Acetylcholine receptor subunit alpha-like

Overview
NameAcetylcholine receptor subunit alpha-like
Smed IDSMED30009442
Length (bp)1760
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetylcholine receptor subunit alpha-like (SMED30009442) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30009442) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetylcholine receptor subunit alpha-like (SMED30009442) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30009442) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009442

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30009442SMESG000068777.1 dd_Smed_v4_12182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009442SMESG000068777.1 dd_Smed_v4_12182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009442SMESG000068777.1 dd_Smed_v4_12182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009442SMESG000068777.1 dd_Smed_v4_12182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009442SMESG000068777.1 dd_Smed_v4_12182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 361.303 bits (926), Expect = 3.272e-118
Identity = 203/530 (38.30%), Postives = 294/530 (55.47%), Query Frame = 2
Query:  164 CNFAVFWLILISLSEFHCGIN---EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            C+    WL L + S  H  +    ++KL + L        +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q+C +KFGSW+Y G  +DL++Q  D                 +  Y+ NGE+D+V  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     ++    V          R+   P++      G +   PP+             +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:    3 CSPGGVWLALAA-SLLHVSLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEAD-----------------ISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLA-----SVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQ---PPEGDP----------DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 361.303 bits (926), Expect = 3.272e-118
Identity = 203/530 (38.30%), Postives = 294/530 (55.47%), Query Frame = 2
Query:  164 CNFAVFWLILISLSEFHCGIN---EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            C+    WL L + S  H  +    ++KL + L        +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q+C +KFGSW+Y G  +DL++Q  D                 +  Y+ NGE+D+V  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     ++    V          R+   P++      G +   PP+             +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:    3 CSPGGVWLALAA-SLLHVSLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEAD-----------------ISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLA-----SVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQ---PPEGDP----------DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 359.377 bits (921), Expect = 4.466e-117
Identity = 194/490 (39.59%), Postives = 279/490 (56.94%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q+C +KFGSW+Y G  +DL++Q  D                 +  Y+ NGE+D+V  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     ++    V          R+   P++      G +   PP+             +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:   66 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEAD-----------------ISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLA-----SVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQ---PPEGDP----------DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 520          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 357.836 bits (917), Expect = 6.250e-117
Identity = 201/530 (37.92%), Postives = 293/530 (55.28%), Query Frame = 2
Query:  164 CNFAVFWLILISLSEFHCGIN---EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            C+    WL L + S  H  +    ++KL + L        +N LERP  NDSQP+ V     L Q++DVD+K Q++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q+C +KFGSW+Y G  +DL++Q  D                 +  Y+ NGE+D+V  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     ++    V          R+   P++      G +   PP+             +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:    3 CSPGGVWLALAA-SLLHVSLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEAD-----------------ISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLA-----SVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQ---PPEGDP----------DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 357.836 bits (917), Expect = 6.250e-117
Identity = 201/530 (37.92%), Postives = 293/530 (55.28%), Query Frame = 2
Query:  164 CNFAVFWLILISLSEFHCGIN---EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            C+    WL L + S  H  +    ++KL + L        +N LERP  NDSQP+ V     L Q++DVD+K Q++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q+C +KFGSW+Y G  +DL++Q  D                 +  Y+ NGE+D+V  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     ++    V          R+   P++      G +   PP+             +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:    3 CSPGGVWLALAA-SLLHVSLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEAD-----------------ISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLA-----SVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQ---PPEGDP----------DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-9 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q18556])

HSP 1 Score: 352.443 bits (903), Expect = 8.808e-115
Identity = 206/529 (38.94%), Postives = 303/529 (57.28%), Query Frame = 2
Query:  200 LSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIP--ADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDA-----------NSKFTFSHVFDVESDFRVHG-----IGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            L+E H   +E +LL  L     P      ERP  N S+P+ V +K +L Q++DVDEKNQ+I    W++ +W DY  +W+PS YGGI   +IP  A+ +WKPD+LL+NSAD+ FD TYP N VV  +  +  VPPG+ K +C IDIT+FPFD Q C +KFGSWTYSG +IDLR+  P+  +    G       I+++ YV NGE++++  P       F+ + Y ++   + +QR+ LYY  NLIIP  LIS M +L FTLPPDAGEKI+L +TILLS+  FL +VAD  P TS A+ L+G +F+C M + S S+VFTVLVLN H+R      + P +++++  WL  +L M++  +  I N    K +   E  + G   N      P D+           N K       D E +F V       +  S+ + R+      M+    E+ +  + +K    +C    EL  I  + + + +K+++DE +   A +WKFAA V+DRCCL  FS+FI++ST  ++  +P
Sbjct:   19 LTEVHSSADEYRLLADLRHNYDP-----YERPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWIEYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPVNYVVSYTGDVLQVPPGILKLSCKIDITYFPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDEG-------IDVQYYVQNGEWNLLAVPARHETNIFDEQPYPSLFFYLIIQRRTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASVVFTVLVLNLHNRKPETHEMSPFLRELLLIWLPWLLLMRRPGK-TIFNCTHLKAEKAEEKAKQGSIKNGVGPGKPTDSVHPSEGLSLMKNIKLGRQQTIDFEYEFHVQHNHLMPVAPSEMTPRV-TYSKVMAESYVEDVVMTELNKYMQKAC---LELKNISSQTRAMRKKMEEDERDEQAANDWKFAAMVVDRCCLITFSVFIVVSTCGIMFSSP 530          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 339.732 bits (870), Expect = 2.759e-110
Identity = 188/495 (37.98%), Postives = 277/495 (55.96%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNE----PEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTS--FRLPKVPSYM-SFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  N S+PV V +K  L Q+IDVDEKNQ+++ N WLD  W DY+  W+ + YG I+  + PA ++WKPD+LL+NS D  FD TY TN++V ++ L+ WVPPG+FK +C IDI WFPFD Q C  KFGSWTY G  +DL+                 T   ++  Y+ NGE+ +    + R +  Y    E Y ++   + M+R+ LYY FNLI+PC+L + M LL FTLPPDAGEKI+L +T+LLS+  FL +V++  P TS A+ LLGI+F C M + + S VFTV VLN H+R+     + P  + ++  W+  +L MK+         + +    K +  SE +           R+  D     + ++ FD +     + + +S ++    L  +PS M S  G    +  + +            L  I  ELK +T+++ + + E      WKFAA V+DR CL VF++FII+ST  +   AP
Sbjct:   34 YNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQ---------------PATGGFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYASLPSLFSTKPNRHSESL----------IRNIKDNEHSLSRANSFDADCRLNQYIMTQSVSNGLTSLGSIPSTMISSNGTTTDVSQQATLLI---------LHRIYHELKIVTKRMIEGDKEEQACNNWKFAAMVVDRLCLYVFTIFIIVSTIGIFWSAP 494          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 333.569 bits (854), Expect = 2.104e-108
Identity = 190/531 (35.78%), Postives = 291/531 (54.80%), Query Frame = 2
Query:  152 IFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIP--ADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            IF   N ++  L++I  +     + E KL   L        +N LERP +N SQP+EV++K FL Q++DVDEKNQI+  N WL   W D+  QW P  YGGI   + P  +D +WKPD+LL+NSA + FD T+ +N++  ++  + W+PPG+ K  C +D+TWFPFD Q C +KFGSWT+ G  IDL++   DDD N        T  ++L +Y++NGE+ ++     R+   Y    E Y  +   + ++R+ LYY FNLIIP +LIS MA+L F  PPDAGEKI+L VTILL++  FL +V++  P TS A+ L+G++F+C M + S S+VFT++VLN H RS +   + PL+++++  +L  +LFM +     ++  +    D   +           K ++P+D N                               +PS  +  G E  I    S  T               EL+++      +E +  +  +W+FAA V+DR CL +F++FI+IS  A++  AP
Sbjct:    2 IFNLIN-SILSLVIIHSNLCDGSVAETKLFTDLLK-----GYNPLERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLYNSAAEDFDSTFKSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAIDLQI---DDDTNG-------TQSMDLSTYLVNGEWQVISTNAKRVVSYYKCCPEPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSHEMNPLVRRVLLEFLPWLLFMSRPGYKFVKANVIDSTDKMPK-----------KPKNPLDCN-------------------------------LPS--NHAGYEAQILLLHSVHT---------------ELRRVVAFYNKEEHDERIQTDWRFAAMVVDRACLLLFTVFIVISILAIMMSAP 457          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 293.508 bits (750), Expect = 7.471e-92
Identity = 145/354 (40.96%), Postives = 222/354 (62.71%), Query Frame = 2
Query:  155 FGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINR--LQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRS-VNLKPVPPLIK 1207
            F F  F V W           G +E++L   L +      +N L RP +N+S+ V V +     Q++D+DEK+QI+++N+WL + W D++  W+PS +G I   ++P + +WKPD+LL+NS D +FD T+P N VV  +  + W+PP + +S+C IDI +FPFD+Q+CT+KFGSWTYSG + DL                   + I+  +Y  NGE++++     R    Y    E Y ++  T+ ++R+ LYY FNL++PC+LIS++ALL FTLP D GEK++LGVTI +S+ +F+++VA+ +PQTS A+ L+ IYF+CIMF    S+V TV+ LN+HHRS    KP+   +K
Sbjct:   11 FFFALFRVIW----------TGDHERRLYAKLAEN-----YNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDL-----------------INTTISPATYKPNGEWELLGLTSQRSIFFYECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHRSPEQYKPMNKFLK 332          

HSP 2 Score: 49.2914 bits (116), Expect = 6.851e-6
Identity = 20/56 (35.71%), Postives = 34/56 (60.71%), Query Frame = 2
Query: 1565 ILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            IL+EL+ I+ +++ +E    +  +W FA+RV+DR C   FS F+ + T  +   AP
Sbjct:  495 ILNELRVISARVRKEEAMHALQADWMFASRVVDRVCFLAFSAFLFMCTAIISYNAP 550          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-25 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q65XS8])

HSP 1 Score: 292.738 bits (748), Expect = 1.015e-91
Identity = 165/516 (31.98%), Postives = 274/516 (53.10%), Query Frame = 2
Query:  284 LERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINR--LQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDA----NSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKV--------------PSYMSFKGAENSIPPKTSKATWPSCNSRH------ELIAIL-------DELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            LERP +N S+ V V+M   L Q++DVDEKNQ++  N WL   W DY  +W P  YGG++  +    ++W PD+L++NSAD +FD  Y +N++V  + L+ W+PPG+++ +C I + WFPFD Q C +KFGSWT+ G  ++L +     DDN            ++ +Y+ NGE+ +    + R    Y    E Y +++ T  ++R+ LYY FNLI+PC+LI+ + L+ FT PPDAGEK+SL +TI+LS+ +F   VA+  P TS A+  L  +FA  +F C+  +  T L LN+HHR+     +    + ++  W+  +L M++        ++ +++D   E  E    ++ ++  + I      ++K T +    V     V+  G+++      +V              P++ S      S PP++    W +  +R       E IA L         L +I + I++ E    +  +WKF+A V+DR C+ +F+ F+  ST A+    P
Sbjct:   40 LERPIENSSEAVMVKMGLVLQQIVDVDEKNQVVDVNAWLKFSWVDYSLKWKPEDYGGVTDLRFRKGQLWTPDVLMYNSADPQFDSRYASNLLVYPNGLVNWMPPGLYRLSCKIQVVWFPFDVQECFLKFGSWTFDGTKLNLEI-----DDNG----------FDISNYMQNGEWTLEGTTVKRNIQYYQCCPEPYYDLVFTFVIRRRALYYAFNLILPCILITMLTLVGFTFPPDAGEKMSLQITIMLSICIFQNYVAELSPPTSEAVPFLSAFFAVCLFTCACCVTATTLALNFHHRTGKSHQMNNTFRLLMLEWIPWLLMMRRPGYVARCGKIVKQDDSEDEFEERQTRLDQQRIATIISQITVESNKPTPTFPRRVTIVDEVNSDGEAEEPLPPDEVIREEDDDVASMDDPPAWRS--TTTTSQPPQSPAHLWWNATNRMGNRVPVEQIAQLLVLQQVHGHLSEINKHIREREKSKKIEDDWKFSALVVDRICMVIFTSFLFGSTVALFASVP 538          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha7 (gene:FBgn0086778 transcript:FBtr0301835)

HSP 1 Score: 421.394 bits (1082), Expect = 3.519e-141
Identity = 231/533 (43.34%), Postives = 333/533 (62.48%), Query Frame = 2
Query:  188 ILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSY---MSFKGAENSIPP----------KTSKATWPSC---NSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +LI +     G +EK+LL  L D      +N LERP  N+S P+++     L Q+IDVDEKNQ++ TNIWL L+W D + +WN S +GG+   +IP  R+WKPD+L++NSAD+ FDGTY TNVVV+N+    +VPPG+FKSTC IDITWFPFD Q C +KFGSWTY G  +DL+LQ      +E  G        ++ S++ NGE+D++  P  R +  +N   E Y++I   I ++RK LYY FNLI+PCVLI++MALL FTLPPD+GEK+SLGVTILLS+T+FL +VA+ +P TS A+ LLG YF CIMFM + S+V T+L+LNYHHR+ +   +   I+ I   WL  +L M++  +          +   S   E    +   + +   + +SK   ++V D++ DFR +    S T   LP  P+Y   M  +G + S+ P          +  +A   +C   ++ +EL  IL EL+ IT+++K +++   + ++WKFAA V+DR CL +F+LF II+T AVL  AP
Sbjct:   48 LLIMIPACAAGPHEKRLLHALLDN-----YNSLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYATNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQ------DEAGG--------DISSFITNGEWDLLGVPGKRNEIYYNCCPEPYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNPDTHEMSEWIRVIFLYWLPCILRMQRPGQVGYECPPPPSSSSSSASGEKKQQIQNVELK---ERSSKSLLANVLDIDDDFRCNHRCASAT---LPHQPTYYRTMYRQGDDGSVGPVGPAGPVVDGRLHEAISHTCLTSSAEYELALILKELRWITEQLKKEDETSDITRDWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 555          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha7 (gene:FBgn0086778 transcript:FBtr0301834)

HSP 1 Score: 421.394 bits (1082), Expect = 3.730e-141
Identity = 231/533 (43.34%), Postives = 333/533 (62.48%), Query Frame = 2
Query:  188 ILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSY---MSFKGAENSIPP----------KTSKATWPSC---NSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +LI +     G +EK+LL  L D      +N LERP  N+S P+++     L Q+IDVDEKNQ++ TNIWL L+W D + +WN S +GG+   +IP  R+WKPD+L++NSAD+ FDGTY TNVVV+N+    +VPPG+FKSTC IDITWFPFD Q C +KFGSWTY G  +DL+LQ      +E  G        ++ S++ NGE+D++  P  R +  +N   E Y++I   I ++RK LYY FNLI+PCVLI++MALL FTLPPD+GEK+SLGVTILLS+T+FL +VA+ +P TS A+ LLG YF CIMFM + S+V T+L+LNYHHR+ +   +   I+ I   WL  +L M++  +          +   S   E    +   + +   + +SK   ++V D++ DFR +    S T   LP  P+Y   M  +G + S+ P          +  +A   +C   ++ +EL  IL EL+ IT+++K +++   + ++WKFAA V+DR CL +F+LF II+T AVL  AP
Sbjct:   48 LLIMIPACAAGPHEKRLLHALLDN-----YNSLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYATNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQ------DEAGG--------DISSFITNGEWDLLGVPGKRNEIYYNCCPEPYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNPDTHEMSEWIRVIFLYWLPCILRMQRPGQVGYECPPPPSSSSSSASGEKKQQIQNVELK---ERSSKSLLANVLDIDDDFRCNHRCASAT---LPHQPTYYRTMYRQGDDGSVGPVGPAGPVVDGRLHEAISHTCLTSSAEYELALILKELRWITEQLKKEDETSDITRDWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 555          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha7 (gene:FBgn0086778 transcript:FBtr0343798)

HSP 1 Score: 421.394 bits (1082), Expect = 3.730e-141
Identity = 231/533 (43.34%), Postives = 333/533 (62.48%), Query Frame = 2
Query:  188 ILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSY---MSFKGAENSIPP----------KTSKATWPSC---NSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +LI +     G +EK+LL  L D      +N LERP  N+S P+++     L Q+IDVDEKNQ++ TNIWL L+W D + +WN S +GG+   +IP  R+WKPD+L++NSAD+ FDGTY TNVVV+N+    +VPPG+FKSTC IDITWFPFD Q C +KFGSWTY G  +DL+LQ      +E  G        ++ S++ NGE+D++  P  R +  +N   E Y++I   I ++RK LYY FNLI+PCVLI++MALL FTLPPD+GEK+SLGVTILLS+T+FL +VA+ +P TS A+ LLG YF CIMFM + S+V T+L+LNYHHR+ +   +   I+ I   WL  +L M++  +          +   S   E    +   + +   + +SK   ++V D++ DFR +    S T   LP  P+Y   M  +G + S+ P          +  +A   +C   ++ +EL  IL EL+ IT+++K +++   + ++WKFAA V+DR CL +F+LF II+T AVL  AP
Sbjct:   48 LLIMIPACAAGPHEKRLLHALLDN-----YNSLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYATNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQ------DEAGG--------DISSFITNGEWDLLGVPGKRNEIYYNCCPEPYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNPDTHEMSEWIRVIFLYWLPCILRMQRPGQVGYECPPPPSSSSSSASGEKKQQIQNVELK---ERSSKSLLANVLDIDDDFRCNHRCASAT---LPHQPTYYRTMYRQGDDGSVGPVGPAGPVVDGRLHEAISHTCLTSSAEYELALILKELRWITEQLKKEDETSDITRDWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 555          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha7 (gene:FBgn0086778 transcript:FBtr0074680)

HSP 1 Score: 421.394 bits (1082), Expect = 3.730e-141
Identity = 231/533 (43.34%), Postives = 333/533 (62.48%), Query Frame = 2
Query:  188 ILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSY---MSFKGAENSIPP----------KTSKATWPSC---NSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +LI +     G +EK+LL  L D      +N LERP  N+S P+++     L Q+IDVDEKNQ++ TNIWL L+W D + +WN S +GG+   +IP  R+WKPD+L++NSAD+ FDGTY TNVVV+N+    +VPPG+FKSTC IDITWFPFD Q C +KFGSWTY G  +DL+LQ      +E  G        ++ S++ NGE+D++  P  R +  +N   E Y++I   I ++RK LYY FNLI+PCVLI++MALL FTLPPD+GEK+SLGVTILLS+T+FL +VA+ +P TS A+ LLG YF CIMFM + S+V T+L+LNYHHR+ +   +   I+ I   WL  +L M++  +          +   S   E    +   + +   + +SK   ++V D++ DFR +    S T   LP  P+Y   M  +G + S+ P          +  +A   +C   ++ +EL  IL EL+ IT+++K +++   + ++WKFAA V+DR CL +F+LF II+T AVL  AP
Sbjct:   48 LLIMIPACAAGPHEKRLLHALLDN-----YNSLERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYATNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQ------DEAGG--------DISSFITNGEWDLLGVPGKRNEIYYNCCPEPYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNPDTHEMSEWIRVIFLYWLPCILRMQRPGQVGYECPPPPSSSSSSASGEKKQQIQNVELK---ERSSKSLLANVLDIDDDFRCNHRCASAT---LPHQPTYYRTMYRQGDDGSVGPVGPAGPVVDGRLHEAISHTCLTSSAEYELALILKELRWITEQLKKEDETSDITRDWKFAAMVVDRLCLIIFTLFTIIATLAVLFSAP 555          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0300594)

HSP 1 Score: 429.098 bits (1102), Expect = 4.407e-141
Identity = 241/535 (45.05%), Postives = 337/535 (62.99%), Query Frame = 2
Query:  176 VFWLILISLSEFHC--GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRN-ELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSY---MSFKGAENSIPPKTS-----KATWPSC---NSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +F LI ++LS   C  G +EK+LL  L D      +N LERP  N+S P+++     L Q+IDVDEKNQ++ TN+WL L+W D + +WN S YGG+   +IP  R+WKPD+L++NSAD+ FDGTY TNVVV+N+    +VPPG+FKSTC IDITWFPFD Q C +KFGSWTY G  +DL+LQ       ++TG        ++ SYVLNGE++++  P  R +  +N   E Y++I   I ++R+ LYY FNLIIPCVLI++MALL FTLPPD+GEK+SLGVTILLS+T+FL +VA+ +P TS A+ LLG YF CIMFM + S+V T+L+LNYHHR+ +   +   I+ +   WL  +L M +   P I        +D  SE     LS    K RS     SK   ++V D++ DFR H          LP  P++   +  +G + SI P  S       T  +C   ++ +EL  IL E++ IT +++ D++   +A +WKFAA V+DR CL +F++F I++T AVL  AP
Sbjct:  294 IFLLIYLNLSAKVCLAGYHEKRLLHDLLD-----PYNTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQ-------DETGG-------DISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSRPGRPLILEFPTTPCSDTSSERKHQILSDVELKERS-----SKSLLANVLDIDDDFR-HNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAP 803          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 369.392 bits (947), Expect = 1.980e-121
Identity = 209/508 (41.14%), Postives = 299/508 (58.86%), Query Frame = 2
Query:  218 GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCN-SRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G ++++L R L        +N LERP  ND+  + V     L Q++DVDEKNQ++ TNIWL L W DY+ QWN S Y G++  + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++      D + TG            Y+ NGE+D+V+ P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TV VL YH+       +P   + ++  W A  L MK+  E ++R     K    S    + + +N     SP  A S  T  ++  +   FR        TS     + S +   G E+ + P    ++  S      EL  ILDE++ I+++ +D ++E T+  EWKFAA VIDR CL  FSLF I+ T  +L  AP
Sbjct:   23 GEHQRRLYRDLMKD-----YNPLERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQMI-----DADITG------------YIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFLRMKRPGEDKVRPACHNKQPRSS---LSSVDLNI----SPGVAQS--TNGNLLYI--GFRGMDTIHYATSPDSGVICSRLVATGEEDVLLPGAQASSVSSSGPGETELSKILDEVRYISKRFRDQDEEDTVCNEWKFAASVIDRLCLMAFSLFTILCTIGILMSAP 497          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 369.007 bits (946), Expect = 2.914e-121
Identity = 209/508 (41.14%), Postives = 299/508 (58.86%), Query Frame = 2
Query:  218 GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCN-SRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G ++++L R L        +N LERP  ND+  + V     L Q++DVDEKNQ++ TNIWL L W DY+ QWN S Y G++  + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++      D + TG            Y+ NGE+D+V+ P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TV VL YH+       +P   + ++  W A  L MK+  E ++R     K    S    + + +N     SP  A S  T  ++  +   FR        TS     + S +   G E+ + P    ++  S      EL  ILDE++ I+++ +D ++E T+  EWKFAA VIDR CL  FSLF I+ T  +L  AP
Sbjct:   24 GEHQRRLYRDLMKD-----YNPLERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQMI-----DADITG------------YIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFLRMKRPGEDKVRPACHNKQPRSS---LSSVDLNI----SPGVAQS--TNGNLLYI--GFRGMDTIHYATSPDSGVICSRLVATGEEDVLLPGAQASSVSSSGPGETELSKILDEVRYISKRFRDQDEEDTVCNEWKFAASVIDRLCLMAFSLFTILCTIGILMSAP 498          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: FO907089.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101882451])

HSP 1 Score: 352.058 bits (902), Expect = 2.548e-114
Identity = 200/511 (39.14%), Postives = 290/511 (56.75%), Query Frame = 2
Query:  218 GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVE-SDFRVHGIGKSKTSFRLPK---VPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G ++++L R L     P     LERP  NDS  + V     L Q++DVDEKNQ++ TNIWL L W DY+ +WN S Y G++  + P   +W+PD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V+ P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YH+   +   +P   + ++  W A  L M++  E  IR     K    S +    LSV+    ++       F F  +  V  +    H +  S+          +P      G  + I   T +          EL  IL+E++ I ++ +D + + ++  EWKFAA VIDR CL  FS+F I+ T  +L  AP
Sbjct:   54 GEHQRRLYRDLMKNYNP-----LERPVYNDSHSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWTDYYLRWNMSDYPGVNTVRFPDSLIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWALDLQMINAD-----------------ITGYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHYHDPDGAKMPKWTRVLLLNWCAWFLRMRRPGEDRIRLACHNKPARRSSVSSVELSVSQGALQAAGGNMLYFGFRGMEGVHYTAHESHSVLCSRLMANSEDDVLLPGAQIRGGVTSGIVGGTLEL---------ELAKILEEVRYIAKRFRDQDADESVCNEWKFAAAVIDRLCLMAFSIFTILCTIGILMSAP 533          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 345.125 bits (884), Expect = 3.040e-112
Identity = 203/518 (39.19%), Postives = 289/518 (55.79%), Query Frame = 2
Query:  188 ILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCP--INRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAE-NSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +L  L+    G  ++KL + L +      +N LERP  NDS P+ V +   L Q+IDVDEKNQ++ TN WL L W D +  WNP  Y G+   + P++++W PD+LL+NSAD++FD T+ TNV+V  S   Q++PPG+ KSTC ID+ WFPFD Q C +KFGSWT++G  +DL++Q                  +++ +Y+ NGE+D+V  P   N L Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TVLVL +HH       +P  ++ I+  W A  L MK+  E    N    K D       +  S+          + +  T  H+      F  H I  +      P   S +S  G      P +  +          E+  IL E+  I Q+ +D ++   +  EWKFAA V+DR CL  FSLF II TF +L  AP
Sbjct:    2 MLAQLTRSLQGEYQRKLYKELMEN-----YNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQ-----------------AVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVRVILLNWCAWFLRMKKPGEERKANF---KYDQSPAHHASASSIQMGVMPGQPSSTNSTTNGHM---NLYFGYHSIDSACCP---PSSDSGVSCSGGRVGGSPNEEQREGVRMFAGEPEIHRILAEVMYIAQRFRDQDEAEAICSEWKFAAAVVDRLCLVAFSLFSIICTFTILMSAP 488          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 344.739 bits (883), Expect = 6.077e-112
Identity = 201/508 (39.57%), Postives = 285/508 (56.10%), Query Frame = 2
Query:  218 GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCP--INRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAE-NSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G  ++KL + L +      +N LERP  NDS P+ V +   L Q+IDVDEKNQ++ TN WL L W D +  WNP  Y G+   + P++++W PD+LL+NSAD++FD T+ TNV+V  S   Q++PPG+ KSTC ID+ WFPFD Q C +KFGSWT++G  +DL++Q                  +++ +Y+ NGE+D+V  P   N L Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TVLVL +HH       +P  ++ I+  W A  L MK+  E    N    K D       +  S+          + +  T  H+      F  H I  +      P   S +S  G      P +  +          E+  IL E+  I Q+ +D ++   +  EWKFAA V+DR CL  FSLF II TF +L  AP
Sbjct:   20 GEYQRKLYKELMEN-----YNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQ-----------------AVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVRVILLNWCAWFLRMKKPGEERKANF---KYDQSPAHHASASSIQMGVMPGQPSSTNSTTNGHM---NLYFGYHSIDSACCP---PSSDSGVSCSGGRVGGSPNEEQREGVRMFAGEPEIHRILAEVMYIAQRFRDQDEAEAICSEWKFAAAVVDRLCLVAFSLFSIICTFTILMSAP 496          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: ENSXETT00000021532.1 (cholinergic receptor, nicotinic alpha 7 [Source:NCBI gene;Acc:100493611])

HSP 1 Score: 357.836 bits (917), Expect = 5.707e-117
Identity = 202/509 (39.69%), Postives = 287/509 (56.39%), Query Frame = 2
Query:  218 GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRH--ELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G  ++KL + L     P     LERP  NDS P+ V     L Q++DVDEKNQ++ TNIWL ++W DY+ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD ++ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V  P  R +  Y    E Y+++  TI M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R  + Q  +    M     SV+         +N    +     +E      GI  + T       P      G     P           +S    +L  IL+EL+ I  + +D +D+ ++  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:   25 GEYQRKLYKELMKNYNP-----LERPVLNDSHPLTVYFGMSLMQIMDVDEKNQVLTTNIWLQMQWIDYYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDASFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDIQKCNLKFGSWTYGGWSLDLQMLESD-----------------ISEYISNGEWDLVGVPGKRSENYYECCKEPYLDVTFTIIMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPHGGNMPKWTRIILLNWCAWFLRMKRPGEDKVR-PVCQHKERRCSMT----SVDVNTVSGQQSSNGNMLYIGFRGLE------GIHCTPT-------PDSGVICGRMTCSPTDDENLLHNVHHSEGDPDLSKILEELRYIANRFRDQDDDESICNEWKFAASVVDRLCLMAFSVFTIICTIGILMSAP 493          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: clca2 (chloride channel accessory 2 [Source:Xenbase;Acc:XB-GENE-980364])

HSP 1 Score: 340.887 bits (873), Expect = 2.108e-110
Identity = 200/512 (39.06%), Postives = 291/512 (56.84%), Query Frame = 2
Query:  212 HCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCP--INRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMK---QNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            H G  ++KL R L        +N LERP  NDSQP+ V ++  L Q+IDVDEKNQ++ TN WL + W D++  W+ + Y G+   + PAD +W PD+LL+NSAD++FD T+ TNV+V ++   Q++PPG+ KSTC ID+ WFPFD Q C +KFGSWT++G  +DL++   D                 + SY+ NGE+D+V  P   N L Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA IM +  LS+V TVLVL +HH       +P +++ I+  W A  L M+   +N  P     ++  +      IE    +N        + N  +   H  +          G        P +          + I  K+ K + P      E++ IL+E++ I ++ ++ +    +  EWKFAA VIDR CL  FSLF II+TF +L  AP
Sbjct:   13 HQGQYQRKLYRELLRN-----YNRLERPVVNDSQPLLVELQLTLLQIIDVDEKNQVLITNAWLQITWNDFYLTWDQAEYPGVQTLRFPADHIWVPDILLYNSADERFDATFHTNVLVNSTGACQYIPPGILKSTCYIDVRWFPFDVQKCKLKFGSWTHNGWLLDLQMMEAD-----------------ISSYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASIMVIVGLSVVVTVLVLQFHHHDPQAGKMPKMVRVILLNWCAWFLRMRKPGENKRPIPCKYIYPNHHSSISSIE----MNIAPGHQSTNGNIVYCGYHTLESPCCPPNSDSGVMCARVNCPSLED-------SDLIQKKSLKESMP------EIVKILEEVQYIARRFREQDAGEEICSEWKFAAAVIDRLCLVAFSLFAIIATFTILMSAP 485          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 270.781 bits (691), Expect = 1.442e-83
Identity = 170/505 (33.66%), Postives = 262/505 (51.88%), Query Frame = 2
Query:  200 LSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNN--ETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIIST 1708
            L  F C   E +L   L     P       RP  N S PV +  +  ++QL+ VDE NQI+ TN+WL   W DY  +WNPS YGGI   +IPA ++W+PD++L+N+A   F        VV+ S  + W+PP +FKS+C ID+T+FPFD QNC++KFGSWTY               D  K  +    S INL+ +  +GE+ I++ P  + +  +N   E Y +I  ++ ++R PL+Y   +IIPC+LIS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV TV VLN H+R+     +P  +K+     L KV+FM +   PE +    +         +  L ++  + RS  D         +F  +S      + +  TS     V    S +   N +   +     P      E+   ++++  I + +K  ++   +  +WK+ A VIDR  L VF L  I+ T
Sbjct:   19 LLGFFCSNVEHRLYEDLLKSYNPYI-----RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTY---------------DKAKINLVMIGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTR---PEKQPYALKP--------QAYLDISSSEIRSCQD--------QLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYN-LGLHSGSGLSP------EIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGT 477          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 270.781 bits (691), Expect = 1.609e-83
Identity = 170/505 (33.66%), Postives = 262/505 (51.88%), Query Frame = 2
Query:  200 LSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNN--ETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIIST 1708
            L  F C   E +L   L     P       RP  N S PV +  +  ++QL+ VDE NQI+ TN+WL   W DY  +WNPS YGGI   +IPA ++W+PD++L+N+A   F        VV+ S  + W+PP +FKS+C ID+T+FPFD QNC++KFGSWTY               D  K  +    S INL+ +  +GE+ I++ P  + +  +N   E Y +I  ++ ++R PL+Y   +IIPC+LIS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV TV VLN H+R+     +P  +K+     L KV+FM +   PE +    +         +  L ++  + RS  D         +F  +S      + +  TS     V    S +   N +   +     P      E+   ++++  I + +K  ++   +  +WK+ A VIDR  L VF L  I+ T
Sbjct:   16 LLGFFCSNVEHRLYEDLLKSYNPYI-----RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTY---------------DKAKINLVMIGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTR---PEKQPYALKP--------QAYLDISSSEIRSCQD--------QLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYN-LGLHSGSGLSP------EIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGT 474          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 270.396 bits (690), Expect = 1.869e-83
Identity = 170/505 (33.66%), Postives = 262/505 (51.88%), Query Frame = 2
Query:  200 LSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNN--ETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIIST 1708
            L  F C   E +L   L     P       RP  N S PV +  +  ++QL+ VDE NQI+ TN+WL   W DY  +WNPS YGGI   +IPA ++W+PD++L+N+A   F        VV+ S  + W+PP +FKS+C ID+T+FPFD QNC++KFGSWTY               D  K  +    S INL+ +  +GE+ I++ P  + +  +N   E Y +I  ++ ++R PL+Y   +IIPC+LIS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV TV VLN H+R+     +P  +K+     L KV+FM +   PE +    +         +  L ++  + RS  D         +F  +S      + +  TS     V    S +   N +   +     P      E+   ++++  I + +K  ++   +  +WK+ A VIDR  L VF L  I+ T
Sbjct:   11 LLGFFCSNVEHRLYEDLLKSYNPYI-----RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTY---------------DKAKINLVMIGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTR---PEKQPYALKP--------QAYLDISSSEIRSCQD--------QLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYN-LGLHSGSGLSP------EIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGT 469          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 358.221 bits (918), Expect = 3.350e-117
Identity = 195/488 (39.96%), Postives = 276/488 (56.56%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V  S   Q++PPG+FKS+C ID+ WFPFD Q C +KFGSW+Y G  +DL++Q  D                 + SY+ NGE+D++  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     +E               RL   P++                 T PS +   +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQEAD-----------------ISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHKPRRCSLA-----SVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDE----------HLMHGTHPS-DGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 285.804 bits (730), Expect = 2.963e-89
Identity = 173/499 (34.67%), Postives = 268/499 (53.71%), Query Frame = 2
Query:  227 EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGK-SKTSFRLPKVPSYMSFKG--AENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIIST 1708
            E +L +YLF+      +N + RP  N S PV ++ +  ++QL+ VDE NQI+ TN+WL   W DY  +W PS Y G+   ++PA+++WKPD++L+N+AD  F     T  ++K +  + W+PP +FKS+C ID+T+FPFD QNCT+KFGSW+Y    IDL L                 S +NL+ Y  +GE+ I+  P  + +  +N   E Y +I  ++ ++R PL+Y  NLIIPC+LIS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV TV VLN H+R+     +P  +K +    L +V+FM +    E  +    +N  G+E+       +   C S  D+ S        D    +  H   K S  S  L +  S  S     + +++ P+  +A              +  +K I + +K       +  +WK+ A VIDR  L VF L  I+ T
Sbjct:   34 EHRLFQYLFED-----YNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLI---------------GSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTE-EDAPKTRNFYGAEL-------SNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEA--------------IQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGT 490          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 285.804 bits (730), Expect = 2.964e-89
Identity = 173/499 (34.67%), Postives = 268/499 (53.71%), Query Frame = 2
Query:  227 EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGK-SKTSFRLPKVPSYMSFKG--AENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIIST 1708
            E +L +YLF+      +N + RP  N S PV ++ +  ++QL+ VDE NQI+ TN+WL   W DY  +W PS Y G+   ++PA+++WKPD++L+N+AD  F     T  ++K +  + W+PP +FKS+C ID+T+FPFD QNCT+KFGSW+Y    IDL L                 S +NL+ Y  +GE+ I+  P  + +  +N   E Y +I  ++ ++R PL+Y  NLIIPC+LIS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV TV VLN H+R+     +P  +K +    L +V+FM +    E  +    +N  G+E+       +   C S  D+ S        D    +  H   K S  S  L +  S  S     + +++ P+  +A              +  +K I + +K       +  +WK+ A VIDR  L VF L  I+ T
Sbjct:   29 EHRLFQYLFED-----YNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLI---------------GSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTE-EDAPKTRNFYGAEL-------SNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEA--------------IQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGT 485          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 280.026 bits (715), Expect = 2.055e-87
Identity = 142/357 (39.78%), Postives = 217/357 (60.78%), Query Frame = 2
Query:  227 EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFN--NETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFM-----KQNNEPEIRN 1276
            E +L +YLF+      +N + RP  N S PV ++ +  ++QL+ VDE NQI+ TN+WL   W DY  +W PS Y G+   ++PA+++WKPD++L+N+AD  F     T  ++K +  + W+PP +FKS+C ID+T+FPFD QNCT+KFGSW+Y    IDL L                 S +NL+ Y  +GE+ I+  P  + +  +N   E Y +I  ++ ++R PL+Y  NLIIPC+LIS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV TV VLN H+R+     +P  +K +    L +V+FM      + + P+ RN
Sbjct:   29 EHRLFQYLFED-----YNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLI---------------GSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRN 365          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 271.166 bits (692), Expect = 9.392e-84
Identity = 165/503 (32.80%), Postives = 262/503 (52.09%), Query Frame = 2
Query:  224 NEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINR--LQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRH--ELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVL 1720
            +E++L   LF       +N   RP +N S PV V  +  +TQL +VDE NQI+ TN+WL   WKDY  +W+P+ Y GI   ++PAD +WKPD++L+N+A   F     T  ++K   ++ W PP +FKS+C +DIT+FPFD QNC++KFGSWTY    IDL +                 S +++  +  N E++IVD    +  ++Y+   E Y +I  +  ++R P++Y  NLIIPC+ IS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV TV VLN H+R+     +P  +K I       +L M        R  L +  + G            +  +S     +K  F+H  + +     H   KS          S ++     +S  P    A W + NS H  ++  +++ ++ I + +K   +   +  +WK+ A V+DR  L VF +  +  T  + 
Sbjct:   33 SEEQLFHRLFAH-----YNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLII---------------GSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMM--------RKPLDKTKEAG----------GVKDPKSHTKRPAKVKFTHRGESKLLKECHHCQKS----------SDIAPGKRRSSQQP----ARWVAENSEHSSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGLF 483          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P22770|ACHA7_CHICK (Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 9.998e-118
Identity = 197/488 (40.37%), Postives = 282/488 (57.79%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P   +WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q C +KFGSWTY G  +DL++Q  D                 +  Y+ NGE+D+V  P  R +  Y    E Y +I  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       +V+ ++C     +N    +     ++    VH    + +     ++    S    EN +         P      +L  IL+E++ I  + +D ++E  +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:   37 YNPLERPVANDSQPLTVYFTLSLMQIMDVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKNVRFPDGLIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQKCNLKFGSWTYGGWSLDLQMQEAD-----------------ISGYISNGEWDLVGIPGKRTESFYECCKEPYPDITFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLSSMEMNTVSGQQC-----SNGNMLYIGFRGLDG---VHCTPTTDSGVICGRMTC--SPTEEENLLHSGHPSEGDP------DLAKILEEVRYIANRFRDQDEEEAICNEWKFAASVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P36544|ACHA7_HUMAN (Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5)

HSP 1 Score: 361.303 bits (926), Expect = 1.571e-117
Identity = 203/530 (38.30%), Postives = 294/530 (55.47%), Query Frame = 2
Query:  164 CNFAVFWLILISLSEFHCGIN---EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            C+    WL L + S  H  +    ++KL + L        +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q+C +KFGSW+Y G  +DL++Q  D                 +  Y+ NGE+D+V  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     ++    V          R+   P++      G +   PP+             +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:    3 CSPGGVWLALAA-SLLHVSLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEAD-----------------ISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLA-----SVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQ---PPEGDP----------DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|Q866A2|ACHA7_MACMU (Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.790e-116
Identity = 201/530 (37.92%), Postives = 293/530 (55.28%), Query Frame = 2
Query:  164 CNFAVFWLILISLSEFHCGIN---EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            C+    WL L + S  H  +    ++KL + L        +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKS+C ID+ WFPFD Q+C +KFGSW+Y G  +DL++Q  D                 +  Y+ +GE+D+V  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     ++               R+   P++      G +   PP+             +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:    3 CSQGGVWLALAA-SLLHVSLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEAD-----------------ISGYIPSGEWDLVGIPGKRSEKFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLA-----SVEMSAVAPPPASNGNLLYIGFRGLDGMHCAPTPDSGVVCGRMACSPTHDEHLLHGGQ---PPEGDP----------DLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P49582|ACHA7_MOUSE (Neuronal acetylcholine receptor subunit alpha-7 OS=Mus musculus OX=10090 GN=Chrna7 PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.343e-116
Identity = 195/488 (39.96%), Postives = 276/488 (56.56%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V  S   Q++PPG+FKS+C ID+ WFPFD Q C +KFGSW+Y G  +DL++Q  D                 + SY+ NGE+D++  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     +E               RL   P++                 T PS +   +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQEAD-----------------ISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHKPRRCSLA-----SVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDE----------HLMHGTHPS-DGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|Q05941|ACHA7_RAT (Neuronal acetylcholine receptor subunit alpha-7 OS=Rattus norvegicus OX=10116 GN=Chrna7 PE=1 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 3.527e-116
Identity = 195/490 (39.80%), Postives = 276/490 (56.33%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS--FKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQP+ V     L Q++DVDEKNQ++ TNIWL + W D++ QWN S Y G+   + P  ++WKPD+LL+NSAD++FD T+ TNV+V  S   Q++PPG+FKS+C ID+ WFPFD Q C +KFGSW+Y G  +DL++Q  D                 + SY+ NGE+D++  P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIS +ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS+V TV+VL YHH   +   +P   + I+  W A  L MK+  E ++R     K    S       SV       P  +N    +     +E               RL   P++      GA  S             +   +L  IL+E++ I  + +  ++   +  EWKFAA V+DR CL  FS+F II T  +L  AP
Sbjct:   37 YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQEAD-----------------ISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHKPRRCSLA-----SVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHLMHGAHPS-------------DGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAP 491          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A4S2LM73 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006211 PE=3 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.235e-159
Identity = 263/630 (41.75%), Postives = 359/630 (56.98%), Query Frame = 2
Query:  188 ILISLSEF-HCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEI-------------------------RNELFQKNDLGSEMIENGLSVNFEKCRS-------------------------------------------PIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSI---------------PPKTSKATWPSCN-----------------------------SRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +L+ L EF   G++EK+LL+YLFD  RPDAHN +ERPS+ DSQ + V +K +L Q++DVDEKNQ++ T IW+D+ W DYHF+WNP  YG I+   +P   VW+PD+LL+N AD+KFD T+PTN +++++  +QW+PPG+FKSTC+IDI WFPFD QNC +KFG+W+Y+G  +D RLQC D         C+    ++L  Y  NGEF +    + R   +Y   +  +++I M IR+QR+ LYY+FNLI+PC+LIS M+L+ F LPPDAGEKISLGVTILLS+TMFL LVADKLPQTS AI L+GIYF+C M MCSLSIVFTVLVLNYHHRS ++  VP  I+ +VN +LA+++FM+  N   I                         R+EL + N +    ++N L V +    +                                           P + +S+   ++V D+E DFRV  +  S      P  P   +  GA+N I                PKT    WP  N                              R +L  I+ EL+ IT K++DDE E  +  EWKFAARVIDR CL VF++F +++   +L  AP
Sbjct:   10 LLLFLVEFVSSGLHEKRLLKYLFDPTRPDAHNPMERPSEIDSQRLTVSVKFYLNQVMDVDEKNQVLTTIIWMDMSWDDYHFKWNPQEYGNITVINLPYTAVWRPDILLYNCADEKFDRTFPTNTIMQHTGNVQWMPPGLFKSTCNIDILWFPFDEQNCMLKFGTWSYNGDQVDFRLQCID----SSVPDCSINGTVDLSEYSANGEFHLKSASVRRFAQRYECCDYDFIDIKMNIRLQRRALYYVFNLIVPCILISGMSLMVFMLPPDAGEKISLGVTILLSLTMFLQLVADKLPQTSEAIPLIGIYFSCTMVMCSLSIVFTVLVLNYHHRSADVVAVPSWIRTLVNNYLARMMFMEAPNRSRIVVEDDAESVNSDSHLLKQEIFKVDTRDELEEINGVLDSRLQNQLKVGWNIANTNTVSPNKTDPAQSRRRQWREASNMGNGKTFPAYQDRPPGVAQIPPERSSRSLLANVLDIEDDFRVAALSASP-----PAYPISANMVGAQNRIVNSDSASPVHLNERNVPKTD--IWPPDNLSQLSDNQRSDDSFAEAGKSPIPTALLNAYRTDLEQIVTELRFITSKMRDDEQEALVNLEWKFAARVIDRFCLIVFAIFNLLAALVILFSAP 628          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A267EGF0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020283g1 PE=3 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.839e-152
Identity = 253/552 (45.83%), Postives = 346/552 (62.68%), Query Frame = 2
Query:  185 LILISLSEFHCGINEKKLLRYLFD----QNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDD--DDNE----KTGVCTETSVINLESYVLNGEF--DIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDAN-------SKFTFSHVFDVESDFRV---------HGIGKSKTSFRLPKVPSYMSFK---GAEN-SIPPKTSKATWPSCNS----RHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            L+ +SL+    G++E++LL YLFD     N  + HN +ERP KN+S  + V  K  L Q+ID+DEKNQI+  NIWLDL W DYHF W+P  +GGI+   I   RVW+PD+LL+NSAD+KFDGTYPTNVV++++  M ++PPGMF+STC ID TWFPFD+Q C +KFGSW+Y G  +DLRL+C ++    NE        C+E    +LE+YV +GE+  + +D      +Y      ++++   I+++R+ LYY  NLIIPCVLIS+M+LL F LPPDAGEKISLGVTI+LS++MF LLVAD +PQTS ++ L+G+YF+C M MCSLS+VFTV+VLNYHHR     PVP  +KK + T+LA +L M+ ++  E +  ++ +            S      R   +AN       SK   ++V D+E D R           GIG S  +F  P   + M      GAE             PSC S    R+EL A++ EL+ IT+KI DD  +  ++ EWKFAARV+DR CL +FS F +IST A+L  AP
Sbjct:   16 LVSVSLA----GLHERRLLYYLFDPANRTNPLEVHNSMERPVKNESNVLYVWFKVSLQQIIDLDEKNQILFANIWLDLTWHDYHFMWDPKDFGGITKINIDPKRVWRPDILLYNSADEKFDGTYPTNVVIEHTGNMNFIPPGMFRSTCKIDTTWFPFDTQVCKLKFGSWSYDGGTLDLRLKCSNESLSTNEMRLNDPNNCSEIGGADLETYVPSGEWYLEGMDGKRTAAEYDCCPYPFIDLSYFIQIRRRTLYYGINLIIPCVLISSMSLLTFVLPPDAGEKISLGVTIMLSLSMFQLLVADAMPQTSESVPLIGMYFSCTMVMCSLSVVFTVIVLNYHHRDAESHPVPNWVKKFICTYLANILCMRNHHRDEEKEPVYLRR-------RKNASFRTSSYREAANANVELKERSSKSLLANVLDLEDDIRTVGGVGGVGVSGIGASAGAFSPPTYQNVMGSSMDGGAERGGGGGGGGGGGGPSCGSNCSTRNELAAVVRELQVITKKIADDTADGEISSEWKFAARVVDRLCLIIFSCFTVISTCAILFSAP 556          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A267DHA4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020283g2 PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 4.618e-152
Identity = 250/543 (46.04%), Postives = 340/543 (62.62%), Query Frame = 2
Query:  218 GINEKKLLRYLFD----QNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDD--DDNE----KTGVCTETSVINLESYVLNGEF--DIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDAN-------SKFTFSHVFDVESDFRV---------HGIGKSKTSFRLPKVPSYMSFK---GAEN---SIPPKTSKATWPSCNS----RHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G++E++LL YLFD     N  + HN +ERP KN+S  + V  K  L Q+ID+DEKNQI+  NIWLDL W DYHF W+P  +GGI+   I   RVW+PD+LL+NSAD+KFDGTYPTNVV++++  M ++PPGMF+STC ID TWFPFD+Q C +KFGSW+Y G  +DLRL+C ++    NE        C+E    +LE+YV +GE+  + +D      +Y      ++++   I+++R+ LYY  NLIIPCVLIS+M+LL F LPPDAGEKISLGVTI+LS++MF LLVAD +PQTS ++ L+G+YF+C M MCSLS+VFTV+VLNYHHR     PVP  +KK + T+LA +L M+ ++  E +  ++ +            S      R   +AN       SK   ++V D+E D R           GIG S  +F  P   + M      GAE               PSC S    R+EL A++ EL+ IT+KI DD  +  ++ EWKFAARV+DR CL +FS F +IST A+L  AP
Sbjct:   23 GLHERRLLYYLFDPANRTNPLEVHNSMERPVKNESNVLYVWFKVSLQQIIDLDEKNQILFANIWLDLTWHDYHFMWDPKDFGGITKINIDPKRVWRPDILLYNSADEKFDGTYPTNVVIEHTGNMNFIPPGMFRSTCKIDTTWFPFDTQVCKLKFGSWSYDGGTLDLRLKCSNESLSTNEMRLNDPNNCSEIGGADLETYVPSGEWYLEGMDGKRTAAEYDCCPYPFIDLSYFIQIRRRTLYYGINLIIPCVLISSMSLLTFVLPPDAGEKISLGVTIMLSLSMFQLLVADAMPQTSESVPLIGMYFSCTMVMCSLSVVFTVIVLNYHHRDAESHPVPNWVKKFICTYLANILCMRNHHRDEEKEPIYLRR-------RKNASFRTSSYREAANANVELKERSSKSLLANVLDLEDDIRTVGGVGGVGVSGIGASAGAFSPPTYQNVMGSSMDGGAERGGGGGGGGGGGGGGPSCGSNCSTRNELAAVVRELQVITKKIADDTADGEISSEWKFAARVVDRLCLIIFSCFTVISTCAILFSAP 558          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: V5H4U2 (Putative acetylcholine receptor OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 7.681e-145
Identity = 240/543 (44.20%), Postives = 336/543 (61.88%), Query Frame = 2
Query:  131 LNMTESKIFGFCNFAVFWLILI--SLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCP--INRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAEN----SIPPKTSKATWPSC-NSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            LN+T       C   + WL L+  +  +   G +E++LL  L        +N LERP  N+S+P+ +     L Q+IDVDEKNQ+I TNIWL L W D + +W+P +YGG+   +IP  ++WKPD+L++NSAD+KFDGTYPTNVVV+++    ++PPG+FKSTC IDITWFPFD Q C +KFGSWTY+G  +DLR++  +  D              L SY+ NGE+D++  P   N  +Y+   E Y++I  TI ++R+ LYY FNLIIPCVLIS+M LL FTLPPD GE+++LGVTILLS+T+F+L +A+ +P TS A+S++G YFACIM M + S+V TV+VLNYHHR+     +P +IK +   WL  +L M+   +   R  LF    L S+M E  L           + +S+   ++V D++ DFR      S ++  L   P   S  GA +     + P    +T  +C +S  EL +IL EL+ IT +++ DE+E  +  EWKFAA V+DR CL VFS F IIST A L  AP
Sbjct:   11 LNLTR-----LCCANLLWLALLFSAPQDTEQGAHERRLLGDLLAN-----YNTLERPVFNESEPLILSFGLTLQQIIDVDEKNQLIITNIWLTLDWIDVNLRWDPKLYGGVQEVRIPPSKIWKPDVLMYNSADEKFDGTYPTNVVVRHNGSCNYIPPGIFKSTCKIDITWFPFDDQKCDLKFGSWTYNGYQLDLRVKSDEGGD--------------LSSYISNGEWDLIAVPGIRNEKEYACCPEPYIDITYTIHIRRRTLYYGFNLIIPCVLISSMTLLGFTLPPDTGERLTLGVTILLSLTVFMLQLAETMPPTSDAVSIIGTYFACIMIMVAFSVVMTVVVLNYHHRNQETTEMPAVIKTVFLVWLPWLLRMEPPGQKPGRRSLF----LNSKMKEFELK----------ERSSRSLLANVLDIDDDFRT---ANSSSAAMLGGHPECRSAAGARSYLGQDMGPAGGASTVHACVHSSRELNSILRELRFITSRMRKDEEEKEIVGEWKFAAMVVDRVCLIVFSGFTIISTCACLFSAP 512          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: G4VN55 (NAChR subunit (ShAR1-alpha-like) OS=Schistosoma mansoni OX=6183 GN=Smp_031680 PE=3 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 2.361e-144
Identity = 216/404 (53.47%), Postives = 289/404 (71.53%), Query Frame = 2
Query:  149 KIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRS 1354
            KIFG   F +F ++       +CG+ EK+LL+YLFD +RPDAHN +ERPS ND++ + V +K FL Q++DVDEKNQ++ T IW+DL W DYHF WNP  +G I+   +P   VW+PD+LL+N AD+KFD T+PTN ++K+   +QW+PPG+FKSTC+IDI WFPFD Q+C +KFGSWTY G  I+ +LQC     N     CT+   ++L  Y  NGEF +    + R   +Y   +  ++++ + I +QR+ LYY+FNLI+PC+LIS MAL+ F LPPDAGEKISLGVTILLS+TMFL LVADKLPQTS AI L+GIYF+C MFMCSLSIVFTVLVLNYHHRS +   VP  I+ IVNT+LAK++ M    EP  R+++ +  D+ S + +N +  N +K +S
Sbjct:    6 KIFGL--FMLFDIV-------YCGLYEKRLLKYLFDSSRPDAHNPIERPSANDTETLNVSVKFFLNQVMDVDEKNQVLTTIIWMDLIWNDYHFLWNPKEFGNITTLNLPYTAVWRPDILLYNCADEKFDRTFPTNTIIKHDGTVQWMPPGLFKSTCNIDILWFPFDEQSCILKFGSWTYYGDQINFQLQCI----NASQPDCTQVGTVDLSEYSRNGEFHLSGSSVRRYAQRYECCDYDFVDVKIAITLQRRALYYVFNLIVPCLLISGMALMVFMLPPDAGEKISLGVTILLSLTMFLQLVADKLPQTSEAIPLIGIYFSCTMFMCSLSIVFTVLVLNYHHRSADCVSVPAWIRNIVNTYLAKLMCM----EPPKRSQIIEVEDISSSISDNFME-NIKKSQS 391          

HSP 2 Score: 70.4774 bits (171), Expect = 6.234e-9
Identity = 34/62 (54.84%), Postives = 47/62 (75.81%), Query Frame = 2
Query: 1547 RHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            + +L  I++EL+ IT+K++D+E +  M+ EWKFAARVIDR CL +FSL  II TFA+L  AP
Sbjct:  617 KSDLELIINELRFITKKLRDNEQDELMSLEWKFAARVIDRFCLIIFSLCNIIVTFAILCSAP 678          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: ENSAMXT00000053066.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103033738])

HSP 1 Score: 361.688 bits (927), Expect = 3.602e-119
Identity = 197/495 (39.80%), Postives = 286/495 (57.78%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCN-------SRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQ + V     L Q++DVDEKNQ++ TNIWL L W DY+ QWN + Y G++  + P +++W+PD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++      D + TG            Y+ NGE+D+V+ P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YHH   +   +P   + ++  W A  L M++  E  +R+    K  L    + +      +    P ++N                                  Y+ F+G E  +   TS  +   C           EL  IL+EL+ I ++ ++ +++ ++  EWKFAA VIDR CL  FS+F I+ TF +L  AP
Sbjct:    4 YNPLERPVFNDSQSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWVDYYLQWNVTDYPGVANVRFPDNQIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMM-----DADITG------------YIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVLLLNWCAWFLRMRRPGEERVRSACHNKQ-LHRGSVSSVELSVSQGALQPNNSNML--------------------------------YIGFRGME-GVHYTTSPDSGVLCGRIMGGSEEDTELAKILEELRYIARRFRNQDEDESVCNEWKFAAAVIDRLCLMAFSIFTILCTFGILMSAP 447          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: ENSAMXT00000055784.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103033738])

HSP 1 Score: 361.688 bits (927), Expect = 7.584e-119
Identity = 201/498 (40.36%), Postives = 293/498 (58.84%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFT-FSHV----FDVESDFRV---HGIGKSKTSFRLP--KVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQ + V     L Q++DVDEKNQ++ TNIWL L W DY+ QWN + Y G++  + P +++W+PD+LL+NSAD++FD T+ TNV+V +S   Q++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++      D + TG            Y+ NGE+D+V+ P  R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YHH   +   +P   + ++  W A  L M++  E  +R+    K  L    + +      +    P ++N  +  F  +    +    D  V     +G S+    LP   V SY    G    +             +  EL  IL+EL+ I ++ ++ +++ ++  EWKFAA VIDR CL  FS+F I+ TF +L  AP
Sbjct:    4 YNPLERPVFNDSQSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWVDYYLQWNVTDYPGVANVRFPDNQIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMM-----DADITG------------YIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVLLLNWCAWFLRMRRPGEERVRSACHNKQ-LHRGSVSSVELSVSQGALQPNNSNMLYIGFRGMEGVHYTTSPDSGVLCGRIMGGSEEDVLLPGATVSSYQGRVGVGGRVTGGVVGGA-----TETELAKILEELRYIARRFRNQDEDESVCNEWKFAAAVIDRLCLMAFSIFTILCTFGILMSAP 478          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 352.058 bits (902), Expect = 2.781e-115
Identity = 195/494 (39.47%), Postives = 283/494 (57.29%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIR--NELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRH----ELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQ + V     L Q++DVDEKNQ++ +NIWL L W D++ +WN S Y G++  + P +++WKPD+LL+NSAD++FD T+ TNVVV       ++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V+    R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TV VL YH+   +   +P   + ++  W A  L MK+  E  +R  +    ++ + S  +  G+         P   N    +     +ES              RL            E  +   T+ A  PS +S      EL  IL+E++ I+++ +D ++E T+  EWKFAA VIDR CL  FS+F I+ T  +L  AP
Sbjct:    4 YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMMEAD-----------------ISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGEDRVRPCHNKQPRSSISSVELSTGV---------PQSTNGNMLYIGFRGMESMPYATSPDSGVICGRL--------VSAGEEDVLLSTNPA--PSISSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAP 461          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 352.443 bits (903), Expect = 4.821e-115
Identity = 199/529 (37.62%), Postives = 296/529 (55.95%), Query Frame = 2
Query:  170 FAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIR--NELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRH----ELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            + VF  + +++  +   +  +   R    Q+    +N LERP  NDSQ + V     L Q++DVDEKNQ++ +NIWL L W D++ +WN S Y G++  + P +++WKPD+LL+NSAD++FD T+ TNVVV       ++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V+    R +  Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TV VL YH+   +   +P   + ++  W A  L MK+  E  +R  +    ++ + S  +  G+         P   N    +     +ES              RL            E  +   T+ A  PS +S      EL  IL+E++ I+++ +D ++E T+  EWKFAA VIDR CL  FS+F I+ T  +L  AP
Sbjct:    4 YGVFLCLAVTICLWRVSLQGEHQRRLY--QDLMKNYNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMMEAD-----------------ISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGEDRVRPCHNKQPRSSISSVELSTGV---------PQSTNGNMLYIGFRGMESMPYATSPDSGVICGRL--------VSAGEEDVLLSTNPA--PSISSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAP 494          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 349.747 bits (896), Expect = 4.342e-114
Identity = 195/493 (39.55%), Postives = 281/493 (57.00%), Query Frame = 2
Query:  275 HNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVD-CPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIR--NELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRH----ELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +N LERP  NDSQ + V     L Q++DVDEKNQ++ +NIWL L W D++ +WN S Y G++  + P +++WKPD+LL+NSAD++FD T+ TNVVV       ++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V     N   Y    E Y ++  T+ M+R+ LYY  NL+IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TV VL YH+   +   +P   + ++  W A  L MK+  E  +R  +    ++ + S  +  G+         P   N    +     +ES              RL            E  +   T+ A  PS +S      EL  IL+E++ I+++ +D ++E T+  EWKFAA VIDR CL  FS+F I+ T  +L  AP
Sbjct:   24 YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMMEAD-----------------ISGYIANGEWDLVGKGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFLRMKRPGEDRVRPCHNKQPRSSISSVELSTGV---------PQSTNGNMLYIGFRGMESMPYATSPDSGVICGRL--------VSAGEEDVLLSTNPA--PSISSGGHVDTELAKILEEVRYISKRFRDQDEEETVCSEWKFAASVIDRLCLMAFSIFTILCTIGILMSAP 480          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.574 bits (732), Expect = 2.320e-91
Identity = 167/449 (37.19%), Postives = 243/449 (54.12%), Query Frame = 2
Query:  452 GISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINR--LQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMS---FKGAE---NSIPPKTSKATW-------PSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKILA 1753
            G+   +    ++W PD+LL+NSAD++FD T+ TNV+V  +   Q +PPGM KSTC ID+ WFPFD Q C +KFGSWT+ G  IDL++   D                    Y+ NGE+D+V+ P  R  L Y    E Y ++  T+ ++R+ LYY  NL++PCVLIS ++LL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+G YFA  M + + S+V TV+VL YHH + + K +P  ++ I+  W A  L MKQ      R+EL ++           LS+        +D            +      HG+    T+   P+ P         G E   NS  P+             P+     E+  IL EL+ I  + +  ++   +A EWKFAA V+DR CL  F+LF IIST ++L  AP   + +A
Sbjct:    5 GVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQMLEADT-----------------SGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFLRMKQPGRE--RHELARR-----------LSILHRNSMVSLD----LALLSASGIHKKTNGHGVFIGFTNPDAPQQPPTSDSGVMCGRETCFNSTGPEEEPGNAQRGMPPDPTAGMSSEITKILIELRYIAGRFRTQDENEAIASEWKFAAAVVDRLCLLAFTLFTIISTISILMSAPHFTEAVA 419          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 278.1 bits (710), Expect = 3.689e-87
Identity = 165/489 (33.74%), Postives = 271/489 (55.42%), Query Frame = 2
Query:  272 AHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINR--LQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSF-------RLPKVPSY-MSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIIST 1708
            ++N   RP  N S PV VR +  ++QL+ +DE NQI+ TN+WL   W DY FQWNP  + G+   ++P+D++WKPD++L+N+AD  F     T  ++K    + W+PP +FKS+C ID+T+FPFD QNCT+KFGSWTY    IDL L            V T+   INL+ +  +GE+ I+D P  +  ++Y+   + Y +I  ++ ++R PL+Y  NLIIPC+LIS + +L F LP D GEK++L +++LLS+T+FLL++ + +P TS  I L+G Y    M   +LSIV T+ VLN H+R+     +P  ++++    L K++ ++             K  +G+    +  +V  E  + P    +    +      S  +  GI ++ +S        RLP++ +  +      +S   ++  A    C    E+  ++D +K I + ++  ++   +  +WK+ A V+DR  L VF L  I+ T
Sbjct:   18 SYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVL------------VGTK---INLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQP-----------PKGSVGTAASPD--AVVSEADQQPACLCAGELSAAAASSSSSCQSGGISRASSSMEAHVSSVRLPRLRAADVMSDELSSSSSTESLDALLALCLLSPEIRQVIDSVKYIAENLRTQDEAKEVCDDWKYVAMVVDRIFLWVFVLVCILGT 478          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 260.381 bits (664), Expect = 7.608e-81
Identity = 128/323 (39.63%), Postives = 199/323 (61.61%), Query Frame = 2
Query:  290 RPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNL-KPVPPLIKKIVNTWLAKVLFMKQN 1255
            RP    S  VEV+    + QL+DVDEKNQ++ TN+WL  +W D + +WNP  YGGI+  ++PA  +W PD++L+++AD +F+G+  T  VVK+   ++W PP ++KS+C ID+T+FPFD QNC++KFGSWTY G  +DL +   D D  E               Y  NGE++ ++   N+      +  Y  I  +  ++R PL+Y   LI+PC+ +S + +  F LP D GEKISL  ++L+S+T+FLL++ + +P +S  I L+G Y   IM   +LSI+ TV V+N HHRS +   P+ P ++++    L K+L M+ +
Sbjct:   51 RPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVNSDVDRGE---------------YFDNGEWEFLNATGNKGVRLDGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCMRSH 358          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 234.572 bits (597), Expect = 6.113e-70
Identity = 129/323 (39.94%), Postives = 195/323 (60.37%), Query Frame = 2
Query:  323 VRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDC--PINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELF 1285
            VR   F T L D DEKNQ++ TN+WL  +W DY  QW+P+ Y  ++  ++P++ +W PD++L+N+AD  F  T+ T   + ++  ++W PP ++KS+C ID+T+FPFD QNCT+KFGSWTY    IDL     D               ++L+ Y  +GE+ IV      N  +Y    + Y +I  +  ++R PL+Y  NLIIPC+LIS + +L F LP D GEKI+L +++LLS+T+FLLL+ + +P TS  I L+G Y    M   +LSIV TV VLN HHRS     +P  ++++    + + L M++    + R+EL 
Sbjct:    1 VRYAEFRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMARD---------------VDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMRRPPPQQRRSELL 308          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000149.1 (pep scaffold:Pmarinus_7.0:GL480219:31373:46583:1 gene:ENSPMAG00000000129.1 transcript:ENSPMAT00000000149.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 4.231e-62
Identity = 106/248 (42.74%), Postives = 157/248 (63.31%), Query Frame = 2
Query:  515 SADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDC--PINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQ 1252
            SAD++FD T+ T+V+V ++   Q++PPG+ KS+C ID+ WFPFD Q+C +KFGSWT+ G  IDL L   D                    Y+ NGE+D++      N L Y    E Y ++  T+ ++R+ LYY  NL++PC+LIS +ALL F LP ++GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+G YFA  + +   S+V TVLVL  HH   +   +P  ++ ++  W A +L MKQ
Sbjct:    1 SADERFDATFHTSVLVNHTGGCQYIPPGILKSSCKIDVRWFPFDVQSCDLKFGSWTHDGWLIDLHLLHADT-----------------SGYLPNGEWDLIGVVGKRNELFYECCQEPYTDVTYTLLLRRRTLYYALNLLLPCMLISALALLVFLLPAESGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTLMIVGFSVVVTVLVLQCHHHDPDGTNMPTWVRVLLVHWCAWLLRMKQ 231          

HSP 2 Score: 55.8398 bits (133), Expect = 1.522e-8
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 1553 ELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPK 1735
            EL  +L E+  + ++++  +    +  EW+FAA VIDR CL  FS+  I ST A+L  AP 
Sbjct:  376 ELAGLLAEVHYLAERMRAADAGARLGGEWRFAAAVIDRLCLIAFSIVTISSTAAILVSAPS 436          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 273.478 bits (698), Expect = 1.366e-85
Identity = 140/341 (41.06%), Postives = 210/341 (61.58%), Query Frame = 2
Query:  227 EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDG---TYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCP--INRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAK 1234
            EK+LL  LF     +      RP  NDS  V V     L Q+I V+ K+Q++  ++W+  KW +    WN S YGGI    +   +VW PD++L+N+AD+ + G    Y T+V+  +    +W  P  F STC+I++ +FPFDSQNC++KFGSWTY G     RL      D+            +L  YV NGE+ ++  P  +NR+ Y+     + ++ + + +QRKPLYY+FNLIIPC LI+T+ L++F LPP++GEK+ LG+T+LL+MT+FLLLVA+ LP TS  I LLG YF   MF+ ++S+V T L+LN+ HR+ +  P+P  +K I+  ++A+
Sbjct:   38 EKRLLADLFRNYDSEV-----RPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGN----RLTMTSTSDSA-----------DLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILDYMAR 358          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N9])

HSP 1 Score: 258.07 bits (658), Expect = 1.098e-78
Identity = 167/525 (31.81%), Postives = 274/525 (52.19%), Query Frame = 2
Query:  224 NEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGT---YPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPI--NRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQN-NEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGI----GKSKTSF------RLPKVPSYMSFKGAENSIPPK-TSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKI 1747
            +E +L R LF    P       RP  +  + V V +   + Q+IDV EK+QII T+ W+   W +   +WN + YGGI    +   +VW PDL+L+N+AD   DG+   + T ++V +     W+ P +F S+C I I +FPFD Q C++KFGSWT+ G ++DL+ + P                 +L  ++ NGE+D++  P   N L+Y      Y ++  T+ ++R+ L+++FNLIIPC +I  +  L F LPPD+GE+IS+ +T LL+MT+F+L+VAD LP TS  +S++ I+++C +    ++++ T +VL YH  S ++  +PP ++ +V   L KV   +++ N+ E       K D     +ENGL       + P+     F F   F V    R  G+    G S  S       R      Y S +  ++ I  + +S +T  +  SR E +    E+    Q+ +D+ED      EWK AA ++D     +F + I IS+  +  R  ++  +
Sbjct:   49 DEGRLTRDLFAGYNPKL-----RPVFHKRENVTVVLGMSVHQIIDVYEKDQIIKTSFWVRQIWYNPFLRWNETFYGGIKEINVSPLQVWTPDLVLYNNADASTDGSLENFKTRIIVSSDGKNMWLAPVIFSSSCTIKIKYFPFDDQYCSLKFGSWTFDGFHLDLKPEAPQ---------------ASLSKFIPNGEWDLIGAPAIRNVLRYDCCPAPYPDVTFTLHLRRRVLFFLFNLIIPCFVIVVLTSLSFYLPPDSGERISVVITNLLAMTVFMLMVADILPPTSDEVSIISIFYSCSIIEVGIALLGTCIVLKYHFCSTSIHKMPPWVRFLVIECLGKVFCRQEHTNDQEDSKSDTIKLDNCKHKLENGL-------KDPLIKQCNF-FGK-FGVRERVRSSGMKTTDGGSNLSMTQDDEGRGRGGTPYSSHRNMDDIIAAEASSNSTVFALLSRQESMVKNLEILAHAQRCQDEEDR--EKNEWKLAASILDNFFCWLFLMSIFISSIVLYVRVTEAHSV 542          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 245.358 bits (625), Expect = 2.001e-74
Identity = 164/523 (31.36%), Postives = 277/523 (52.96%), Query Frame = 2
Query:  221 INEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDG---TYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINR--LQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHR--SVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLS-VNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYM---SFKGAENSIPPKTSKATWPSCNSRHELIAILDELK-KITQKIKDDEDEITMAK-------EWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            ++E  LL  L      DAH +   P  N +Q + V     L QL++VD+KNQII TN+W+  +W +   +W+P  YGGI+  +I A ++W PD++L+NSAD +F G    Y T V++ +  +  W  P  F+STC ID+T+FPFD Q C +KFGSWT+  + +DL              +  + S ++   Y+ + E+D++     R    Y+     + ++ +T   +RKPL+Y+FNLI+PC++I+ M LL F LPP++GE+I+L +T+LL+M +FL L A+ LP+ S  + +LGI++  +M   +LS++ T  VL+ HH+   + + PVP  ++  +  +L K+L +K+     I  + +   D  S++    LS +  +  R+  D   +F  S+             GKS        V   +   SF   +++    T++ T  +  +     ++   +  K TQ I    D +   +       EW++ A V+DR    +F L II+S  +V+ R+P
Sbjct:   10 LHEHTLLGDLLKGYNKDAHPV---PILNKTQYM-VTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTF--EVVDL-------------DIFADKSPLHSSQYMKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGVKK----PITEDTY---DASSKLDFKRLSMMKRDMERAVGDGKRRFGLSNG------------GKSGRRLGSRAVSDDLLMDSFDQEDDTNSNSTNQNTTNNTGNNQRTFSVQSSMNTKATQGIIVLADHVKHKRLVEINQGEWRYLAMVLDRLFFWLFVLMIILSA-SVILRSP 493          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 233.802 bits (595), Expect = 4.849e-72
Identity = 121/329 (36.78%), Postives = 193/329 (58.66%), Query Frame = 2
Query:  290 RPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDG---TYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPV---PPLIKKIVNTWLAKVLFMKQ 1252
            RP  N +  ++V     + Q+++V+ +NQII TN+W+  +W +    W+PS Y G+   ++ A  VW PD++L++SAD  F G    Y T+V++       W  P  F+STC ID+T+FPFD Q C +KFGSWTY+   +D++                  + +    Y+ + E+D++    +R    Y+   E   ++ + + ++RKPL+Y FNLI PC+++ TM LL F LPP++GE+I+L +T+LL+M +FL LVA+ LP+ S +I LLG ++  IM   ++S++ T  VLN HHR+     V   P  +  IV  WLA VL ++Q
Sbjct:   17 RPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ---------------ASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVLCVRQ 330          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO32053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW63])

HSP 1 Score: 232.646 bits (592), Expect = 1.372e-71
Identity = 123/350 (35.14%), Postives = 206/350 (58.86%), Query Frame = 2
Query:  227 EKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKF---DGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYV--LNGEFDI---VDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQ 1252
            E  LL+YL      DA     RP  N + PV++++   L Q+ID++E++QI+  N+W+   WKD+  +WNP  +GGI    I  DRVWKPD+LL+N  D +F   +    TNV+V +     W+ P + KS C ID+ +FPFD Q+C + FGSWT+ G  ID+ L+       +++G+ TE    N E ++   +G  D+   + CP          E Y  +  TI ++R+ ++Y+FN+++P  +I+ ++L  F LPP++GE++S  +T+LL+M+++L++V + +P+++  I L+  +F   M   +LS+  T +V+ +       KP+  +IK +VN WLA  L MK+
Sbjct:    1 EPALLKYLLQNYSKDA-----RPVLNVNDPVQLKLGIMLRQVIDLNERDQILTINVWIRQYWKDHLLKWNPDDFGGIKSINIAPDRVWKPDVLLYNRTDLRFGSLNNKIDTNVIVNHDGSTTWLAPAIIKSECKIDVRFFPFDVQSCELTFGSWTHDGLKIDIHLK-------QESGIDTENFSDNREWFLKGTSGRRDVKMYICCP----------EPYPTVTYTIILRRRAMFYVFNMVLPTGVIALLSLFSFYLPPNSGERVSFVITVLLAMSVYLIMVTENIPRSTD-IPLVSKFFMASMIQIALSLAATCVVIRFDTTK---KPMSSVIKLVVNDWLATALLMKK 324          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000038695.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 375.17 bits (962), Expect = 1.911e-123
Identity = 202/509 (39.69%), Postives = 297/509 (58.35%), Query Frame = 2
Query:  212 HCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            H G N+++L   L        +N LERP  NDSQ + V     L Q++DVDEKNQ++ TNIWL L W D++ QWN S Y G++  + P   +WKPD+LL+NSAD++FD T+ TN++V +S    ++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V+ P  R +  Y   +E Y++I  T+ M+R+ LYY  NL++PCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YHH   +   +P   + I+  W A  L MK+  E  +R+    K    S      + +N     S +  N    +  V  +ES     G     +     ++   ++  G +  + P +  ++    N   EL  ILDE++ I ++ +D +++ ++  EWKFAA V+DR CL  FSLF I+ T  +L  AP
Sbjct:   45 HQGPNQRRLYSDLMS-----TYNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLEAD-----------------VSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNKTRRSS---LTSMDLNAPTSTS-LSTNGNLLYVGVRGLESLQYSPGATSPDSGVVCGRL---ITRAGEDEMLLPSSHASSLG--NMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAP 522          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000046008.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 374.4 bits (960), Expect = 3.438e-123
Identity = 202/509 (39.69%), Postives = 297/509 (58.35%), Query Frame = 2
Query:  212 HCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            H G N+++L   L        +N LERP  NDSQ + V     L Q++DVDEKNQ++ TNIWL L W D++ QWN S Y G++  + P   +WKPD+LL+NSAD++FD T+ TN++V +S    ++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V+ P  R +  Y   +E Y++I  T+ M+R+ LYY  NL++PCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YHH   +   +P   + I+  W A  L MK+  E  +R+    K    S      + +N     S +  N    +  V  +ES     G     +     ++   ++  G +  + P +  ++    N   EL  ILDE++ I ++ +D +++ ++  EWKFAA V+DR CL  FSLF I+ T  +L  AP
Sbjct:   42 HQGPNQRRLYSDLMS-----TYNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLEAD-----------------VSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNKTRRSS---LTSMDLNAPTSTS-LSTNGNLLYVGVRGLESLQYSPGATSPDSGVVCGRL---ITRAGEDEMLLPSSHASSLG--NMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAP 519          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000033785.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 371.703 bits (953), Expect = 7.585e-123
Identity = 197/489 (40.29%), Postives = 289/489 (59.10%), Query Frame = 2
Query:  272 AHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
             +N LERP  NDSQ + V     L Q++DVDEKNQ++ TNIWL L W D++ QWN S Y G++  + P   +WKPD+LL+NSAD++FD T+ TN++V +S    ++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D                 +  Y+ NGE+D+V+ P  R +  Y   +E Y++I  T+ M+R+ LYY  NL++PCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YHH   +   +P   + I+  W A  L MK+  E  +R+    K    S      + +N     S +  N    +  V  +ES     G     +     ++   ++  G +  + P +  ++    N   EL  ILDE++ I ++ +D +++ ++  EWKFAA V+DR CL  FSLF I+ T  +L  AP
Sbjct:    3 TYNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLEAD-----------------VSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDNKTRRSS---LTSMDLNAPTSTS-LSTNGNLLYVGVRGLESLQYSPGATSPDSGVVCGRL---ITRAGEDEMLLPSSHASSLG--NMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAP 465          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000023459.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101168927])

HSP 1 Score: 357.066 bits (915), Expect = 4.856e-117
Identity = 200/517 (38.68%), Postives = 295/517 (57.06%), Query Frame = 2
Query:  218 GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCN----------SRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G+++++L + L     P     LERP  NDS  + V     L Q++DVDEKNQ++ TNIWL L WKD++ QWN S Y G++  + P  ++W+PD+LL+NSAD++FD ++ TN++V +S   Q++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D      TG            Y+ NGE+D+V+ P  R +  Y    E Y ++  T+ M+R+ LYY  N +IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YHH   +   +P   + ++  W A  L M++  E ++   L   +++G    + G   + E   +P+    +    HV                T+  L     Y+ F+G E  +   ++    P C              EL  IL+E++ I Q+ ++ + E     EWKFAA VIDR CL  FS+F I+ T  +L  AP
Sbjct:    7 GVHQRRLYKELIRNYNP-----LERPVSNDSHSLTVHFSFSLLQIMDVDEKNQVLTTNIWLQLYWKDFYLQWNMSDYPGVTNVRFPDSQIWRPDILLYNSADERFDASFHTNILVNSSGYCQYLPPGIFKSTCHIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMINAD-----TTG------------YIANGEWDLVEVPGQRSERFYDCCKEPYPDVTFTVVMRRRTLYYGLNFLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMAIVGLSVIATVLVLQYHHHDPDGGHMPQWTRVVLLNWCAWFLRMRRPGEAKV---LLACHNMGKR--QRGSLSSLELSINPVSVPPQ---PHV----------------TNSNL----LYVGFQGVEG-LHCGSATDPEPLCARFIEEDFLRVGEVELQQILEEVRFIGQRFRNQDQEKAACSEWKFAAAVIDRLCLVAFSVFTILCTIGILMSAP 472          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000023454.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101168927])

HSP 1 Score: 353.984 bits (907), Expect = 9.321e-116
Identity = 194/509 (38.11%), Postives = 296/509 (58.15%), Query Frame = 2
Query:  218 GINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQ--YSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFR-VHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRH-ELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            G+++++L + L     P     LERP  NDS  + V     L Q++DVDEKNQ++ TNIWL L WKD++ QWN S Y G++  + P  ++W+PD+LL+NSAD++FD ++ TN++V +S   Q++PPG+FKSTC ID+ WFPFD Q C +KFGSWTY G  +DL++   D      TG            Y+ NGE+D+V+ P  R +  Y    E Y ++  T+ M+R+ LYY  N +IPCVLIST+ALL F LP D+GEKISLG+T+LLS+T+F+LLVA+ +P TS ++ L+  YFA  M +  LS++ TVLVL YHH   +   +P   + ++  W A  L M++  E ++   L   +++G    + G   + E   +P+    +   ++   +   F+ V G+     +   P    ++           +  +    + ++   EL  IL+E++ I Q+ ++ + E     EWKFAA VIDR CL  FS+F I+ T  +L  AP
Sbjct:    2 GVHQRRLYKELIRNYNP-----LERPVSNDSHSLTVHFSFSLLQIMDVDEKNQVLTTNIWLQLYWKDFYLQWNMSDYPGVTNVRFPDSQIWRPDILLYNSADERFDASFHTNILVNSSGYCQYLPPGIFKSTCHIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMINAD-----TTG------------YIANGEWDLVEVPGQRSERFYDCCKEPYPDVTFTVVMRRRTLYYGLNFLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMAIVGLSVIATVLVLQYHHHDPDGGHMPQWTRVVLLNWCAWFLRMRRPGEAKV---LLACHNMGKR--QRGSLSSLELSINPVSVPPQPHVTNSNLLYVGFQGVEGLHCGSATDPEPLCARFIEEDFLRVGGGTRRRQGGVLNDSALEVELQQILEEVRFIGQRFRNQDQEKAACSEWKFAAAVIDRLCLVAFSVFTILCTIGILMSAP 483          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000068777.1 (SMESG000068777.1)

HSP 1 Score: 1140.56 bits (2949), Expect = 0.000e+0
Identity = 553/554 (99.82%), Postives = 554/554 (100.00%), Query Frame = 2
Query:   92 MIRVLKPLSIFIQLNMTESKIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKILA 1753
            MIRVLKPLSIFIQLNMTESKIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQN+EPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKILA
Sbjct:    1 MIRVLKPLSIFIQLNMTESKIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNSEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKILA 554          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000068777.1 (SMESG000068777.1)

HSP 1 Score: 1111.29 bits (2873), Expect = 0.000e+0
Identity = 538/539 (99.81%), Postives = 539/539 (100.00%), Query Frame = 2
Query:  137 MTESKIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKILA 1753
            MTESKIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQN+EPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKILA
Sbjct:    1 MTESKIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNSEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSEKILA 539          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000011827.1 (SMESG000011827.1)

HSP 1 Score: 466.077 bits (1198), Expect = 3.051e-159
Identity = 238/525 (45.33%), Postives = 347/525 (66.10%), Query Frame = 2
Query:  182 WLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQYSF---NNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLPKVPSYMSFKGAEN-----SIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            +++L  L+  HCG + K+LL YLF+ ++   HN LERP  +++Q +EV+ K  L Q++D+DEKNQ+++TNIWLD+ W DY+F+WNP  +G I+   +P+++VWKPD+L++NSAD+KFDGTYP NVVV N  LM  VPPGMFKSTC I+ITWFPFD Q+C +KFG+WTY+G  +D RL+C  D+ +  TG   +    + ES++ NGE++IVD P  +   ++       +++I   ++M+RK LYYIFNL+ PC++ISTM+LL FTLPP AGEKI++GVTI+LS+TMFL +VADKLPQTSG++ L+G+YF+CIM MCS S+VFTVLVLN HH+S   + +P  +K +VN WLA  L M   N P++ N   +K ++        +  N        +  +   + ++ + +SD   +     + S    +  S  +  GA+N      I P     +   C+   EL  ++ ELK+IT KI+++  +   + EWKFAARVIDR CL  F+LF +IS+  +LT AP
Sbjct:    5 FVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKC--DEGSNCTG---QYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMFLFMVADKLPQTSGSVPLIGLYFSCIMIMCSFSVVFTVLVLNCHHKSGEDEEMPYWLKVLVNRWLANFLLMSPRN-PQVTNSPTRKIEIQQ---RRSILPNMNHSFLTYENLAPKPYGNITNRKSDGSTNVTSTKRLSHIYTQNNSGKANIGAKNIYKNSYIKPMICNHSATKCSIFTELQDVIHELKQITDKIQEEHFDFKKSNEWKFAARVIDRFCLIGFALFTLISSVVILTSAP 520          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000002905.1 (SMESG000002905.1)

HSP 1 Score: 463.766 bits (1192), Expect = 3.114e-158
Identity = 243/513 (47.37%), Postives = 335/513 (65.30%), Query Frame = 2
Query:  170 FAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTET-SVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQKNDLGSEMIENGLSVNFEKC-RSPIDANSKFTFSHVFDVESDFRVHGIGKSKTSFRLP------KVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLT 1678
            +  F+ +L+   E   G  EKKLLR+LFD  R DAHNILERP+K+D + + V +  FL Q+IDVDEKNQI+HTN+W+DLKW DYHF W+P  Y  I+   IPA+R+W+PD+LL+NSAD++FD T+P N+VVK    M  VPPGMFKSTC I+I W+PFD+Q C +KFGSWTY G  IDL   C    DN  T  C +T    N E+ + NGE+D++     R   +Y    ETY++I   + ++R+ LYY FNLI+PC++ISTMALL F +PPDAGEKISLGVTILLS+T+FL++VA+K+P TS AI L+G+YF C+M +CSLS+VFTVLVLN+HHRS +   VP  + K+VN WLA++LFMK  N  ++ +E+F+  DL     +   +  + +  +S     SK   ++V D+E++  +        SF  P      +VP Y S    +N+      +   P    R ++  IL  L+++T K+ + E +   A EWKFAARV+DR CL 
Sbjct:    4 YCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFC----DNATT--CNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGVTILLSLTVFLMMVAEKMPPTSKAIPLIGMYFTCVMIVCSLSLVFTVLVLNFHHRSSDSIDVPESLHKVVNIWLARILFMKPRN--KVASEVFESGDLKQNTGQFKRNAIYNRAFQSGSMKGSKSLLANVLDMENE--IWARAAQSVSFSYPSANVNSEVPPYES----QNNNGGIMGEGLLPE--GRSQIKEILSHLRQVTSKLAETEIQELRANEWKFAARVMDRFCLV 500          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000028455.1 (SMESG000028455.1)

HSP 1 Score: 288.886 bits (738), Expect = 1.295e-89
Identity = 182/592 (30.74%), Postives = 302/592 (51.01%), Query Frame = 2
Query:  137 MTESKIFGFCNFAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILE----------RPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPI--NRLQYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVFTVLVLNYHHRSVNLKPVPPLIKKI----------------------------------VNTWLAKVLFMK-------QNNEPEIRNELFQKNDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFR-----VHGIGKSKTSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELI--AILDELKKITQKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAP 1732
            M    +F   N     L+LI     +     K L     D+N P+ H + +          RP +N S+PV  +M   LTQ+ D+DEKNQ++ TN+WLD +W D + QWN S +  IS  +IP++++WKPD++L+N+A D  D   P   +VKN   + W  P   KS+C ID+T+FPFDSQ CT+KFGSWTY G  ++L         ++  GV       +L+ YV NGE+ +    +  N + Y+   E Y ++   + ++R+ LY+I+++I PC+++ST+ LL F LPPD+GEKI+LG+T+LL+ ++ +L +A+KLP+TS ++ L+ IY   +M M S+S++ TV VLN HHR  N  P+P  ++++                                  +N+ L +    K       QN+     N+   +  LG+  + +  ++  +     + AN +  +  +F  ++D+R     +H    S +S     +   +    +  ++    S   +PSC++  + I   IL  L +I  K + DE    + +EW+  A+ +DR    ++      ST  VL  AP
Sbjct:    1 MVWKSVFRLANIYGLILVLI----VNRNTEGKSLSEVKNDENLPEEHRLFKKLMKDYEPSVRPVRNSSKPVIAKMGITLTQIFDMDEKNQVLVTNVWLDQQWYDEYLQWNTSEFPSISKLRIPSEKIWKPDIVLYNNAADFADKMMPALAMVKNDGEVFWPVPTKLKSSCKIDVTYFPFDSQICTLKFGSWTYDGFQVEL---------DKLKGV-------DLDMYVENGEWKLKKTKVLRNNIVYTCCPEPYYDVTFVLYLERRILYFIYHVIYPCIMMSTLTLLVFCLPPDSGEKIALGITVLLAFSVLMLSIAEKLPETSESVPLISIYLTTVMSMTSVSVIMTVFVLNLHHRGPNKSPIPKWMQRLMICKNRYFSCKGSLTKNRKIPFKGIKNIESLLMSINSKLKQFPVKKSKSFPSPQNHVENYLNKYPNEVGLGNIKLNSYPTMETDVLSGSVTANHE--YEPMFISDNDYRCTGNIIHSRSLSLSSSSRQCLSCNILINPSSPTVDKAVSTDAYPSCDNDQQEINTKILSALNRILVKHEIDESNYNLIQEWREVAQFVDRILFWLYLFSTSTSTIIVLIIAP 570          
The following BLAST results are available for this feature:
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA73.272e-11838.30cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.13.272e-11838.30cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA74.466e-11739.59cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC254952.16.250e-11737.92cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC254952.16.250e-11737.92cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-98.808e-11538.94AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-162.759e-11037.98Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-112.104e-10835.78AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-197.471e-9240.96AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-251.015e-9131.98AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha73.519e-14143.34gene:FBgn0086778 transcript:FBtr0301835[more]
nAChRalpha73.730e-14143.34gene:FBgn0086778 transcript:FBtr0301834[more]
nAChRalpha73.730e-14143.34gene:FBgn0086778 transcript:FBtr0343798[more]
nAChRalpha73.730e-14143.34gene:FBgn0086778 transcript:FBtr0074680[more]
nAChRalpha54.407e-14145.05gene:FBgn0028875 transcript:FBtr0300594[more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna71.980e-12141.14cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
chrna72.914e-12141.14cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
FO907089.12.548e-11439.14neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch73-380n15.23.040e-11239.19si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:ch73-380n15.26.077e-11239.57si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021532.15.707e-11739.69cholinergic receptor, nicotinic alpha 7 [Source:NC... [more]
clca22.108e-11039.06chloride channel accessory 2 [Source:Xenbase;Acc:X... [more]
mppe11.442e-8333.66metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.609e-8333.66metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.869e-8333.66metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna73.350e-11739.96cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna32.963e-8934.67cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna32.964e-8934.67cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna32.055e-8739.78cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna69.392e-8432.80cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22770|ACHA7_CHICK9.998e-11840.37Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|P36544|ACHA7_HUMAN1.571e-11738.30Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|Q866A2|ACHA7_MACMU1.790e-11637.92Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|P49582|ACHA7_MOUSE2.343e-11639.96Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
sp|Q05941|ACHA7_RAT3.527e-11639.80Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LM731.235e-15941.75Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A267EGF01.839e-15245.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DHA44.618e-15246.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V5H4U27.681e-14544.20Putative acetylcholine receptor OS=Ixodes ricinus ... [more]
G4VN552.361e-14453.47NAChR subunit (ShAR1-alpha-like) OS=Schistosoma ma... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053066.13.602e-11939.80neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSAMXT00000055784.17.584e-11940.36neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna72.781e-11539.47neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna74.821e-11537.62neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna74.342e-11439.55neuronal acetylcholine receptor subunit alpha-7-li... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008550.12.320e-9137.19pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrna33.689e-8733.74cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b7.608e-8139.63cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a6.113e-7039.94cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
ENSPMAT00000000149.14.231e-6242.74pep scaffold:Pmarinus_7.0:GL480219:31373:46583:1 g... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420541.366e-8541.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420381.098e-7831.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448962.001e-7431.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479694.849e-7236.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320531.372e-7135.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038695.11.911e-12339.69neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000046008.13.438e-12339.69neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000033785.17.585e-12340.29neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000023459.24.856e-11738.68neuronal acetylcholine receptor subunit alpha-7 [S... [more]
ENSORLT00000023454.29.321e-11638.11neuronal acetylcholine receptor subunit alpha-7 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068777.10.000e+099.82SMESG000068777.1[more]
SMESG000068777.10.000e+099.81SMESG000068777.1[more]
SMESG000011827.13.051e-15945.33SMESG000011827.1[more]
SMESG000002905.13.114e-15847.37SMESG000002905.1[more]
SMESG000028455.11.295e-8930.74SMESG000028455.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009442 ID=SMED30009442|Name=Acetylcholine receptor subunit alpha-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1760bp
GATCTTTCAATTGATTCATTCACACTGAACATTGATTATTCCTGCAGAGA
TAAAGTTGTCTTTTTAATGGAATTTTGCCCAATCAAATAAAATGATTAGA
GTACTCAAACCTCTTTCAATTTTCATCCAGCTCAACATGACAGAATCTAA
AATTTTTGGTTTTTGTAATTTCGCAGTTTTTTGGTTAATTCTCATATCAC
TTTCAGAATTCCATTGTGGAATAAATGAAAAAAAATTACTCCGTTATCTT
TTCGATCAAAACCGGCCAGACGCTCACAACATTTTAGAGCGCCCTTCCAA
AAATGACAGTCAACCAGTTGAAGTTCGAATGAAAGCCTTCTTAACTCAGC
TAATTGATGTGGATGAAAAAAATCAAATAATTCACACCAATATTTGGCTT
GACTTAAAATGGAAAGACTATCATTTTCAGTGGAACCCATCTGTATATGG
AGGTATATCTGGCTTCAAAATTCCTGCTGACAGAGTATGGAAGCCGGATT
TGTTATTATTTAATAGTGCTGATGATAAATTCGACGGAACATATCCGACA
AACGTGGTTGTAAAAAACAGTTCTCTTATGCAATGGGTTCCACCAGGAAT
GTTCAAGTCAACCTGTGATATCGATATAACATGGTTTCCTTTTGACTCAC
AGAATTGTACGGTAAAGTTCGGCAGTTGGACCTATTCCGGAAAATATATA
GACCTTAGGCTCCAGTGTCCAGATGACGATGACAACGAGAAAACCGGTGT
ATGTACCGAGACCAGTGTGATCAATCTAGAATCCTATGTGCTCAATGGAG
AATTCGATATTGTCGATTGCCCTATAAATCGGTTACAATACTCATTTAAC
AATGAAACATATATGAACATTTTAATGACAATACGAATGCAGAGGAAGCC
TCTATATTATATATTCAATTTGATTATTCCATGTGTTTTGATATCTACTA
TGGCTCTTTTGGAATTCACACTGCCTCCAGATGCCGGGGAGAAAATTTCT
TTAGGTGTGACAATATTATTATCAATGACTATGTTTCTGTTGTTGGTAGC
CGACAAATTGCCCCAAACGTCAGGTGCCATTTCTTTATTAGGTATTTATT
TTGCGTGTATAATGTTTATGTGTTCCCTATCAATTGTCTTCACGGTCCTT
GTGCTTAATTATCACCATAGGTCGGTGAATCTCAAGCCAGTTCCACCTTT
AATTAAGAAAATAGTGAATACCTGGTTGGCAAAAGTGCTTTTCATGAAAC
AGAACAATGAGCCCGAGATCAGAAATGAATTATTTCAAAAAAATGACTTG
GGCAGTGAAATGATCGAAAATGGCCTCTCAGTAAACTTTGAAAAATGTAG
AAGTCCGATTGATGCAAATTCCAAATTCACATTCTCTCATGTATTCGATG
TAGAAAGTGATTTTCGAGTACATGGGATCGGCAAATCAAAGACCTCTTTC
AGACTTCCCAAAGTTCCATCTTATATGAGTTTTAAAGGCGCAGAAAATTC
AATTCCGCCTAAAACTAGCAAAGCTACTTGGCCTTCATGTAACTCAAGAC
ATGAATTAATAGCTATTCTGGATGAATTGAAGAAGATTACCCAGAAAATA
AAGGATGATGAAGATGAAATAACGATGGCGAAAGAATGGAAATTTGCGGC
AAGAGTGATTGACCGATGTTGTTTGACAGTTTTCAGTTTGTTTATTATTA
TTTCAACTTTTGCCGTTCTTACAAGGGCCCCTAAATCTGAAAAGATTTTA
GCGTAGTGAC
back to top

protein sequence of SMED30009442-orf-1

>SMED30009442-orf-1 ID=SMED30009442-orf-1|Name=SMED30009442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=555bp
MIRVLKPLSIFIQLNMTESKIFGFCNFAVFWLILISLSEFHCGINEKKLL
RYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTN
IWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGT
YPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSG
KYIDLRLQCPDDDDNEKTGVCTETSVINLESYVLNGEFDIVDCPINRLQY
SFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGE
KISLGVTILLSMTMFLLLVADKLPQTSGAISLLGIYFACIMFMCSLSIVF
TVLVLNYHHRSVNLKPVPPLIKKIVNTWLAKVLFMKQNNEPEIRNELFQK
NDLGSEMIENGLSVNFEKCRSPIDANSKFTFSHVFDVESDFRVHGIGKSK
TSFRLPKVPSYMSFKGAENSIPPKTSKATWPSCNSRHELIAILDELKKIT
QKIKDDEDEITMAKEWKFAARVIDRCCLTVFSLFIIISTFAVLTRAPKSE
KILA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0045211postsynaptic membrane
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 489..509
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 480..552
e-value: 1.3E-8
score: 36.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 269..387
e-value: 2.8E-42
score: 146.0
NoneNo IPR availablePANTHERPTHR18945:SF825NICOTINIC ACETYLCHOLINE RECEPTOR ALPHA5, ISOFORM Bcoord: 24..549
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 271..360
e-value: 1.35265E-43
score: 148.665
NoneNo IPR availableCDDcd18997LGIC_ECD_nAChRcoord: 76..269
e-value: 8.31865E-84
score: 256.648
NoneNo IPR availableTMHMMTMhelixcoord: 302..319
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 271..290
NoneNo IPR availableTMHMMTMhelixcoord: 522..544
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 264..276
score: 34.08
coord: 98..114
score: 29.84
coord: 131..142
score: 43.02
coord: 175..189
score: 53.03
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 24..544
e-value: 1.8E-101
score: 338.1
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 24..549
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 155..173
score: 36.78
coord: 137..149
score: 38.72
coord: 119..133
score: 37.11
coord: 85..101
score: 53.4
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 277..541
e-value: 2.9E-48
score: 165.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 44..268
e-value: 3.3E-66
score: 224.6
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 45..270
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 47..270
e-value: 7.3E-61
score: 205.4
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 175..189
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 270..547