +   Y  N  C Y I    N ++ + F    L              +S C  D+V V   ++   P+I +       CG+S+P P++  S SN++ + F SD+  + SGF A Y            CG  +      G   S  +P  Y  N +C+W +   +    + + F  F  EG   SC    + + DG S  +    + CGT+  IPA + ST  +++++F T   +    GF+ ++   ++   D
Sbjct:  457 DLSGPAGSFSYPNTPGHDEYDHQVSCTWVLRTDPNKILRVTFPYFHL-EQSTGCIFDFLQIHDGDSPFSYMIGK-YCGQTAPAELHSSHNALYFWF---------RSDSSNS---------GGGFTVTWQ------------AEDPVCGGEL-------TAPYGNLNSPGYPGNYPPGRDC----YWMVTVNPGLLITFAFGTLNLESHPN--CS------------YDFLEIR--DGLLPGDPVLGKFCSTGTPAPLQTT--GPFAWLHFH-SDLSVSDRGFHITYTTSPSDPGCGGTFTD-------------SEGVIISPNWPNNYAHNRQCIYLIQLPANEKVALNFTHMDLE------------THSGCSFDYVEVRDGRVEAAPLIGK------YCGTSLPAPIV--SSSNTLWIRFKSDNTVTRSGFRAVYTL---------ACGGTLSGS---GQFRSPYHPNNYPHNKLCEWVINQPEGY-VVTLDFLSFDVEGG--SCLFDFVEVRDGSSSSSPLLGKFCGTN--IPARLQSTQRSMYIQFRTD-ASVSNHGFEAVYDSAIEGCGD 919          

HSP 12 Score: 94.3597 bits (233), Expect = 7.957e-19
Identity = 168/706 (23.80%), Postives = 276/706 (39.09%), Query Frame = 3
Query:  525 SPNFPQKYPPNIRCKYQFVAKSQEKVVINFEH-FNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGI-YPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSP-FFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKLIWS 2624
            SPN+PQ YP NI C +     + E V I+FE+ F IE     C  D+L++       + +  N+  + R CG T    P+   S  + ++L F +D +             +GF   +    IA    T         +I    + G I SP +PG  YP   +C + L G     + L F +  L   +  C +D+V I + +  + P++ +  CG+     I ++ +   ++F++            D     P      GF + +  SV+              G E +         SG + SP YP   P +++C + +    +R       L    L +        ++G+  ++        L     +L       Q  CGT      ++   G  + +   T  + S+G  GF+  Y+            EP VC  +  + +   G   SP +    Y +N  C++ I   N H I         S   V  +  H   + TCE D+++       G ++++       CG + P   I  S S  + + F SDS Q   GF A+Y F         +CG     E   G ++S  YP  Y S   C W ++A   S  I + F  F  E  H +C+   + I++G S  +    + CGT S  P  I S SNT+ + F+    +  + GF   WS
Sbjct: 2223 SPNYPQNYPQNIDCIWVIKVPNGEAVQIDFENEFYIESTA-SCLYDYLEI------RDGSTLNSDLVSRLCGSTR---PSTQHSTGSAMLLRFRTDGSVTH----------IGFKAKYS---IAICGGT---------FI---GQTGSIHSPGFPGSNYPDMSSCEWYLEGPTGHYLTLRFSNFSL-QTSSGCSQDYVEIREYNA-TGPLLNR-HCGDDLPAPIDTSDSFAFVKFVS------------DASTSAP------GFQLFFEASVE------------ACGGELN-------ALSGTISSPNYPNLYPHSRVCRWEVVAPPDRR----VTLTINDLRLE-------ASGTSCMFDYVEVLNGLGADAPRL-------QRFCGT-VPAGTQVHSSGNSMAIVFRTDASISNG--GFMASYSSD----------EPAVCGGI--LDNPSGGNFTSPGYLVSNYSNNLNCEWLI--QNPHHIN--------SSIVVLIEDLHLENHQTCESDYLQFRLGDSNGDLLAK------FCGQTTPSVPIVVSTSE-LWVHFQSDSSQGDLGFKAKYMF--------SECGGWQTGE--EGVLSSPNYPAMYPSPSRCAWLLEAPVGST-ITLTFTYFNLE-HHSTCSWDSVTIFNGGSPGSPIIGQYCGTTS--PGTIQSGSNTLAIVFLAD-HSVSKGGFLASWS 2788          

HSP 13 Score: 80.4925 bits (197), Expect = 1.380e-14
Identity = 64/235 (27.23%), Postives = 103/235 (43.83%), Query Frame = 3
Query:  513 RMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLI 1217
            +   SP+FP  YPP+  C++   A  QE + ++ + F ++      ++     Y+++       F   H   FC   + H P+F  S    +++DF S           DH  + G   +F F +IA  + T EQ            E GY+ SP +P  YP  ++C+ +L       I   F   D+   +D C  D++ I +G T SSP+IG+ FCG      I    N L +
Sbjct: 3270 QTLTSPSFPNTYPPHTSCRWTLDAPGQETIKVSVQTFVLQP-----DQSCSTNYLQIHDWPLGDFGQSH--TFCASDM-HPPDF-YSYGRTVLVDFKS-----------DHF-MTGNGLSFTF-QIANCSRTYEQ------------EFGYLKSPGWPDTYPHDVDCTIILKAPTNNSISFFFNAFDV-ESHDSCNFDYLEIRNGSTASSPLIGR-FCGSTLPSPIFPQSNTLYL 3468          

HSP 14 Score: 75.0998 bits (183), Expect = 5.864e-13
Identity = 107/522 (20.50%), Postives = 188/522 (36.02%), Query Frame = 3
Query:  528 PNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKE-ITCKGPLV-----------------LLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSL 2039
            PN   +Y P++ C +         + + F  F +E     C  D++ +Y +  +++  L     +G FCG +   +P F +S  N + + F +D + Q+           GFN T++ + +            C   +++      +TSP++P  YP H +C + L    +E I++  +   L   +  C  +++ I+D                                +  GDF +     + D   M+P      G  V+  F  D+    N +     I   C    ++ E+  G LKSPG+P   P +  C              T +LK  T N                 SI  FF   ++        DS     C  DY EI+   T   PL+                  L L+  + FSS   GF + +T             P  C     I     G ++SP +   YP+ + C+++I+      + + F + S+ + G  +  +  L
Sbjct: 3157 PNLDGRYEPSMNCVWTIEMPVNRAINLTFSSFELESSAT-CRYDYVKVY-DGHNMDFPL-----VGTFCGTS---IPAFFMSTGNFLTIQFVTDSSVQRQ----------GFNATYRAVPLF-----------CGGTLNATTTIQTLTSPSFPNTYPPHTSCRWTLDAPGQETIKVSVQTFVL-QPDQSCSTNYLQIHD--------------------------------WPLGDFGQSHTFCASD---MHPPDFYSYGRTVLVDFKSDHFMTGNGLSFTFQI-ANCS---RTYEQEFGYLKSPGWPDTYPHDVDC--------------TIILKAPTNN-----------------SISFFFNAFDVESH-----DS-----CNFDYLEIRNGSTASSPLIGRFCGSTLPSPIFPQSNTLYLHCKSDFSSTRDGFDVTWT-----------SSPNGCG---GILYGDHGSLSSPNYPGTYPNQSHCEWNIVAPRGRVVTVTFGQISIDDPGDCQNNFLKL 3552          

HSP 15 Score: 66.6254 bits (161), Expect = 2.169e-10
Identity = 52/217 (23.96%), Postives = 94/217 (43.32%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCG 1169
             +SP +P  YP ++ C     A +   +   F  F++E     CN D+L++         +  ++  +GRFCG TL   P+ +    N + L   SD ++ +           GF+ T+                 C   +    + G ++SP YPG YP+  +C + +V  +   + + F  + ++    DC  + + +YDG   SS  +G P+CG
Sbjct: 3387 LKSPGWPDTYPHDVDCTIILKAPTNNSISFFFNAFDVES-HDSCNFDYLEI------RNGSTASSPLIGRFCGSTL---PSPIFPQSNTLYLHCKSDFSSTRD----------GFDVTW-----------TSSPNGCGGIL--YGDHGSLSSPNYPGTYPNQSHCEWNIVAPRGRVVTVTFGQISIDDPG-DCQNNFLKLYDGPDSSSLPVG-PYCG 3568          
BLAST of Cubilin vs. Ensembl Medaka
Match: bmp1b (bone morphogenetic protein 1 [Source:NCBI gene;Acc:100125512])

HSP 1 Score: 110.538 bits (275), Expect = 5.397e-24
Identity = 89/333 (26.73%), Postives = 148/333 (44.44%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHM-----GLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKE-------------EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSV-----------DYVKITNEMEKNHIIGTECDMWIKSSEKTSGI 1430
              +P +P  YPPN  C +Q VA +Q ++ + F+ F  EG    C  DF+++   M S +S L      GRFCG      P+ + SLHN + ++F SD NT        H           NG  +   +    S   Q  S     D+K++              G I+SP +P  YPS   C++ L      RI+++F ++D+   + +C  DH+ I+DG  + +P +G+ FCG K    ++S+ N + +RF++ + +                  QK+GF   YR              D        + N+  G++C +W+ ++EK  G+
Sbjct:  573 LNTPGWPGDYPPNKNCVWQLVAPTQYRITLLFDGFETEGN-DVCKYDFVEVRSGM-SPDSQLH-----GRFCGA---ERPDAITSLHNNLRIEFKSD-NTVSKKGFKAHFFSDIDECSKANGGCQHECVNTFGSYTCQCRSGFMLHDNKQDCKEAGCDHVVSSVSGTISSPNWPDRYPSKKACTWSLSTTPGHRIKIVFNEVDM-ETHLECAYDHLEIFDGKDDRTPTLGR-FCGTKKPAAVVSSSNKMFLRFLSDNSV------------------QKRGFETSYRAECGGNLKAAVETKDLYSHAQFGDNNYPGGSDC-LWVITAEKGYGV 873          

HSP 2 Score: 91.2781 bits (225), Expect = 4.097e-18
Identity = 145/620 (23.39%), Postives = 232/620 (37.42%), Query Frame = 3
Query:  522 QSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQS------YNQDDHMG----------LLGFNGTFKFI-----EIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEIKMNPKLLQKKGFNVVYRFSVD-YVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYG--------IHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIE-GKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIIN 2273
            QSPN+P  Y  N  C ++        V ++F+ F IE     C  D    Y+E++   S   +   LGRFCG+     P  + S  N + L F SD +  ++      + + D              L   G+++       E+A  +    Q  +C  +I S    G + +P +PG YP + NC + LV   + RI LLF   +    ND C  D V +  G +  S + G+ FCG +    I S  N L I F + + + +   ++      DE        Q +  N    ++            K       CD  + S    SG + SP +P R P  K CT+ L          + N   MET +              +C+   L I+  +      + R   L          CGT  ++   +      + LR  + N+        V    F+  Y  E G  ++  V         TK    ++ F +  YP  + C + I     + + + FQ F + E+              C  D+V +      G  +  P    + CGS  P  +   S  ++I L F SD   S  GF+A+Y     QD ++
Sbjct:  417 QSPNYPDDYQSNKMCVWRITVPESFNVGLSFQSFEIE-KHDSCAYD----YVEVRDGGSG--SDPLLGRFCGYDK---PGDLKSSSNKLWLKFVSDGSVNKAGFAASFFKEMDECSRPDRGHCEQRCLNTLGSYRCACDPGYELAA-DRRSCQTAACGGFITSLN--GSLNTPGWPGDYPPNKNCVWQLVAPTQYRITLLFDGFE-TEGNDVCKYDFVEVRSGMSPDSQLHGR-FCGAERPDAITSLHNNLRIEFKSDNTVSKKGFKAHFFSDIDECSKANGGCQHECVNTFGSYTCQCRSGFMLHDNKQDCKEAGCDHVVSS---VSGTISSPNWPDRYPSKKACTWSLSTTPGHRIKIVFNEVDMETHL--------------ECAYDHLEIFDGK------DDRTPTL-------GRFCGT--KKPAAVVSSSNKMFLRFLSDNS--------VQKRGFETSYRAECGGNLKAAV--------ETKDLYSHAQFGDNNYPGGSDCLWVITAEKGYGVEMIFQVFEIEEE------------VDCGYDYVELYD----GTDVKCPRLGRY-CGSGAPEDVY--SAGDAIVLKFHSDDSISRKGFHARYTSTKFQDTLH 954          

HSP 3 Score: 72.4034 bits (176), Expect = 2.708e-12
Identity = 77/332 (23.19%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVV--YRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFL 1490
            F SP FP  Y     C ++      EKV  N      E   P   K F        SL   +F     GRFCG   D +P+ +VS  + + ++F S  +              GF+  ++ +    +                +++ G I SP YP  Y S+  C + +   +   + L F+  ++  ++D C  D+V + DG + S P++G+ FCG      + S+ N L ++F++   + ++   +      DE  + +    +++  N +  YR + D        ++       C  +I S    +G L +PG+P   P NK C + L
Sbjct:  311 FSSPGFPIGYSAYSHCVWRISVTPGEKVTKNIRKSFDE---PADRKHF--------SLSVWVF----AGRFCG---DALPDTIVSTDSRLWVEFRSSSSWVGK----------GFSAVYEAVCGGKV----------------ERDHGQIQSPNYPDDYQSNKMCVWRITVPESFNVGLSFQSFEI-EKHDSCAYDYVEVRDGGSGSDPLLGR-FCGYDKPGDLKSSSNKLWLKFVSDGSVNKAGFAASFFKEMDECSRPDRGHCEQRCLNTLGSYRCACD-PGYELAADRRSCQTAACGGFITS---LNGSLNTPGWPGDYPPNKNCVWQL 592          

HSP 4 Score: 53.9138 bits (128), Expect = 1.304e-6
Identity = 48/154 (31.17%), Postives = 72/154 (46.75%), Query Frame = 3
Query: 2130 LCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFIT 2579
             CG ++P  ++S DSR   + + F S S     GF A Y+ +         CG  +  E   G I S  YP +Y+SN +C W +   +S N + + F  F  E  H SCA   + + DG S         CG D   P  + S+SN + L+F++
Sbjct:  366 FCGDALPDTIVSTDSR---LWVEFRSSSSWVGKGFSAVYEAV---------CGGKV--ERDHGQIQSPNYPDDYQSNKMCVWRITVPESFN-VGLSFQSFEIE-KHDSCAYDYVEVRDGGSGSDPLLGRFCGYDK--PGDLKSSSNKLWLKFVS 501          

HSP 5 Score: 53.1434 bits (126), Expect = 1.943e-6
Identity = 65/267 (24.34%), Postives = 102/267 (38.20%), Query Frame = 3
Query: 1836 EPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
            E G  H V    S+ SG I+SP +   YPS   C + +     HRI+I F E  +              +  C  D + +   K  + P + +       CG+  P  ++S   SN + L F+SD+     GF   Y           +CG N+ + +   ++ S      N YP        C W + A       MI F  F  E     C    + +YDG   +       CG+ +    + S  + + L+F  S  +  +KGF
Sbjct:  715 EAGCDHVV----SSVSGTISSPNWPDRYPSKKACTWSLSTTPGHRIKIVFNEVDME------------THLECAYDHLEIFDGKDDRTPTLGR------FCGTKKPAAVVSS--SNKMFLRFLSDNSVQKRGFETSY---------RAECGGNLKAAVETKDLYSHAQFGDNNYP----GGSDCLWVITAEKGYGVEMI-FQVFEIE-EEVDCGYDYVELYDGTDVKCPRLGRYCGSGAPEDVY-SAGDAIVLKF-HSDDSISRKGF 940          
BLAST of Cubilin vs. Ensembl Medaka
Match: bmp1a (bone morphogenetic protein 1 [Source:NCBI gene;Acc:100125511])

HSP 1 Score: 106.301 bits (264), Expect = 1.004e-22
Identity = 154/733 (21.01%), Postives = 281/733 (38.34%), Query Frame = 3
Query:  519 FQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESG-----DEI-KMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTY-----------FLYGIHNRNKMETAVLKFQTLNIPPTPDNK-----CSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGI-GGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQ-KIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITS------NRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFI-STSNTVHLEFITSPKAYGQKGFKL 2615
            F SP FP  Y   + C ++      EK+++NF   ++        +  L  Y  ++  +     A   GRFCG   D +P  ++S  + + ++F S  N              GF+  ++ I                   D K++ G I SP YP  Y  +  C + +  ++   + L F+  ++  ++D C  D++ + DG +E+SP++G+ FCG      I ++ N L ++F++   + ++   +      DE  K +    +++  N +  +                    C  +I    K +G + SPG+P   P NK C +            L+ +      +     F  +    + D+K     C +      + +   +++E +    V       Q     D    +   C+   V    NT  ++      GFV++   K D        E G  H V ++    SG I SP +   YPS   C + +     HRI+I F E  +              +  C  D +++   +  K P + +       CGS  P P+IS    N + + F SD+     GF A +         + +CG  + +E++  ++ S      N YP        C+W + A +    + + F  F  E     C    + ++DG   ++      CG  S  P  I S  +++ ++F  S     +KGF +
Sbjct:  317 FSSPGFPNGYSAYMHCIWRISVTPGEKIILNFTSMDL-------YRSHLCWYDHVEIRDGYWRKAPLKGRFCG---DKLPEPIISTDSRLWIEFRSSSNWVGK----------GFSAVYEAICGG----------------DVKRDNGQIQSPNYPDDYRPNKACIWKISVSEGYHVGLTFQSFEI-ERHDSCAYDYLEVRDGISENSPLLGR-FCGYDKPDDIKTSSNHLWMKFVSDGSVNKAGFAANFFKEMDECSKPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFIT---KLNGSITSPGWPREYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDVCKYDFVEVRSGLSADSKPHGKFCGSEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHDCV----NTFGSYRCQCRSGFVLHEN-KHD------CKEAGCDHTVNSV----SGAITSPNWPDKYPSKKACTWALSTTPGHRIKIAFNEIDME------------AHLDCAYDHIQIYDGRDAKAPSLGR------FCGSKKPQPIISS--GNKLFIRFFSDNSVQKKGFDASH---------SAECGGILKAEVKTKDLFSHAQFGDNNYP----GASDCEWVISA-EKGYGVELIFQTFEIE-EEADCGYDYMELFDGADTKSPRLGRYCG--SGPPEEIYSAGDSIVIKF-HSDDTINKKGFHV 955          

HSP 2 Score: 89.3521 bits (220), Expect = 1.495e-17
Identity = 135/605 (22.31%), Postives = 232/605 (38.35%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLY---GIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPL--------VLLRLNTSNAFSSG---------IGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQY----------DFIPIQDIIN-------------------HKCGE----NIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASS--ELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGF 2609
            G  +SP +P  Y ++++C + +     E+I L F  +DL +++  C  DHV I DG    +P+ G+ FCG+K    I+ST + L I F                   +      KGF+ VY                 I G +        ++ +G ++SP YP     NK C + +    G H         L FQ+  I      +  + +     +R    +      +    D PD I   +++  +K ++  G +            ++  +   +G         +G +        +   + +  E     F+  ++ +    I SP + + YP N  C + ++    +RI + F  F             +  N  C+ DFV V   +      S+P      CGS  P  +   S+ N++ + F SD+  S  GF AQ+          +     D +N                   H C E    + ++ + G  ITS  +P +Y S   C W++      +RI I F++   E +H  CA   ++IYDG   +A S    CG+    P  IS+ N + + F  S  +  +KGF
Sbjct:  315 GNFSSPGFPNGYSAYMHCIWRISVTPGEKIILNFTSMDL-YRSHLCWYDHVEIRDGYWRKAPLKGR-FCGDKLPEPIISTDSRLWIEF------------------RSSSNWVGKGFSAVYE---------------AICGGDV-------KRDNGQIQSPNYPDDYRPNKACIWKISVSEGYH-------VGLTFQSFEI-----ERHDSCAYDYLEVRDGISENSPLLGRFCGYDKPDDIKTSSNHLWMKFVS-DGSVNKAGFAANFFKEMDECSKPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGS----ITSPGWPREYPPNKNCIWQLVAPTQYRITLLFDVF------------ETEGNDVCKYDFVEVRSGLSAD---SKP--HGKFCGSEKPEAIT--SQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHDCVNTFGSYRCQCRSGFVLHENKHDCKEAGCDHTVNSVSGA-ITSPNWPDKYPSKKACTWALST-TPGHRIKIAFNEIDME-AHLDCAYDHIQIYDGRDAKAPSLGRFCGSKKPQP-IISSGNKLFIRFF-SDNSVQKKGF 836          

HSP 3 Score: 56.6102 bits (135), Expect = 1.741e-7
Identity = 67/237 (28.27%), Postives = 98/237 (41.35%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLIS-DSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQAS--SELCGTDSAIPAFIST-SNTVHLEFIT 2579
            SG  +SP F   Y +   C + I      +I + F    L             ++  C  D V    +I  G     P++  F CG  +P P+IS DSR   + + F S S     GF A Y+ I         CG ++  +   G I S  YP +YR N  C W +   +  + + + F  F  E  H SCA   L + DG S  +      CG D   P  I T SN + ++F++
Sbjct:  314 SGNFSSPGFPNGYSAYMHCIWRISVTPGEKIILNFTSMDL------------YRSHLCWYDHV----EIRDGYWRKAPLKGRF-CGDKLPEPIISTDSR---LWIEFRSSSNWVGKGFSAVYEAI---------CGGDVKRD--NGQIQSPNYPDDYRPNKACIWKISVSEGYH-VGLTFQSFEIE-RHDSCAYDYLEVRDGISENSPLLGRFCGYDK--PDDIKTSSNHLWMKFVS 515          
BLAST of Cubilin vs. Ensembl Medaka
Match: cdcp2 (CUB domain containing protein 2 [Source:NCBI gene;Acc:101171399])

HSP 1 Score: 93.2041 bits (230), Expect = 1.416e-19
Identity = 70/241 (29.05%), Postives = 114/241 (47.30%), Query Frame = 3
Query:  516 MFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQN---DDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFIT 1229
            +  SP +PQ+Y  N  C +     +   V   F  F +E    GCN DF+ L+      +    + +HLG+FCG   +  PN + + ++++V+ F SD N          +G  GF   + + E   + S                  G  +SP +PGIYP+++NC + +      RI L F  +DL  +N   D C  D V ++DGD++S+ ++G+ +CG +    ILS  N LL+   T
Sbjct:   11 VISSPGYPQEYSNNADCSWTIRVSNGSVVTFVFLDFQLENN-EGCNFDFVSLF------DGDTLSHRHLGKFCG--AEKPPNIITTSNHLLVV-FKSDFN----------IGGRGFKA-YYYSECQQVLSAVS---------------GDFSSPHFPGIYPNNINCHWSISLAGGYRINLYFPVMDLEDRNRLSDQCDYDSVAVHDGDSQSAALLGR-WCGREQPPFILSKGNKLLVVLST 214          

HSP 2 Score: 56.9954 bits (136), Expect = 8.407e-8
Identity = 64/249 (25.70%), Postives = 105/249 (42.17%), Query Frame = 3
Query: 1881 SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQ---SCANSILRIYDGDSFQAS--SELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFK 2612
            SGVI+SP + Q Y +N  C + I  +N   +   F +F L              N  C  DFV +      G  +S      F CG+  P  +I  + SN + + F SD      GF A Y           +C + ++S +  G+ +S  +P  Y +N+ C WS+ +     RI ++F     E  ++    C    + ++DGDS  A+     CG +   P FI +     L  +++ +    +GF 
Sbjct:    9 SGVISSPGYPQEYSNNADCSWTIRVSNGSVVTFVFLDFQLE------------NNEGCNFDFVSLF----DGDTLSHRHLGKF-CGAEKPPNII--TTSNHLLVVFKSDFNIGGRGFKAYY---------YSEC-QQVLSAV-SGDFSSPHFPGIYPNNINCHWSI-SLAGGYRINLYFPVMDLEDRNRLSDQCDYDSVAVHDGDSQSAALLGRWCGREQ--PPFILSKGNKLLVVLSTDRNEAHRGFS 224          

HSP 3 Score: 55.8398 bits (133), Expect = 1.929e-7
Identity = 31/88 (35.23%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  960 GYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
            G I+SP YP  Y ++ +CS+ +  +    +  +F D  L + N+ C  D V+++DGDT S   +G+ FCG +    I++T N LL+ F
Sbjct:   10 GVISSPGYPQEYSNNADCSWTIRVSNGSVVTFVFLDFQLEN-NEGCNFDFVSLFDGDTLSHRHLGK-FCGAEKPPNIITTSNHLLVVF 95          
BLAST of Cubilin vs. Ensembl Medaka
Match: zmp:0000001114 (suppressor of tumorigenicity 14 protein homolog [Source:NCBI gene;Acc:101155223])

HSP 1 Score: 92.0485 bits (227), Expect = 2.087e-18
Identity = 63/241 (26.14%), Postives = 111/241 (46.06%), Query Frame = 3
Query:  510 RRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDD---CIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRF 1223
             +MFQSP +P    PN RC++Q  A  +  + +NF  FNI+     C  DF+ ++  +    S     + + + CG      P  VVS  NI++++  +D + Q+           GFN T+K I        + + ++C   +   + EG  TSP +P  YP  ++C++ +      ++RL F    +     D   C +D++           I+G+ +CGE   L + S  N+L ++F
Sbjct:  209 EKMFQSPGYPSGNDPNSRCQWQIRASEENTITVNFLDFNIKD---DCANDFVSIFDSLSPDYS-----QAITKQCGQRPPSNPLAVVSSGNIMLINLITDSSVQKP----------GFNATYKII-------PQTEAKTCGGIL--SESEGNFTSPLHPKFYPPAVDCTWTIKVPDGSKVRLKFNMFRMKEPGVDVNICHKDYLE----------IMGKKYCGEMSSLSLTSDTNILEVKF 412          

HSP 2 Score: 78.5666 bits (192), Expect = 3.003e-14
Identity = 81/280 (28.93%), Postives = 120/280 (42.86%), Query Frame = 3
Query: 1917 YPS----NTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPG-PLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQS---CANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCG 2732
            YPS    N+ CQ+ I  +  + I + F +F++ +D              C  DFV +   +   P  SQ I     CG   P  PL   S  N + +  I+DS     GF A Y  IP  +     CG  I+SE  G N TS  +P+ Y   + C W++K  D S ++ + F+ F  +        C    L I          + CG  S++ +  S +N + ++F  S ++Y  KGF    +E     P+  CP      T  CIS  L+CDG   CG
Sbjct:  217 YPSGNDPNSRCQWQIRASEENTITVNFLDFNIKDD--------------CANDFVSIFDSL--SPDYSQAITKQ--CGQRPPSNPLAVVSSGNIMLINLITDSSVQKPGFNATYKIIPQTEA--KTCG-GILSESEG-NFTSPLHPKFYPPAVDCTWTIKVPDGS-KVRLKFNMFRMKEPGVDVNICHKDYLEIM-------GKKYCGEMSSL-SLTSDTNILEVKF-HSDESYTDKGFN---AEYTAYDPNNPCPKQFFCNTSICISNALKCDGWNDCG 461          
BLAST of Cubilin vs. Planmine SMEST
Match: SMESG000058235.1 (SMESG000058235.1)

HSP 1 Score: 1968.36 bits (5098), Expect = 0.000e+0
Identity = 1018/1020 (99.80%), Postives = 1018/1020 (99.80%), Query Frame = 3
Query:  408 MDFFLLSIYCLTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPVSSSYNLLHXXXXXXXXXXXXXXXXXXXXXKEHRKQQNKTLNAFRDDLPDGKLLGDNNVLLMSQINPPVIPIYHQAYNTQLSDIMSFPPHYNXXXXXXXXXXXXXQTLSNHHNYNRYSSRESMQKSALRRAHSTKQLRYPHREXXXXXXXXXXXXXXXXXXXXXXXYRNVSAKLAKSHNCNLNVDHKSDLFNHEDPNFYPISAMGDSGTWTREKMQKISMV 3467
            MDFFLLSIYCLTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNIS TKSGVINSPFFNQLYPSNTTCQYDIIGN NHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPVSSSYNLLHVGLGIIITMLILILLVVYVLYKEHRKQQNKTLNAFRDDLPDGKLLGDNNVLLMSQINPPVIPIYHQAYNTQLSDIMSFPPHYNSGSSSSRPASNQSQTLSNHHNYNRYSSRESMQKSALRRAHSTKQLRYPHRESNNNTYSNNNNSNIKSIPPLNNPYRNVSAKLAKSHNCNLNVDHKSDLFNHEDPNFYPISAMGDSGTWTREKMQKISMV
Sbjct:    1 MDFFLLSIYCLTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISLTKSGVINSPFFNQLYPSNTTCQYDIIGNKNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPVSSSYNLLHVGLGIIITMLILILLVVYVLYKEHRKQQNKTLNAFRDDLPDGKLLGDNNVLLMSQINPPVIPIYHQAYNTQLSDIMSFPPHYNSGSSSSRPASNQSQTLSNHHNYNRYSSRESMQKSALRRAHSTKQLRYPHRESNNNTYSNNNNSNIKSIPPLNNPYRNVSAKLAKSHNCNLNVDHKSDLFNHEDPNFYPISAMGDSGTWTREKMQKISMV 1020          
BLAST of Cubilin vs. Planmine SMEST
Match: SMESG000080965.1 (SMESG000080965.1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 318/801 (39.70%), Postives = 465/801 (58.05%), Query Frame = 3
Query:  480 YYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKS------LESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGF--NGTFKFIEIAPINSTKEQKESCHFYIDSKKE-EGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDG---DTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEK-NHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTK-SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSED-GVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPVSSSYNLLH 2831
            +YS+K+      +  SPN+P KYP ++R  Y F+    E+V +NFEHFNIEGL   C KD+LD+YIE+KS      + + LF+   LGRFCGH+LD +P+ +VS +N+I+LDF+SD NTQ SYNQDDHMG LGF  N +FK+ E+           SC + I +     G I+SPTYPG+ PS LNC Y         RIRL F D +L  Q++ C  + V I +    D++S+    +  CG K   +  S+ N   +R +      R+ +     I +    LQ  GF + + FS  Y  +     + +HI GTECD+ I+SS+++ G + SPG    +   K+C YF  GIHN   ME   L F  LN+P   D KC  G LSIYS+  F +K  I+  + V+ ++ PDQ++CG +Y +    T + P+++L+LN +        GF + Y F +D+GI G MV  G CH+ Y    T   G+INSPF+   YPSN++CQYD    +N  IR+ F  F  SED   K   YH +  S C  D++ V + + +     Q  +T   CG+S+PG L+S  +S   +LTF S++ ++  GF A Y FI  + + + +CG NI S    G I S  YP  Y S+LIC+W + A     R ++ F  F  EG+ +SC+N++LRIY+G + +  SELCGTDSAIP++ S+SN + + F+T   + G +GF+++W+ ++ RL +GSCPGF+CL + HCIS+ L C+ V +CG+Y+   G    P +D SDE   CPV+ +Y  L+
Sbjct:   33 FYSNKMTGG---ILLSPNWPGKYPQDVRYVYVFMGSENEQVHLNFEHFNIEGLSFSCEKDYLDIYIEVKSYKNRINISNILFHEPVLGRFCGHSLDFIPHNIVSKNNVIILDFFSDKNTQFSYNQDDHMGKLGFKANFSFKYNEMITKYWASSHHSSCFYLIHANGSYTGEISSPTYPGLLPSTLNCIYEFRSESTLARIRLDFIDFNLYQQDEMCPVEFVEIINQPQLDSDSNDADNR-LCGIKDNFQFFSSHNRFYLRLVV--LAGRNYMMEPHNIDLYKSSLQNIGFKIKFTFSDKYEPLNALYNRQDHIPGTECDIKIQSSDQSEGYIISPGINRASLAPKICNYFFMGIHNTQNMEVVQLNFTYLNLPEMKDFKCQDGYLSIYSV-SFEMKYLIKRYRTVIKETKPDQVLCGKNYLKY-SYTSRNPVIILKLNFTQPVRKEQQGFKLSYRFLKDFGISGTMVSRGRCHYRYQSDETGYRGLINSPFYTNFYPSNSSCQYDFFAKSNEMIRLIFIVFQTSEDVPAKLTSYHDVHLS-CHQDYLTVAEIVKRENGFLQTNKTERYCGTSIPGILVSQQKSLGFTLTFKSNAHKNGPGFLASYQFIKKRKVFSDQCGSNISSTSYYGYIHSPHYPGRYSSDLICEWHLHAVSPKERFILTFTSFQIEGTSKSCSNAVLRIYEGFNVKPQSELCGTDSAIPSYFSSSNFIRVRFLTDITSKGARGFQIVWTRVIPRLSNGSCPGFQCLNSGHCISKNLTCNKVFNCGSYVNNSG---LPTIDRSDEVQACPVAENYTYLY 821          

HSP 2 Score: 58.151 bits (139), Expect = 4.782e-8
Identity = 87/396 (21.97%), Postives = 152/396 (38.38%), Query Frame = 3
Query:  879 FIEIAPI-NSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------------DGDTESSPIIGQPFCGEKPKL---KILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGT----------DYREIKEITCKGPLVLLRLNTSNAFSSGIG--GFVIYYTFKRDYGIEGKMVE-----PGV-CHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNN 1964
            F+ I  I NS+ E     HFY  +K   G + SP +PG YP  +   Y+ +G++ E++ L F   ++   +  C +D++ IY                   P++G+ FCG         I+S  N++++ F +    K ++     +  M      K GF   + F  + + IT     +H   + C   I ++   +G + SP YP   P    C   +Y   + + +    L F   N+    D  C             FV++  +PQ     +  D  +CG           +   ++ +   G   ++  +  + + S +   GF I +TF   Y     +       PG  C      S    G I SP  N+   +   C Y  +G +N
Sbjct:   14 FLSITKIANSSIENIFYEHFY-SNKMTGGILLSPNWPGKYPQDVRYVYVFMGSENEQVHLNFEHFNIEGLSFSCEKDYLDIYIEVKSYKNRINISNILFHEPVLGR-FCGHSLDFIPHNIVSKNNVIILDFFSD---KNTQFSYNQDDHMG-----KLGFKANFSFKYNEM-ITKYWASSH--HSSCFYLIHANGSYTGEISSPTYPGLLPSTLNC---IYEFRSESTLARIRLDFIDFNL-YQQDEMCPVE----------FVEIINQPQLDSDSNDADNRLCGIKDNFQFFSSHNRFYLRLVVLAGRNYMMEPHNIDLYKSSLQNIGFKIKFTFSDKYEPLNALYNRQDHIPGTECDIKIQSSDQSEGYIISPGINRASLAPKICNYFFMGIHN 382          
BLAST of Cubilin vs. Planmine SMEST
Match: SMESG000080965.1 (SMESG000080965.1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 317/801 (39.58%), Postives = 462/801 (57.68%), Query Frame = 3
Query:  480 YYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKS------LESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGF--NGTFKFIEIAPINSTKEQKESCHFYIDSKKE-EGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDG---DTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEK-NHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTK-SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSED-GVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPVSSSYNLLH 2831
            +YS+K+      +  SPN+P KYP ++R  Y F+    E+V +NFEHFNIEGL   C KD+LD+YIE+KS      + + LF+   LGRFCGH+LD +P+ +VS +N+I+LDF+SD NTQ SYNQDDHMG LGF  N +FK+ E+           SC + I +     G I+SPTYPG+ PS LNC Y         RIRL F D +L  Q++ C  + V I +    D++S+    +  CG K   +  S+ N   +R +      R+ +     I +    LQ  GF + + FS  Y  +     + +HI GTECD+ I+SS+++ G + SPG    +   K+C YF  GIHN   ME   L F  LN+P   D KC  G LSIYS+  F +K  I+  + V+ ++ PDQ++CG +Y +    T + P+++L+LN +        GF + Y F +D+GI G MV  G CH+ Y    T   G+INSPF+   YPSN++CQYD    +N  IR+ F  F  SED   K   YH +  S C  D++ V + + +     Q  +T   CG+S+PG L+S  +S   +LTF S++ ++  GF A Y FI  + + + +CG NI S    G I S  YP  Y S+LIC+W + A     R ++ F  F  EG    C+N++LRIY+G + +  SELCGTDSAIP++ S+SN + + F+T   + G +GF+++W+ ++ RL +GSCPGF+CL + HCIS+ L C+ V +CG+Y+   G    P +D SDE   CPV+ +Y  L+
Sbjct:   33 FYSNKMTGG---ILLSPNWPGKYPQDVRYVYVFMGSENEQVHLNFEHFNIEGLSFSCEKDYLDIYIEVKSYKNRINISNILFHEPVLGRFCGHSLDFIPHNIVSKNNVIILDFFSDKNTQFSYNQDDHMGKLGFKANFSFKYNEMITKYWASSHHSSCFYLIHANGSYTGEISSPTYPGLLPSTLNCIYEFRSESTLARIRLDFIDFNLYQQDEMCPVEFVEIINQPQLDSDSNDADNR-LCGIKDNFQFFSSHNRFYLRLVV--LAGRNYMMEPHNIDLYKSSLQNIGFKIKFTFSDKYEPLNALYNRQDHIPGTECDIKIQSSDQSEGYIISPGINRASLAPKICNYFFMGIHNTQNMEVVQLNFTYLNLPEMKDFKCQDGYLSIYSV-SFEMKYLIKRYRTVIKETKPDQVLCGKNYLKY-SYTSRNPVIILKLNFTQPVRKEQQGFKLSYRFLKDFGISGTMVSRGRCHYRYQSDETGYRGLINSPFYTNFYPSNSSCQYDFFAKSNEMIRLIFIVFQTSEDVPAKLTSYHDVHLS-CHQDYLTVAEIVKRENGFLQTNKTERYCGTSIPGILVSQQKSLGFTLTFKSNAHKNGPGFLASYQFIKKRKVFSDQCGSNISSTSYYGYIHSPHYPGRYSSDLICEWHLHAVSPKERFILTFTSFQIEG----CSNAVLRIYEGFNVKPQSELCGTDSAIPSYFSSSNFIRVRFLTDITSKGARGFQIVWTRVIPRLSNGSCPGFQCLNSGHCISKNLTCNKVFNCGSYVNNSG---LPTIDRSDEVQACPVAENYTYLY 817          

HSP 2 Score: 58.151 bits (139), Expect = 4.940e-8
Identity = 87/396 (21.97%), Postives = 152/396 (38.38%), Query Frame = 3
Query:  879 FIEIAPI-NSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------------DGDTESSPIIGQPFCGEKPKL---KILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGT----------DYREIKEITCKGPLVLLRLNTSNAFSSGIG--GFVIYYTFKRDYGIEGKMVE-----PGV-CHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNN 1964
            F+ I  I NS+ E     HFY  +K   G + SP +PG YP  +   Y+ +G++ E++ L F   ++   +  C +D++ IY                   P++G+ FCG         I+S  N++++ F +    K ++     +  M      K GF   + F  + + IT     +H   + C   I ++   +G + SP YP   P    C   +Y   + + +    L F   N+    D  C             FV++  +PQ     +  D  +CG           +   ++ +   G   ++  +  + + S +   GF I +TF   Y     +       PG  C      S    G I SP  N+   +   C Y  +G +N
Sbjct:   14 FLSITKIANSSIENIFYEHFY-SNKMTGGILLSPNWPGKYPQDVRYVYVFMGSENEQVHLNFEHFNIEGLSFSCEKDYLDIYIEVKSYKNRINISNILFHEPVLGR-FCGHSLDFIPHNIVSKNNVIILDFFSD---KNTQFSYNQDDHMG-----KLGFKANFSFKYNEM-ITKYWASSH--HSSCFYLIHANGSYTGEISSPTYPGLLPSTLNC---IYEFRSESTLARIRLDFIDFNL-YQQDEMCPVE----------FVEIINQPQLDSDSNDADNRLCGIKDNFQFFSSHNRFYLRLVVLAGRNYMMEPHNIDLYKSSLQNIGFKIKFTFSDKYEPLNALYNRQDHIPGTECDIKIQSSDQSEGYIISPGINRASLAPKICNYFFMGIHN 382          
BLAST of Cubilin vs. Planmine SMEST
Match: SMESG000080965.1 (SMESG000080965.1)

HSP 1 Score: 538.88 bits (1387), Expect = 1.698e-173
Identity = 314/801 (39.20%), Postives = 455/801 (56.80%), Query Frame = 3
Query:  480 YYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKS------LESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGF--NGTFKFIEIAPINSTKEQKESCHFYIDSKKE-EGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDG---DTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEK-NHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTK-SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSED-GVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPVSSSYNLLH 2831
            +YS+K+      +  SPN+P KYP ++R  Y F+    E+V +NFEHFNIEGL   C KD+LD+YIE+KS      + + LF+   LGRFCGH+LD +P+ +VS +N+I+LDF+SD NTQ SYNQDDHMG LGF  N +FK+ E+           SC + I +     G I+SPTYPG+ PS LNC Y         RIRL F D +L  Q++ C  + V I +    D++S+    +  CG K   +  S+ N   +R +      R+ +     I +    LQ  GF + + FS  Y  +     + +HI GTECD+ I+SS+++ G + SPG    +   K+C YF  GIHN   ME   L F  LN+P   D KC  G LSIYS+  F +K  I+  + V+ ++ PDQ++CG +Y +    T + P+++L+LN +        GF + Y F +D+GI G MV  G CH+ Y    T   G+INSPF+   YPSN++CQYD    +N  IR+ F  F  SED   K   YH +  S C  D++ V + + +     Q  +T   CG+S+PG L+S  +S   +LTF S++ ++  GF A Y FI  + + + +CG NI S    G I S  YP  Y S+LIC+W + A     R ++ F  F  EG+ +SC+N++LRIY+G + +  SELCGTDSAIP++ S+SN + +    S + Y            ++RL +GSCPGF+CL + HCIS+ L C+ V +CG+Y+   G    P +D SDE   CPV+ +Y  L+
Sbjct:   33 FYSNKMTGG---ILLSPNWPGKYPQDVRYVYVFMGSENEQVHLNFEHFNIEGLSFSCEKDYLDIYIEVKSYKNRINISNILFHEPVLGRFCGHSLDFIPHNIVSKNNVIILDFFSDKNTQFSYNQDDHMGKLGFKANFSFKYNEMITKYWASSHHSSCFYLIHANGSYTGEISSPTYPGLLPSTLNCIYEFRSESTLARIRLDFIDFNLYQQDEMCPVEFVEIINQPQLDSDSNDADNR-LCGIKDNFQFFSSHNRFYLRLVV--LAGRNYMMEPHNIDLYKSSLQNIGFKIKFTFSDKYEPLNALYNRQDHIPGTECDIKIQSSDQSEGYIISPGINRASLAPKICNYFFMGIHNTQNMEVVQLNFTYLNLPEMKDFKCQDGYLSIYSV-SFEMKYLIKRYRTVIKETKPDQVLCGKNYLKY-SYTSRNPVIILKLNFTQPVRKEQQGFKLSYRFLKDFGISGTMVSRGRCHYRYQSDETGYRGLINSPFYTNFYPSNSSCQYDFFAKSNEMIRLIFIVFQTSEDVPAKLTSYHDVHLS-CHQDYLTVAEIVKRENGFLQTNKTERYCGTSIPGILVSQQKSLGFTLTFKSNAHKNGPGFLASYQFIKKRKVFSDQCGSNISSTSYYGYIHSPHYPGRYSSDLICEWHLHAVSPKERFILTFTSFQIEGTSKSCSNAVLRIYEGFNVKPQSELCGTDSAIPSYFSSSNFIRI----SDRYY------------IKRLSNGSCPGFQCLNSGHCISKNLTCNKVFNCGSYVNNSG---LPTIDRSDEVQACPVAENYTYLY 805          

HSP 2 Score: 58.151 bits (139), Expect = 4.878e-8
Identity = 87/396 (21.97%), Postives = 152/396 (38.38%), Query Frame = 3
Query:  879 FIEIAPI-NSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIY------------DGDTESSPIIGQPFCGEKPKL---KILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGT----------DYREIKEITCKGPLVLLRLNTSNAFSSGIG--GFVIYYTFKRDYGIEGKMVE-----PGV-CHFVYNISSTKSGVINSPFFNQLYPSNTTCQYDIIGNNN 1964
            F+ I  I NS+ E     HFY  +K   G + SP +PG YP  +   Y+ +G++ E++ L F   ++   +  C +D++ IY                   P++G+ FCG         I+S  N++++ F +    K ++     +  M      K GF   + F  + + IT     +H   + C   I ++   +G + SP YP   P    C   +Y   + + +    L F   N+    D  C             FV++  +PQ     +  D  +CG           +   ++ +   G   ++  +  + + S +   GF I +TF   Y     +       PG  C      S    G I SP  N+   +   C Y  +G +N
Sbjct:   14 FLSITKIANSSIENIFYEHFY-SNKMTGGILLSPNWPGKYPQDVRYVYVFMGSENEQVHLNFEHFNIEGLSFSCEKDYLDIYIEVKSYKNRINISNILFHEPVLGR-FCGHSLDFIPHNIVSKNNVIILDFFSD---KNTQFSYNQDDHMG-----KLGFKANFSFKYNEM-ITKYWASSH--HSSCFYLIHANGSYTGEISSPTYPGLLPSTLNC---IYEFRSESTLARIRLDFIDFNL-YQQDEMCPVE----------FVEIINQPQLDSDSNDADNRLCGIKDNFQFFSSHNRFYLRLVVLAGRNYMMEPHNIDLYKSSLQNIGFKIKFTFSDKYEPLNALYNRQDHIPGTECDIKIQSSDQSEGYIISPGINRASLAPKICNYFFMGIHN 382          
BLAST of Cubilin vs. Planmine SMEST
Match: SMESG000080965.1 (SMESG000080965.1)

HSP 1 Score: 431.795 bits (1109), Expect = 6.250e-135
Identity = 243/645 (37.67%), Postives = 363/645 (56.28%), Query Frame = 3
Query:  924 SCHFYIDSKKE-EGYITSPTYPGIYPSHLNCSYLLVGNQK-ERIRLLFRDLDLNHQNDDCIEDHVTIYDG---DTESSPIIGQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEK-NHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDS-PDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTK-SGVINSPFFNQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSED-GVKRQKYHSLKNSTCEGDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISDSVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSNLICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSELCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSCPGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPVSSSYNLLH 2831
            SC + I +     G I+SPTYPG+ PS LNC Y         RIRL F D +L  Q++ C  + V I +    D++S+    +  CG K   +  S+ N   +R +      R+ +     I +    LQ  GF + + FS  Y  +     + +HI GTECD+ I+SS+++ G + SPG    +   K+C YF  GIHN   ME   L F  LN+P   D KC  G LSIYS+  F +K  I+  + V+ ++ PDQ++CG +Y +    T + P+++L+LN +        GF + Y F +D+GI G MV  G CH+ Y    T   G+INSPF+   YPSN++CQYD    +N  IR+ F  F  SED   K   YH +  S C  D++ V + + +     Q  +T   CG+S+PG L+S  +S   +LTF S++ ++  GF A Y FI  + + + +CG NI S    G I S  YP  Y S+LIC+W + A     R ++ F  F  EG+ +SC+N++LRIY+G + +  SELCGTDSAIP++ S+SN + + F+T   + G +GF+++W+ ++ RL +GSCPGF+CL + HCIS+ L C+ V +CG+Y+   G    P +D SDE   CPV+ +Y  L+
Sbjct:   13 SCFYLIHANGSYTGEISSPTYPGLLPSTLNCIYEFRSESTLARIRLDFIDFNLYQQDEMCPVEFVEIINQPQLDSDSNDADNR-LCGIKDNFQFFSSHNRFYLRLVV--LAGRNYMMEPHNIDLYKSSLQNIGFKIKFTFSDKYEPLNALYNRQDHIPGTECDIKIQSSDQSEGYIISPGINRASLAPKICNYFFMGIHNTQNMEVVQLNFTYLNLPEMKDFKCQDGYLSIYSV-SFEMKYLIKRYRTVIKETKPDQVLCGKNYLKY-SYTSRNPVIILKLNFTQPVRKEQQGFKLSYRFLKDFGISGTMVSRGRCHYRYQSDETGYRGLINSPFYTNFYPSNSSCQYDFFAKSNEMIRLIFIVFQTSEDVPAKLTSYHDVHLS-CHQDYLTVAEIVKRENGFLQTNKTERYCGTSIPGILVSQQKSLGFTLTFKSNAHKNGPGFLASYQFIKKRKVFSDQCGSNISSTSYYGYIHSPHYPGRYSSDLICEWHLHAVSPKERFILTFTSFQIEGTSKSCSNAVLRIYEGFNVKPQSELCGTDSAIPSYFSSSNFIRVRFLTDITSKGARGFQIVWTRVIPRLSNGSCPGFQCLNSGHCISKNLTCNKVFNCGSYVNNSG---LPTIDRSDEVQACPVAENYTYLY 648          

HSP 2 Score: 78.1814 bits (191), Expect = 2.814e-14
Identity = 75/296 (25.34%), Postives = 120/296 (40.54%), Query Frame = 3
Query:  405 KMDFFLLSIYCLTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPNIRCKYQFVAKSQEKVVINFEHFNIEGLLPG-----------CNKDFLDLYIEMKSLESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHLNCSY-LLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQPFCGEKPKL-KILSTRNMLLIRFITGDFIKRSR 1253
            K+ +  L  + ++  +V    C   Y SD+ G   R +  SP +   YP N  C+Y F AKS E + + F  F     +P            C++D+L +  E+   E+         R+CG +   +P  +VS    +            ++  + H    GF  +++FI+   + S     + C   I S    GYI SP YPG Y S L C + L   + KER  L F    +   +  C    + IY+G            CG    +    S+ N + +RF+T    K +R
Sbjct:  302 KLSYRFLKDFGISGTMVSRGRCHYRYQSDETGY--RGLINSPFYTNFYPSNSSCQYDFFAKSNEMIRLIFIVFQTSEDVPAKLTSYHDVHLSCHQDYLTV-AEIVKRENGFLQTNKTERYCGTS---IPGILVSQQKSLGFTL--------TFKSNAHKNGPGFLASYQFIKKRKVFS-----DQCGSNISSTSYYGYIHSPHYPGRYSSDLICEWHLHAVSPKERFILTFTSFQIEGTSKSCSNAVLRIYEGFNVKPQ---SELCGTDSAIPSYFSSSNFIRVRFLTDITSKGAR 575          

HSP 3 Score: 59.6918 bits (143), Expect = 1.361e-8
Identity = 100/441 (22.68%), Postives = 171/441 (38.78%), Query Frame = 3
Query:  564 CKYQFVA----KSQEKVVINFEHFNIEGLLP-GCNKDFLDLY---IEMKSL----ESTLFNAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLLGFNGTFKFIEIAPINSTKEQKESCHFYIDSKKE--EGYITSPTYPGIYPSHLNCSYLLVGNQKERIRLLF------RDL--DLNHQND---DCIEDHVTIYDGDTESSPII----GQPFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKGFNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVRTPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSIRPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSNAFSSGIGGFVIYYT 1799
            C Y F+     ++ E V +NF + N+  +    C   +L +Y    EMK L     + +   K     CG   +++     S + +I+L     +N  Q   ++      GF  +++F++   I+ T   +  CH+   S +    G I SP Y   YPS+ +C Y       E IRL+F       D+   L   +D    C +D++T+ +     +  +     + +CG      ++S +  L          K +  ++G             GF   Y+F          ++K  +   +C   I SS    G + SP YP R   + +C + L+ +  +   E  +L F +  I  T  + CS   L IY          ++PQ           +CGTD   I         + +R  T +  S G  GF I +T
Sbjct:  200 CNYFFMGIHNTQNMEVVQLNFTYLNLPEMKDFKCQDGYLSIYSVSFEMKYLIKRYRTVIKETKPDQVLCGK--NYLKYSYTSRNPVIILK----LNFTQPVRKEQQ----GFKLSYRFLKDFGISGTMVSRGRCHYRYQSDETGYRGLINSPFYTNFYPSNSSCQYDFFAKSNEMIRLIFIVFQTSEDVPAKLTSYHDVHLSCHQDYLTVAEIVKRENGFLQTNKTERYCGTSIPGILVSQQKSLGFTLT----FKSNAHKNG------------PGFLASYQF----------IKKRKVFSDQCGSNI-SSTSYYGYIHSPHYPGRYSSDLICEWHLHAVSPK---ERFILTFTSFQIEGTSKS-CSNAVLRIYE------GFNVKPQSE---------LCGTD-SAIPSYFSSSNFIRVRFLT-DITSKGARGFQIVWT 582          
The following BLAST results are available for this feature:
BLAST of Cubilin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CUBN7.136e-2923.72cubilin [Source:HGNC Symbol;Acc:HGNC:2548][more]
TLL14.786e-2426.74tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL15.515e-2426.74tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
BMP18.035e-2223.58bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
TLL28.202e-1926.79tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844][more]
back to top
BLAST of Cubilin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lev-102.556e-8328.66LEV-10B [Source:UniProtKB/TrEMBL;Acc:G5EER3][more]
lev-108.390e-8328.66LEV-10B [Source:UniProtKB/TrEMBL;Acc:G5EER3][more]
lev-104.659e-4434.24LEV-10B [Source:UniProtKB/TrEMBL;Acc:G5EER3][more]
nas-393.944e-1525.06Zinc metalloproteinase nas-39 [Source:UniProtKB/S... [more]
ZC116.38.216e-1421.13Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of Cubilin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426135.595e-9229.33gene:FBgn0261262 transcript:FBtr0304687[more]
CG426132.109e-9129.33gene:FBgn0261262 transcript:FBtr0304688[more]
CG426131.128e-9029.54gene:FBgn0261262 transcript:FBtr0304685[more]
CG426131.295e-8429.92gene:FBgn0261262 transcript:FBtr0304686[more]
tok2.521e-2130.45gene:FBgn0004885 transcript:FBtr0084690[more]
back to top
BLAST of Cubilin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cubn9.287e-3725.77cubilin (intrinsic factor-cobalamin receptor) [Sou... [more]
bmp1b3.221e-2621.92bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB... [more]
bmp1b7.739e-2621.89bone morphogenetic protein 1b [Source:ZFIN;Acc:ZDB... [more]
bmp1a1.018e-2320.66bone morphogenetic protein 1a [Source:ZFIN;Acc:ZDB... [more]
bmp1a2.082e-2023.66bone morphogenetic protein 1a [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Cubilin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr813.257e-2925.68WD repeat domain 81 [Source:Xenbase;Acc:XB-GENE-62... [more]
wdr816.407e-2923.52WD repeat domain 81 [Source:Xenbase;Acc:XB-GENE-62... [more]
ENSXETT00000007740.12.507e-2623.46tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007933.13.089e-2623.83tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007882.11.939e-2523.35tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
back to top
BLAST of Cubilin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cubn6.051e-2923.33cubilin (intrinsic factor-cobalamin receptor) [Sou... [more]
Tll11.099e-2327.84tolloid-like [Source:MGI Symbol;Acc:MGI:106923][more]
Bmp12.423e-2223.45bone morphogenetic protein 1 [Source:MGI Symbol;Ac... [more]
Tll25.036e-2026.81tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Tll25.412e-2026.81tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
back to top
BLAST of Cubilin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70244|CUBN_RAT1.788e-2822.93Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1... [more]
sp|O60494|CUBN_HUMAN3.427e-2823.72Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5[more]
sp|Q9JLB4|CUBN_MOUSE4.233e-2823.33Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3[more]
sp|F1RWC3|CUBN_PIG2.484e-2623.55Cubilin OS=Sus scrofa OX=9823 GN=CUBN PE=1 SV=3[more]
sp|Q9TU53|CUBN_CANLF3.189e-2422.57Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN ... [more]
back to top
BLAST of Cubilin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FHN82.754e-13734.21Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GBW15.859e-13733.94Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GY951.891e-13435.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F4R11.486e-13335.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JCS69.306e-13334.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cubilin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cubn1.524e-3524.26cubilin [Source:NCBI gene;Acc:103044622][more]
cubn1.577e-3524.26cubilin [Source:NCBI gene;Acc:103044622][more]
tll12.562e-3423.66tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll14.086e-3423.66tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll14.228e-3423.66tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
back to top
BLAST of Cubilin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007253.11.887e-2622.04pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1... [more]
ENSPMAT00000010323.11.159e-1424.87pep scaffold:Pmarinus_7.0:GL476365:125003:472029:-... [more]
ENSPMAT00000008741.13.516e-1323.40pep scaffold:Pmarinus_7.0:GL478849:6130:19306:1 ge... [more]
ENSPMAT00000008025.12.156e-1225.10pep scaffold:Pmarinus_7.0:GL476353:328552:336612:1... [more]
ENSPMAT00000007646.11.295e-1135.40pep scaffold:Pmarinus_7.0:GL489134:1272:7172:1 gen... [more]
back to top
BLAST of Cubilin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cubilin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417832.403e-2322.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390072.574e-2023.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498581.374e-1928.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499666.735e-1824.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477782.433e-1625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cubilin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cubn1.302e-4324.56cubilin [Source:NCBI gene;Acc:105353827][more]
bmp1b5.397e-2426.73bone morphogenetic protein 1 [Source:NCBI gene;Acc... [more]
bmp1a1.004e-2221.01bone morphogenetic protein 1 [Source:NCBI gene;Acc... [more]
cdcp21.416e-1929.05CUB domain containing protein 2 [Source:NCBI gene;... [more]
zmp:00000011142.087e-1826.14suppressor of tumorigenicity 14 protein homolog [S... [more]
back to top
BLAST of Cubilin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058235.10.000e+099.80SMESG000058235.1[more]
SMESG000080965.14.782e-839.70SMESG000080965.1[more]
SMESG000080965.14.940e-839.58SMESG000080965.1[more]
SMESG000080965.11.698e-17339.20SMESG000080965.1[more]
SMESG000080965.16.250e-13537.67SMESG000080965.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009444 ID=SMED30009444|Name=Cubilin|organism=Schmidtea mediterranea sexual|type=transcript|length=3776bp
TTTTGTAAGCATAACCAATTACCGATCCCACACAGGCATACAAACACGTT
GGCTAACTTGACAGTAGCACACATACACCAAATTGGTGGATTTACAAATG
GTTACGATTACATGCAACATTGAGATCAATTTCGATGGACATACATCTGC
ATGCCAAACAGGATTGGTATTCATGAATCAACGTACCAAACCAAGGTAAT
CTAAAATCAGGACAACTCAATCATTGTCTAAATTGAAATAATTAACTTCC
TATATTATTCATCAATTGATTCACAAATCTACTTTAAGAGTATTTTTCAA
TTTTAAAACAATTTACAAATAACCAATCACTTCTAATGAAAGAATTTCTA
GTTTCAATTCATTTTCTCAAAACTTGCCAATGATTCTCGAATTAATAATT
TGTAAAAATGGATTTTTTCCTGCTTAGTATTTACTGCTTGACAAACTATG
TCGTTTACGCGTTAGATTGTGACATTATCTACTATAGTGATAAAATTGGA
GTTAACAATCGGAGAATGTTTCAATCACCTAATTTTCCTCAAAAATATCC
TCCTAATATCCGCTGTAAATATCAATTTGTAGCAAAATCACAAGAAAAAG
TTGTGATAAATTTTGAGCATTTTAATATTGAAGGTCTCCTACCTGGGTGC
AATAAGGATTTCCTAGATTTGTATATAGAAATGAAATCATTAGAAAGCAC
ACTTTTCAACGCCAAACATCTCGGTAGATTTTGCGGGCATACTCTTGACC
ATGTTCCGAATTTCGTTGTCAGTCTCCATAACATTATCGTATTGGATTTC
TATTCTGACATTAACACCCAACAATCATACAACCAGGACGATCACATGGG
CTTATTGGGATTTAATGGCACTTTCAAGTTCATTGAAATAGCACCTATTA
ACTCAACCAAGGAGCAAAAAGAAAGTTGTCACTTTTATATAGATTCTAAA
AAAGAGGAAGGGTATATAACTTCTCCAACATATCCTGGTATTTATCCCAG
TCATTTAAACTGCTCATATCTGCTAGTTGGTAATCAAAAAGAACGAATAC
GTCTTTTGTTTCGTGATCTCGACTTGAATCATCAAAACGATGATTGTATA
GAAGACCACGTAACAATTTATGATGGTGACACTGAAAGTTCTCCAATTAT
CGGTCAACCGTTTTGCGGTGAAAAACCCAAATTAAAGATCCTTTCAACAA
GGAACATGCTACTTATTCGATTCATTACAGGTGATTTCATAAAACGAAGT
CGCTTGGAAAGCGGAGACGAAATTAAAATGAACCCGAAACTTCTACAAAA
AAAAGGGTTTAATGTTGTTTATAGATTTAGTGTTGACTATGTTAAAATCA
CAAATGAAATGGAAAAAAATCACATAATAGGAACAGAATGTGATATGTGG
ATTAAAAGTTCAGAAAAAACTTCTGGCATTCTTAAATCACCTGGTTACCC
TGTTAGGACACCAAAAAATAAATTATGTACATATTTCCTTTATGGTATTC
ACAATCGGAATAAAATGGAAACTGCTGTTCTCAAATTTCAAACTCTCAAC
ATTCCACCTACACCGGATAACAAATGTTCTACAGGATCTCTTTCCATCTA
TTCTATTCGACCGTTTTTTGTCAAATTGGAAATCAGACCACAAAAATTAG
TGCTGCCAGACTCCCCTGATCAAATTATTTGTGGGACAGATTACAGGGAA
ATCAAAGAAATTACTTGCAAAGGACCATTGGTTTTGCTTCGTTTAAATAC
CTCAAATGCATTTAGTTCCGGCATTGGAGGATTTGTAATTTATTATACAT
TTAAAAGAGATTACGGTATTGAGGGCAAAATGGTCGAGCCTGGAGTTTGT
CATTTTGTGTACAACATATCATCGACCAAATCTGGGGTGATCAACTCACC
GTTTTTCAATCAGCTGTATCCATCAAATACAACTTGCCAATATGACATCA
TTGGTAATAATAATCACAGAATCAGAATTTATTTCCAGGAGTTTTCACTG
TCAGAAGATGGAGTTAAACGTCAGAAATACCATTCGTTGAAAAACTCTAC
ATGCGAAGGCGATTTCGTAAGGGTCATACAGAAAATACCGAAAGGTCCAA
TCATTTCACAACCAATTGAAACATCATTTCTGTGCGGCAGCTCTGTTCCT
GGTCCTTTAATTAGTGATTCAAGGTCGAACAGTATCAGTTTGACATTTAT
ATCTGATAGCGTCCAGTCCCATTCTGGCTTTTATGCACAATACGATTTCA
TACCTATTCAAGACATTATAAATCATAAATGCGGAGAAAATATCATATCA
GAAATCCGTGGCGGAAATATAACAAGCAACCGATATCCGAGAGAATATAG
GAGCAATTTAATTTGTCAATGGTCAGTGAAAGCATTTGACTCCTCTAATA
GGATCATGATTCATTTTCATGATTTTGTTACAGAAGGTTCTCACCAAAGC
TGTGCGAATAGTATTTTACGTATTTATGATGGAGATTCATTTCAAGCATC
ATCTGAACTATGCGGCACTGATTCCGCCATTCCAGCGTTCATATCAACTT
CAAACACAGTTCATTTAGAATTCATTACTAGTCCGAAAGCATACGGGCAG
AAAGGATTCAAACTGATCTGGTCGGAAATTCTGCAGCGATTACCAGATGG
ATCCTGCCCAGGCTTCGAATGCCTAAAAACAAAGCATTGTATCAGCCGAC
AGCTAGAATGTGATGGAGTCCCACATTGTGGAACATACATGGGAACTCAG
GGAAACATTTTCAAACCTCTAGTAGACGATTCAGATGAAGAGCACACTTG
TCCAGTCAGTAGTAGCTACAATCTGCTCCACGTCGGTTTAGGAATCATCA
TAACTATGCTTATACTTATTCTTTTAGTAGTTTATGTATTATACAAAGAA
CATCGGAAGCAACAAAATAAAACTCTAAATGCATTTAGAGATGATCTACC
CGATGGGAAATTATTAGGAGACAATAATGTTCTATTAATGAGCCAGATTA
ATCCTCCAGTTATTCCAATATACCATCAAGCATACAATACCCAACTATCT
GATATTATGTCATTTCCTCCCCACTACAATTCCGGTTCAAGTTCCTCCCG
GCCCGCATCGAATCAGTCACAGACTTTATCTAATCACCATAATTACAATA
GGTATTCATCTCGTGAAAGTATGCAAAAAAGCGCTCTTAGGCGTGCACAT
TCCACCAAACAATTGAGATATCCTCATAGGGAATCCAATAACAACACCTA
CAGCAATAACAATAATAGCAATATCAAAAGTATTCCACCTCTCAATAATC
CGTACAGAAACGTCTCTGCAAAACTAGCCAAATCACACAATTGCAACTTG
AATGTCGACCACAAATCGGATTTATTCAACCACGAGGATCCGAATTTCTA
TCCAATATCGGCGATGGGTGACAGTGGAACATGGACTAGAGAGAAAATGC
AGAAAATATCCATGGTCTGATGGTATGTGAGCGCGCCAATCTGATTAATG
TTTAACTAGCATTTATACAATTTGATTTATTAATTGTTTCATAAAACCTT
TACTTATTACAATAGCACATTAGCTTGTAATTCTTTTCTGGGTCTTCGAT
AAATCAGCAGCTATCTTCAATATTTAGATATATTATTTCGAAATTCTAAG
AGTTTTGTATTCAATAAATTTCACCGAATTCTATTGAGATCAATCTATGC
AATTGAGAAATGTAATTCTATTGGTTGTGCAATATTGAGTTGCGATTGGT
GAATGAATTGTGTCGTTGCGTAATCG
back to top

protein sequence of SMED30009444-orf-1

>SMED30009444-orf-1 ID=SMED30009444-orf-1|Name=SMED30009444-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1021bp
MDFFLLSIYCLTNYVVYALDCDIIYYSDKIGVNNRRMFQSPNFPQKYPPN
IRCKYQFVAKSQEKVVINFEHFNIEGLLPGCNKDFLDLYIEMKSLESTLF
NAKHLGRFCGHTLDHVPNFVVSLHNIIVLDFYSDINTQQSYNQDDHMGLL
GFNGTFKFIEIAPINSTKEQKESCHFYIDSKKEEGYITSPTYPGIYPSHL
NCSYLLVGNQKERIRLLFRDLDLNHQNDDCIEDHVTIYDGDTESSPIIGQ
PFCGEKPKLKILSTRNMLLIRFITGDFIKRSRLESGDEIKMNPKLLQKKG
FNVVYRFSVDYVKITNEMEKNHIIGTECDMWIKSSEKTSGILKSPGYPVR
TPKNKLCTYFLYGIHNRNKMETAVLKFQTLNIPPTPDNKCSTGSLSIYSI
RPFFVKLEIRPQKLVLPDSPDQIICGTDYREIKEITCKGPLVLLRLNTSN
AFSSGIGGFVIYYTFKRDYGIEGKMVEPGVCHFVYNISSTKSGVINSPFF
NQLYPSNTTCQYDIIGNNNHRIRIYFQEFSLSEDGVKRQKYHSLKNSTCE
GDFVRVIQKIPKGPIISQPIETSFLCGSSVPGPLISDSRSNSISLTFISD
SVQSHSGFYAQYDFIPIQDIINHKCGENIISEIRGGNITSNRYPREYRSN
LICQWSVKAFDSSNRIMIHFHDFVTEGSHQSCANSILRIYDGDSFQASSE
LCGTDSAIPAFISTSNTVHLEFITSPKAYGQKGFKLIWSEILQRLPDGSC
PGFECLKTKHCISRQLECDGVPHCGTYMGTQGNIFKPLVDDSDEEHTCPV
SSSYNLLHVGLGIIITMLILILLVVYVLYKEHRKQQNKTLNAFRDDLPDG
KLLGDNNVLLMSQINPPVIPIYHQAYNTQLSDIMSFPPHYNSGSSSSRPA
SNQSQTLSNHHNYNRYSSRESMQKSALRRAHSTKQLRYPHRESNNNTYSN
NNNSNIKSIPPLNNPYRNVSAKLAKSHNCNLNVDHKSDLFNHEDPNFYPI
SAMGDSGTWTREKMQKISMV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035914Sperma_CUB_dom_sf
IPR000859CUB_dom
IPR002172LDrepeatLR_classA_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1020..1020
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 939..960
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 889..960
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 889..921
NoneNo IPR availablePANTHERPTHR45645:SF39coord: 81..838
NoneNo IPR availablePANTHERPTHR45645FAMILY NOT NAMEDcoord: 81..838
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.612
NoneNo IPR availableTMHMMTMhelixcoord: 807..829
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 749..800
e-value: 0.004
score: 25.7
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 750..796
e-value: 0.00899394
score: 32.949
IPR000859CUB domainSMARTSM00042CUB_2coord: 174..308
e-value: 1.3E-22
score: 91.1
coord: 26..159
e-value: 6.0E-15
score: 65.7
coord: 625..741
e-value: 6.8E-17
score: 72.1
coord: 328..466
e-value: 0.08
score: 3.4
coord: 481..615
e-value: 2.3E-11
score: 53.8
IPR000859CUB domainPFAMPF00431CUBcoord: 489..612
e-value: 3.4E-12
score: 46.7
coord: 34..139
e-value: 9.8E-17
score: 61.3
coord: 625..736
e-value: 5.2E-16
score: 58.9
coord: 180..278
e-value: 1.1E-19
score: 70.8
IPR000859CUB domainPROSITEPS01180CUBcoord: 328..466
score: 10.92
IPR000859CUB domainPROSITEPS01180CUBcoord: 21..159
score: 17.94
IPR000859CUB domainPROSITEPS01180CUBcoord: 481..615
score: 16.839
IPR000859CUB domainPROSITEPS01180CUBcoord: 174..308
score: 17.785
IPR000859CUB domainPROSITEPS01180CUBcoord: 625..741
score: 19.268
IPR000859CUB domainCDDcd00041CUBcoord: 625..739
e-value: 7.9547E-19
score: 80.9194
IPR000859CUB domainCDDcd00041CUBcoord: 485..612
e-value: 8.68985E-21
score: 86.6974
IPR000859CUB domainCDDcd00041CUBcoord: 21..158
e-value: 8.76373E-18
score: 77.8378
IPR000859CUB domainCDDcd00041CUBcoord: 183..307
e-value: 4.45794E-24
score: 95.9422
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 174..309
e-value: 1.3E-24
score: 88.9
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 32..158
e-value: 8.2E-20
score: 73.3
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 477..615
e-value: 1.1E-21
score: 79.4
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 330..466
e-value: 1.5E-9
score: 40.2
IPR035914Spermadhesin, CUB domain superfamilyGENE3DG3DSA:2.60.120.290coord: 618..742
e-value: 8.0E-21
score: 76.3
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 183..278
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 484..614
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 625..739
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 327..465
IPR035914Spermadhesin, CUB domain superfamilySUPERFAMILYSSF49854Spermadhesin, CUB domaincoord: 36..138