Dicer-like protein 1

Overview
NameDicer-like protein 1
Smed IDSMED30009440
Length (bp)2586
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dicer-like protein 1 (SMED30009440) t-SNE clustered cells

Violin plots show distribution of expression levels for Dicer-like protein 1 (SMED30009440) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dicer-like protein 1 (SMED30009440) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dicer-like protein 1 (SMED30009440) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009440

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30009440h1SMcG0020884 dd_Smed_v4_5587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009440h1SMcG0020884 dd_Smed_v4_5587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 99.3673 bits (246), Expect = 9.804e-21
Identity = 143/563 (25.40%), Postives = 243/563 (43.16%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLM---LKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQI-YWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS-GEL-DFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTS-----LTNMESRI---VSYGESE-------------KDLRKL-MTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKS----ILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLE-KEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALD-FIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTID 2482
             +PR YQLE+   A  GK+ +I  PTG GKTF++ ++    LK   +    +V F  +++ +  QQ   F   FE           +   R   +     E +  +    + ++D+II T     N L K  I   + F+L++ DE H+  K+HPYN ++F Y    Q++  +   L  V                        IGLTAS   G+  + D+  + +  L  SL    I TV  N++EL +           +ESRI     Y  ++             KDL  L    N  F  +K+E+ +  +    ++       + + +        L +    ++K     I++    + D ++ + +    +    FDEI   ++ T  ++  +   +++S++        EN  +  +  I++E   L  E  TIL  V+ R      KN +E   KL+F    I+   G+G  +++ GM++  QK  LD F       I+IATSV DEGID+ QC+LVI      +V  ++Q RGR R + S+  +L  +   I+
Sbjct:   38 FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFE-----------RHGYRVTGISGATAENVPVEQ--IVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNY--LDQKLGGSSGPLPQV------------------------IGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMV-----FQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEI--EQDLTQRFEEKLQELESVSRD-----PSNENPKLEDLCFILQEEYHLNPETITIL-FVKTRALVDALKNWIEGNPKLSFLKPGIL--TGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIE 546          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 98.9821 bits (245), Expect = 1.723e-20
Identity = 143/563 (25.40%), Postives = 243/563 (43.16%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLM---LKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQI-YWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS-GEL-DFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTS-----LTNMESRI---VSYGESE-------------KDLRKL-MTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKS----ILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLE-KEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALD-FIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTID 2482
             +PR YQLE+   A  GK+ +I  PTG GKTF++ ++    LK   +    +V F  +++ +  QQ   F   FE           +   R   +     E +  +    + ++D+II T     N L K  I   + F+L++ DE H+  K+HPYN ++F Y    Q++  +   L  V                        IGLTAS   G+  + D+  + +  L  SL    I TV  N++EL +           +ESRI     Y  ++             KDL  L    N  F  +K+E+ +  +    ++       + + +        L +    ++K     I++    + D ++ + +    +    FDEI   ++ T  ++  +   +++S++        EN  +  +  I++E   L  E  TIL  V+ R      KN +E   KL+F    I+   G+G  +++ GM++  QK  LD F       I+IATSV DEGID+ QC+LVI      +V  ++Q RGR R + S+  +L  +   I+
Sbjct:  241 FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFE-----------RHGYRVTGISGATAENVPVEQ--IVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNY--LDQKLGGSSGPLPQV------------------------IGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMV-----FQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEI--EQDLTQRFEEKLQELESVSRD-----PSNENPKLEDLCFILQEEYHLNPETITIL-FVKTRALVDALKNWIEGNPKLSFLKPGIL--TGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIE 749          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: IFIH1 (interferon induced with helicase C domain 1 [Source:HGNC Symbol;Acc:HGNC:18873])

HSP 1 Score: 76.2554 bits (186), Expect = 1.975e-13
Identity = 89/305 (29.18%), Postives = 142/305 (46.56%), Query Frame = 2
Query:  764 HRNNQDSHDKGKMHRDNLFKSKTEDIISQTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS----IRDHDVIIATADFFKN-ILNKQQ-----IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASP--SGELDFDKTYELLKALLHSLGDVGIVTVTENIDEL 1627
            H +N  S D G M  D    S  E++ ++   + EL            + R YQ+E+ + A  GK+ +I LPTG+GKT +A  +    L++    +   +V  LV+KVLLV Q    F+ +F+             + +  ++I L+    D+  K S    ++  D+II+TA   +N +LN +      +  +DFSL+++DE HH  KE  YN ++  Y +  Q++   KN  L   +                I   +I+GLTASP   G     K  E +  L  +L    I TV EN+D+L
Sbjct:  276 HNSNMGS-DSGTMGSD----SDEENVAARASPEPEL------------QLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQL---FRKEFQPF-----------LKKWYRVIGLSG---DTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLM--QKL---KNNRLKKENKPV-------------IPLPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQL 528          

HSP 2 Score: 55.0694 bits (131), Expect = 6.199e-7
Identity = 29/80 (36.25%), Postives = 48/80 (60.00%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTIDILHE 2494
            M+  EQK+ +   R  K  ++IAT+V +EG+D+ +C++VI     T+  A+VQ RGRAR  +S  +++      + I HE
Sbjct:  766 MTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV-IEHE 844          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DHX58 (DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:29517])

HSP 1 Score: 68.1662 bits (165), Expect = 1.106e-12
Identity = 53/164 (32.32%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEI-IDSDHKCSIRDHDVIIATADFFKNILN----KQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            +E R YQ E+   A  GK+ +I+LPTG GKT  AA +  + LE     +V  LV++V LV Q  + F+         R      TVT      +L+ ++   +      R HD++I TA+  +  L     ++ +  T FSL+V+DE HH  K+  YN ++ +Y
Sbjct:    1 MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFR---------RMLDGRWTVT------TLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQY 149          
BLAST of Dicer-like protein 1 vs. Ensembl Human
Match: DHX58 (DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:29517])

HSP 1 Score: 70.4774 bits (171), Expect = 2.357e-12
Identity = 53/164 (32.32%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEI-IDSDHKCSIRDHDVIIATADFFKNILN----KQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            +E R YQ E+   A  GK+ +I+LPTG GKT  AA +  + LE     +V  LV++V LV Q  + F+         R      TVT      +L+ ++   +      R HD++I TA+  +  L     ++ +  T FSL+V+DE HH  K+  YN ++ +Y
Sbjct:    1 MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFR---------RMLDGRWTVT------TLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQY 149          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: drh-3 (Dicer Related Helicase [Source:UniProtKB/TrEMBL;Acc:Q93413])

HSP 1 Score: 119.783 bits (299), Expect = 2.960e-27
Identity = 148/568 (26.06%), Postives = 252/568 (44.37%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFH----RVAFLVDKVLLVMQQSKSF----KGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDK--------TYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLK-----------SQLSGLLVDVREIQ-------------KSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSIINEIVKECKS-------LQDENRTILVLVEERRDAREYKNSLEKEKLNFEF----QLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVN-PPTSVQALVQIRGRARKKDSRLLML 2458
            R YQ E+ + A  GK+CVI  PTG+GKT +A    LK +EE        RV  LV K+ LV QQ   F     G +E   +  F   E +V+   +     +E+I +    S+    ++I   +  +++   +++Y +DFS+++ DE H   K HPY             VL+N+                   ++EWK  + +IIGLTAS S ++D  K         Y +L AL+++   +  +T   +IDELNE     + +S  +     E  LR  +         KF   +  +        + ++    IN  K           S L G++ ++ ++                +      +VD++ A+  + +   +K   ++ E+ +ETV Y   I +  T+ +  Q         S+  EIV   K+       +  E+R +++ V +R  A+   + L + K+  +F    + +VG+     K      +  EQ+  LD     + ++I+ATSVV+EG+D+  C+L+I  N    S   LVQ RGRAR K+SR ++L
Sbjct:  372 RTYQEELVQPALEGKNCVIVAPTGSGKTEVAIYAALKHIEERTSQGKPSRVVLLVPKIPLVGQQKDRFLKYCNGMYE---VNGFHGSESSVSGTGR----RDEVIAT--HVSVMTPQILI---NMLQSVRQNERLYVSDFSMMIFDEVHKAAKNHPY-------------VLINQ------------------MVQEWKYEKPQIIGLTASLSVKVDGQKDENQMLNDIYNML-ALINA-PHLSTITRQSSIDELNEHVGKPD-DSVELCLPAKENILRDYIERYLNHAHGKFLEELASMSKS--TGRNNTIPPNMINTFKKNQPKNYEYYDSLLQGIIQELNKLNVPEKWNSQTWAKYMKVYLEARGIVDLMPAM--VAFKYMEKAIGKLNESHSETVEYSTFIKDHDTLKQTIQ---------SVEPEIVLRLKNTLTNQFHVAPESR-VIIFVTQRSTAQRVSDFLNESKVLDQFGNYGEQMVGYVLGTNKQGAVQQTSQEQQLTLDKFNNGRLKVIVATSVVEEGLDVTACNLIIKYNCSSGSAIQLVQQRGRARAKNSRSVLL 879          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: dcr-1 (Endoribonuclease dcr-1 Death-promoting deoxyribonuclease [Source:UniProtKB/Swiss-Prot;Acc:P34529])

HSP 1 Score: 68.1662 bits (165), Expect = 2.902e-11
Identity = 50/174 (28.74%), Postives = 83/174 (47.70%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLM------LKMLEENPFHRVAFLVDKVLLVMQQS------KSFK-GQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS--IRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCV-KEHPYNKLLFEYHL 1384
            PR YQ+E+ +KA  K+ ++ L TG+GKTFIA +L+      L    +    R  F+V+KV LV QQ+       SFK GQ                         ++ + DS  +C   ++ H V++ TA    +++    +   D  +++ DE HH +  +HPY  ++ +Y L
Sbjct:   13 PRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHG--------------------QTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKL 166          

HSP 2 Score: 53.5286 bits (127), Expect = 8.175e-7
Identity = 23/54 (42.59%), Postives = 39/54 (72.22%), Query Frame = 2
Query: 2315 IIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKT 2476
            +IATSV++EG+D+ QC+LVI  + P  +++ VQ +GRAR+  SR ++   ++ T
Sbjct:  457 LIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKDT 510          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: dcr-1 (Endoribonuclease dcr-1 Death-promoting deoxyribonuclease [Source:UniProtKB/Swiss-Prot;Acc:P34529])

HSP 1 Score: 68.1662 bits (165), Expect = 2.902e-11
Identity = 50/174 (28.74%), Postives = 83/174 (47.70%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLM------LKMLEENPFHRVAFLVDKVLLVMQQS------KSFK-GQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS--IRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCV-KEHPYNKLLFEYHL 1384
            PR YQ+E+ +KA  K+ ++ L TG+GKTFIA +L+      L    +    R  F+V+KV LV QQ+       SFK GQ                         ++ + DS  +C   ++ H V++ TA    +++    +   D  +++ DE HH +  +HPY  ++ +Y L
Sbjct:   13 PRDYQVELLDKATKKNTIVQLGTGSGKTFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHG--------------------QTSSGLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMVDYKL 166          

HSP 2 Score: 53.5286 bits (127), Expect = 8.175e-7
Identity = 23/54 (42.59%), Postives = 39/54 (72.22%), Query Frame = 2
Query: 2315 IIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKT 2476
            +IATSV++EG+D+ QC+LVI  + P  +++ VQ +GRAR+  SR ++   ++ T
Sbjct:  457 LIATSVLEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVEEKDT 510          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: drh-1 (Dicer Related Helicase [Source:UniProtKB/TrEMBL;Acc:V6CIX1])

HSP 1 Score: 63.5438 bits (153), Expect = 5.019e-10
Identity = 43/173 (24.86%), Postives = 78/173 (45.09%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLE----ENPFHRVAFLVDKVLLVMQQSKSFKGQFEDIC-LERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQ-----------QIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYH 1381
            R YQ E+ + A  GK+ ++  PTG+GKT IAA ++ +  E    E    +  F+    +++ QQ+ S     + +   +  +  +   TR +                 I+  D+I+AT     N+ N+            Q + + F+++  DE H+ VK  PY+ ++ EYH
Sbjct:   36 RNYQEELCQVALQGKNTIVTAPTGSGKTVIAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYLDHVYHTQIIQGSDNVPTRNV-----------------IQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQFFLSTFTIIFFDECHNTVKNSPYSNIMREYH 191          

HSP 2 Score: 50.447 bits (119), Expect = 6.083e-6
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query: 2267 EQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC-----RDQKT 2476
            +Q + L    + + +I+++TSV +EG+D+P+C LVI  N  T+  A VQ RGR R  +S  +++      RDQ++
Sbjct:  496 KQMEKLKMFADGEIRILVSTSVAEEGLDVPECSLVIKYNYATNEIAHVQRRGRGRALNSECVLITNSIALRDQES 570          
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Match: drh-1 (Dicer Related Helicase [Source:UniProtKB/TrEMBL;Acc:V6CIX1])

HSP 1 Score: 62.3882 bits (150), Expect = 1.211e-9
Identity = 43/173 (24.86%), Postives = 78/173 (45.09%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLE----ENPFHRVAFLVDKVLLVMQQSKSFKGQFEDIC-LERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQ-----------QIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYH 1381
            R YQ E+ + A  GK+ ++  PTG+GKT IAA ++ +  E    E    +  F+    +++ QQ+ S     + +   +  +  +   TR +                 I+  D+I+AT     N+ N+            Q + + F+++  DE H+ VK  PY+ ++ EYH
Sbjct:  294 RNYQEELCQVALQGKNTIVTAPTGSGKTVIAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYLDHVYHTQIIQGSDNVPTRNV-----------------IQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQFFLSTFTIIFFDECHNTVKNSPYSNIMREYH 449          

HSP 2 Score: 50.447 bits (119), Expect = 5.942e-6
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 2
Query: 2267 EQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC-----RDQKT 2476
            +Q + L    + + +I+++TSV +EG+D+P+C LVI  N  T+  A VQ RGR R  +S  +++      RDQ++
Sbjct:  754 KQMEKLKMFADGEIRILVSTSVAEEGLDVPECSLVIKYNYATNEIAHVQRRGRGRALNSECVLITNSIALRDQES 828          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: Dcr-2 (gene:FBgn0034246 transcript:FBtr0086904)

HSP 1 Score: 62.7734 bits (151), Expect = 1.523e-9
Identity = 42/169 (24.85%), Postives = 83/169 (49.11%), Query Frame = 2
Query:  899 LKLEPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLE------ENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLE---RFESQEKTV---TRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLL 1369
            ++++PR YQL + +     + +++LPTG+GKTF+A +++ +  +      E+   R  F+ + V L  QQ+ + +      C      F   E+ V   TR +           SD    I+ + V++ TA  F +++ +  +  +  S+V++DE HH    HP+ + +
Sbjct:    4 VEIKPRGYQLRLVDHLTKSNGIVYLPTGSGKTFVAILVLKRFSQDFDKPIESGGKRALFMCNTVELARQQAMAVRR-----CTNFKVGFYVGEQGVDDWTRGMW----------SD---EIKKNQVLVGTAQVFLDMVTQTYVALSSLSVVIIDECHHGTGHHPFREFM 154          

HSP 2 Score: 50.8322 bits (120), Expect = 6.887e-6
Identity = 24/78 (30.77%), Postives = 47/78 (60.26%), Query Frame = 2
Query: 2270 QKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRD---QKTIDILHE 2494
            QK A+   R+  + ++I +SV++EGID+  C+ V  ++P  +    VQ +GRAR  +++ ++   D   +KTI  +++
Sbjct:  443 QKSAIQQFRDGNANLMICSSVLEEGIDVQACNHVFILDPVKTFNMYVQSKGRARTTEAKFVLFTADKEREKTIQQIYQ 520          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: Dcr-2 (gene:FBgn0034246 transcript:FBtr0340217)

HSP 1 Score: 62.7734 bits (151), Expect = 1.576e-9
Identity = 42/169 (24.85%), Postives = 83/169 (49.11%), Query Frame = 2
Query:  899 LKLEPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLE------ENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLE---RFESQEKTV---TRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLL 1369
            ++++PR YQL + +     + +++LPTG+GKTF+A +++ +  +      E+   R  F+ + V L  QQ+ + +      C      F   E+ V   TR +           SD    I+ + V++ TA  F +++ +  +  +  S+V++DE HH    HP+ + +
Sbjct:    4 VEIKPRGYQLRLVDHLTKSNGIVYLPTGSGKTFVAILVLKRFSQDFDKPIESGGKRALFMCNTVELARQQAMAVRR-----CTNFKVGFYVGEQGVDDWTRGMW----------SD---EIKKNQVLVGTAQVFLDMVTQTYVALSSLSVVIIDECHHGTGHHPFREFM 154          

HSP 2 Score: 50.8322 bits (120), Expect = 6.886e-6
Identity = 24/78 (30.77%), Postives = 47/78 (60.26%), Query Frame = 2
Query: 2270 QKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRD---QKTIDILHE 2494
            QK A+   R+  + ++I +SV++EGID+  C+ V  ++P  +    VQ +GRAR  +++ ++   D   +KTI  +++
Sbjct:  443 QKSAIQQFRDGNANLMICSSVLEEGIDVQACNHVFILDPVKTFNMYVQSKGRARTTEAKFVLFTADKEREKTIQQIYQ 520          
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Match: Dcr-1 (gene:FBgn0039016 transcript:FBtr0084324)

HSP 1 Score: 57.3806 bits (137), Expect = 7.220e-8
Identity = 24/54 (44.44%), Postives = 39/54 (72.22%), Query Frame = 2
Query: 2270 QKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRAR 2431
            Q++ L   R     ++I TSV++EGID+P+C+LV+  +PPT+ ++ VQ +GRAR
Sbjct:  551 QEEVLKRFRMHDCNVLIGTSVLEEGIDVPKCNLVVRWDPPTTYRSYVQCKGRAR 604          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: dhx58 (DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZFIN;Acc:ZDB-GENE-120612-3])

HSP 1 Score: 107.071 bits (266), Expect = 1.265e-23
Identity = 140/536 (26.12%), Postives = 227/536 (42.35%), Query Frame = 2
Query:  899 LKLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS-IRDHDVIIATADFFKNILNK----QQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASP--SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKD-----LRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIE-EINNLKSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIF---NFKTISKEFQLLHQEQ--ENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQL--IVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDS 2443
            ++L  R YQ E+ + A  G++ +I+LPTG GKT  A  +  K LE     +VA LV+KV LV Q      G +              +  K ++ +++ +  + D     +R  D++I TA   +N LN     + +  TDF+L+V+DE HH  KE  YNK+++ Y                             +    + R  +I+GLTASP   G    DK  E +  +  +L D  IV+       L  F      E  IV     +KD     L+ +M     F+     R +  +G           T E E + ++ + +G+ V+ R I +  L H+    D +   D I    A +  +E   + +  +    +IF    F   S E + L  +   EN  +     +  +  QD N   ++  + RR      + +   K N E Q   I      GA +    M+  EQK  +   R+    ++I+TSV +EG+D+P+C+LV+     T+  A  Q  GRAR  +S
Sbjct:    1 MELRLRPYQEEVVQAALRGENSIIWLPTGGGKTRAAVYVAEKHLETKANAKVAVLVNKVHLVDQHYMKEFGHY--------------LRHKYRIKAISGDSSEKDFFGRLVRVSDLVICTAQILENALNNMDEDKHVEITDFTLLVIDECHHTNKESVYNKIMWRY---------------------------VEKKVRKEGRLPQILGLTASPGTGGNKSLDKAVEHVLQICANL-DSKIVSTKNYTPMLQNFVPKPKKEYDIVE--RRDKDPFGDHLKSMMLMIHEFMPPTVSRGLRELG-----------TQEYEADVVELEKAGVKVNNRLIAQCAL-HLRKYNDALLINDTIRMVDAFRVLEEFYNSRSSKLLDGTDIFLQGLFDENSLELKHLASDARYENPKLAQLQSRLLEEFQDTNSRGIIFSKTRRGTHCLNDWV---KTNRELQRVNITAGILTGAGNGANNMTQTEQKSVISHFRQGYLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARASNS 477          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: dhx58 (DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZFIN;Acc:ZDB-GENE-120612-3])

HSP 1 Score: 107.071 bits (266), Expect = 2.023e-23
Identity = 136/533 (25.52%), Postives = 224/533 (42.03%), Query Frame = 2
Query:  899 LKLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS-IRDHDVIIATADFFKNILNK----QQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASP--SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEK---DLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIF---NFKTISKEFQLLHQEQ--ENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQL--IVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDS 2443
            ++L  R YQ E+ + A  G++ +I+LPTG GKT  A  +  K LE     +VA LV+KV LV Q      G +              +  K ++ +++ +  + D     +R  D++I TA   +N LN     + +  TDF+L+V+DE HH  KE  YNK+++ Y                             +    + R  +I+GLTASP   G    DK  E +  +  +L D  IV+       L  F      E  IV   + +     L+ +M     F+     R +  +G              E + ++ + +G+ V+ R I +  L H+    D +   D I    A +  +E   + +  +    +IF    F   S E + L  +   EN  +     +  +  QD N   ++  + RR      + +   K N E Q   I      GA +    M+  EQK  +   R+    ++I+TSV +EG+D+P+C+LV+     T+  A  Q  GRAR  +S
Sbjct:    1 MELRLRPYQEEVVQAALRGENSIIWLPTGGGKTRAAVYVAEKHLETKANAKVAVLVNKVHLVDQHYMKEFGHY--------------LRHKYRIKAISGDSSEKDFFGRLVRVSDLVICTAQILENALNNMDEDKHVEITDFTLLVIDECHHTNKESVYNKIMWRY---------------------------VEKKVRKEGRLPQILGLTASPGTGGNKSLDKAVEHVLQICANL-DSKIVSTKNYTPMLQNFVPKPKKEYDIVERRDKDPFGDHLKSMMLMIHEFMPPTVSRGLRELGTQEY----------EADVVELEKAGVKVNNRLIAQCAL-HLRKYNDALLINDTIRMVDAFRVLEEFYNSRSSKLLDGTDIFLQGLFDENSLELKHLASDARYENPKLAQLQSRLLEEFQDTNSRGIIFSKTRRGTHCLNDWV---KTNRELQRVNITAGILTGAGNGANNMTQTEQKSVISHFRQGYLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARASNS 477          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:ZFIN;Acc:ZDB-GENE-081104-438])

HSP 1 Score: 67.3958 bits (163), Expect = 5.670e-11
Identity = 67/215 (31.16%), Postives = 103/215 (47.91%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ------IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS 1525
            R YQ+E+   A   K+ ++ LPTG+GKT +A  +  + LE         +V  LV+KV LV Q    +K +F      RF   + +V R    +S A+++  S  +  I  +D+II TA   +N L K +      I  + F+L+V+DE HH  K   YN ++  Y    Q+   N+N+LL   D                +   +I+GLTASP 
Sbjct:  298 RDYQMEVARPALEEKNIIVCLPTGSGKTRVAVFITKEHLERKQRMGQKGKVVVLVNKVPLVEQH---YKAEFG-----RFLKHQYSVER----VSGASQLKISFPQI-IEKNDIIICTAQILENSLAKAKNGDEDGIELSQFTLMVIDECHHTKKGGVYNHIMIRY--LKQK---NRNQLLKKQDKTL-------------VPIPQILGLTASPG 481          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:ZFIN;Acc:ZDB-GENE-081104-438])

HSP 1 Score: 66.6254 bits (161), Expect = 1.211e-10
Identity = 67/215 (31.16%), Postives = 103/215 (47.91%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ------IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS 1525
            R YQ+E+   A   K+ ++ LPTG+GKT +A  +  + LE         +V  LV+KV LV Q    +K +F      RF   + +V R    +S A+++  S  +  I  +D+II TA   +N L K +      I  + F+L+V+DE HH  K   YN ++  Y    Q+   N+N+LL   D                +   +I+GLTASP 
Sbjct:  298 RDYQMEVARPALEEKNIIVCLPTGSGKTRVAVFITKEHLERKQRMGQKGKVVVLVNKVPLVEQH---YKAEFG-----RFLKHQYSVER----VSGASQLKISFPQI-IEKNDIIICTAQILENSLAKAKNGDEDGIELSQFTLMVIDECHHTKKGGVYNHIMIRY--LKQK---NRNQLLKKQDKTL-------------VPIPQILGLTASPG 481          

HSP 2 Score: 53.1434 bits (126), Expect = 1.691e-6
Identity = 25/69 (36.23%), Postives = 42/69 (60.87%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC 2461
            M+  EQK  L   R  +  ++IAT+V +EG+D+ +C++VI     T+  A++Q RGR R +DS   ++ 
Sbjct:  729 MTAAEQKDVLKRFRTGEINLLIATTVAEEGLDIAECNVVIRYCLVTNEVAMIQARGRGRAEDSSYTLVA 797          
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:ZFIN;Acc:ZDB-GENE-081104-438])

HSP 1 Score: 65.855 bits (159), Expect = 1.534e-10
Identity = 68/215 (31.63%), Postives = 102/215 (47.44%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ------IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS 1525
            R YQ+E+   A   K+ ++ LPTG+GKT +A  +  + LE         +V  LV+KV LV Q  K+  G        RF   + +V R    +S A+++  S  +  I  +D+II TA   +N L K +      I  + F+L+V+DE HH  K   YN ++  Y    Q+   N+N+LL   D    P               +I+GLTASP 
Sbjct:    5 RDYQMEVARPALEEKNIIVCLPTGSGKTRVAVFITKEHLERKQRMGQKGKVVVLVNKVPLVEQHYKAEFG--------RFLKHQYSVER----VSGASQLKISFPQI-IEKNDIIICTAQILENSLAKAKNGDEDGIELSQFTLMVIDECHHTKKGGVYNHIMIRY--LKQK---NRNQLLKKQDKTLVPIP-------------QILGLTASPG 188          

HSP 2 Score: 53.1434 bits (126), Expect = 1.294e-6
Identity = 25/69 (36.23%), Postives = 42/69 (60.87%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC 2461
            M+  EQK  L   R  +  ++IAT+V +EG+D+ +C++VI     T+  A++Q RGR R +DS   ++ 
Sbjct:  436 MTAAEQKDVLKRFRTGEINLLIATTVAEEGLDIAECNVVIRYCLVTNEVAMIQARGRGRAEDSSYTLVA 504          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 117.087 bits (292), Expect = 2.150e-26
Identity = 148/572 (25.87%), Postives = 262/572 (45.80%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKC----SIRDHDVIIATADFFKNILN----KQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSG--ELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVS------YGESEKDLRK-----LMTTNFV---FLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQ-ENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLI----VXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC-------RDQKTIDILHELM 2500
            +E   YQ E+   A  GK+ +I+LPTG GKT  A  + ++ LE     +VAF+V+KV LV Q  S  F+   +D               K  +++++    D++HKC      +D+DVII TA   +N L+    +  +  TDF+L+++DE HH  K+  YNKL+     Y +R +  K +L                         +I+GLTASP       F K  E +  +  +L    I++   + ++L       N +  +V+      +G+  K+L K     L T  F    F  + +E++V  +           L + +I  +K   +   + +R+   S+L H    V + +A + +      +KF  I +  + T  +   +F+ +  +   +L H  + EN  +  + EI+K+       +R I +    R+      N +  +     FQ +        G G  ++ K M+  EQ++ ++  R+ +  ++++TSV +EG+D+PQC++V+     T+  A+VQ RGRAR +DS    L        R ++T +IL +LM
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKD---------------KYTVVAISG---DTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLM---EGYLERKICRKGKL------------------------PQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELMKTIHGYLRTAEFSESEFGTQVYEQKVVELEK-----EAGQLAVLQIYWMKRTCA---LHLRKYNDSLLVH--DTVRMTDAYELLAEFYVTEKF--IRKQNDPTDTFLIQLFD-RNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGI-IFTRTRQSTHSLHNWISGKDY---FQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGKEIRREQTNEILEDLM 510          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 116.701 bits (291), Expect = 2.874e-26
Identity = 148/572 (25.87%), Postives = 264/572 (46.15%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKC----SIRDHDVIIATADFFKNILN----KQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSG--ELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVS------YGESEKDLRK-----LMTTNFV---FLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQ-ENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLI----VXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC-------RDQKTIDILHELM 2500
            +E   YQ E+   A  GK+ +I+LPTG GKT  A  + ++ LE     +VAF+V+KV LV Q  S  F+   +D               K  +++++    D++HKC      +D+DVII TA   +N L+    +  +  TDF+L+++DE HH  K+  YNKL+     Y +R +  K +L                         +I+GLTASP       F K  E +  +  +L    I++   + ++L       N +  +V+      +G+  K+L K     L T  F    F  + +E++V      + L  + ++   E + +K   +   + +R+   S+L H    V + +A + +      +KF  I +  + T  +   +F+ +  +   +L H  + EN  +  + EI+K+       +R I +    R+      N +  +     FQ +        G G  ++ K M+  EQ++ ++  R+ +  ++++TSV +EG+D+PQC++V+     T+  A+VQ RGRAR +DS    L        R ++T +IL +LM
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKD---------------KYTVVAISG---DTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLM---EGYLERKICRKGKLP------------------------QILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELMKTIHGYLRTAEFSESEFGTQVYEQKV------VELEKEGAV---EADRMKRTCA---LHLRKYNDSLLVH--DTVRMTDAYELLAEFYVTEKF--IRKQNDPTDTFLIQLFD-RNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGI-IFTRTRQSTHSLHNWISGKDY---FQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGKEIRREQTNEILEDLM 506          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 116.316 bits (290), Expect = 3.363e-26
Identity = 148/572 (25.87%), Postives = 264/572 (46.15%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKC----SIRDHDVIIATADFFKNILN----KQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSG--ELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVS------YGESEKDLRK-----LMTTNFV---FLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQ-ENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLI----VXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC-------RDQKTIDILHELM 2500
            +E   YQ E+   A  GK+ +I+LPTG GKT  A  + ++ LE     +VAF+V+KV LV Q  S  F+   +D               K  +++++    D++HKC      +D+DVII TA   +N L+    +  +  TDF+L+++DE HH  K+  YNKL+     Y +R +  K +L                         +I+GLTASP       F K  E +  +  +L    I++   + ++L       N +  +V+      +G+  K+L K     L T  F    F  + +E++V      + L  + ++   E + +K   +   + +R+   S+L H    V + +A + +      +KF  I +  + T  +   +F+ +  +   +L H  + EN  +  + EI+K+       +R I +    R+      N +  +     FQ +        G G  ++ K M+  EQ++ ++  R+ +  ++++TSV +EG+D+PQC++V+     T+  A+VQ RGRAR +DS    L        R ++T +IL +LM
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKD---------------KYTVVAISG---DTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLM---EGYLERKICRKGKL------------------------PQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELMKTIHGYLRTAEFSESEFGTQVYEQKV------VELEKEGAV---EADRMKRTCA---LHLRKYNDSLLVH--DTVRMTDAYELLAEFYVTEKF--IRKQNDPTDTFLIQLFD-RNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGI-IFTRTRQSTHSLHNWISGKDY---FQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGKEIRREQTNEILEDLM 506          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 116.316 bits (290), Expect = 3.363e-26
Identity = 148/572 (25.87%), Postives = 264/572 (46.15%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKC----SIRDHDVIIATADFFKNILN----KQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASP--SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVS------YGESEKDLRK-----LMTTNFV---FLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQ-ENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLI----VXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC-------RDQKTIDILHELM 2500
            +E   YQ E+   A  GK+ +I+LPTG GKT  A  + ++ LE     +VAF+V+KV LV Q  S  F+   +D               K  +++++    D++HKC      +D+DVII TA   +N L+    +  +  TDF+L+++DE HH  K+  YNKL+     Y +R +  K +L                         +I+GLTASP       F K  E +  +  +L    I++   + ++L       N +  +V+      +G+  K+L K     L T  F    F  + +E++V      + L  + ++   E + +K   +   + +R+   S+L H    V + +A + +      +KF  I +  + T  +   +F+ +  +   +L H  + EN  +  + EI+K+       +R I +    R+      N +  +     FQ +        G G  ++ K M+  EQ++ ++  R+ +  ++++TSV +EG+D+PQC++V+     T+  A+VQ RGRAR +DS    L        R ++T +IL +LM
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKD---------------KYTVVAISG---DTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLM---EGYLERKICRKGKLP------------------------QILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELMKTIHGYLRTAEFSESEFGTQVYEQKV------VELEKEGAV---EADRMKRTCA---LHLRKYNDSLLVH--DTVRMTDAYELLAEFYVTEKF--IRKQNDPTDTFLIQLFD-RNQATLLELAHDSRFENPKLTKLEEILKDQFQFSSVSRGI-IFTRTRQSTHSLHNWISGKDY---FQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGKEIRREQTNEILEDLM 506          
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 116.316 bits (290), Expect = 3.901e-26
Identity = 145/566 (25.62%), Postives = 255/566 (45.05%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKC----SIRDHDVIIATADFFKNILN----KQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSG--ELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVS------YGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNL--KSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQ-ENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLI----VXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLC-------RDQKTIDILHELM 2500
            +E   YQ E+   A  GK+ +I+LPTG GKT  A  + ++ LE     +VAF+V+KV LV Q  S  F+   +D               K  +++++    D++HKC      +D+DVII TA   +N L+    +  +  TDF+L+++DE HH  K+  YNKL+     Y +R +  K +L                         +I+GLTASP       F K  E +  +  +L    I++   + ++L       N +  +V+      +G+  K+L K +       L+  E   +  G  +       L  E +  L   +      + +R+   S+L H    V + +A + +      +KF  I +  + T  +   +F+   +    +L H  + EN  +  + EI+K+       +R I +    R+      N +  +     FQ +        G G  ++ K M+  EQ++ ++  R+ +  ++++TSV +EG+D+PQC++V+     T+  A+VQ RGRAR +DS    L        R ++T +IL +LM
Sbjct:    1 MELHDYQWEVIAPALEGKNIIIWLPTGAGKTRAALYVAMRHLEMKRNAKVAFIVNKVHLVDQHFSNEFQPHLKD---------------KYTVVAISG---DTEHKCFFAQKTQDNDVIICTAQILQNALSSGSEEMHVELTDFTLLIIDECHHTHKDGVYNKLM---EGYLERKICRKGKL------------------------PQILGLTASPGTGRATSFHKAVEHILQICANLDTWRIMSAEVHREDLEAKAKQPNKQYDLVAQRTRDPFGDKLKELMKTIHG----YLRTAEFSESEFGTQVYEQKVVELEKEALPGLLGTTTFRTCALHLRKYNDSLLVH--DTVRMTDAYELLAEFYVTEKF--IRKQNDPTDTFLIQLFDPTLL----ELAHDSRFENPKLTKLEEILKDQFQFSSVSRGI-IFTRTRQSTHSLHNWISGKDY---FQKMGIKTAPLTGAGYSNQSKHMTQNEQREVIEKFRKGQLNLLVSTSVAEEGLDIPQCNVVVRYGLMTNEIAMVQARGRARHEDSCYSFLAKSGGKEIRREQTNEILEDLM 505          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ddx58 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:MGI Symbol;Acc:MGI:2442858])

HSP 1 Score: 77.0258 bits (188), Expect = 5.516e-14
Identity = 52/164 (31.71%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKAN-GKDCVIFLPTGTGKTFIAAMLMLKMLEENPFH---RVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDS-DHKCSIRDHDVIIATADFFKNILNKQQI-YWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            L+PR YQLE+   A  GK+ +I  PTG GKTF++ ++    L++ P     +V F  +++ +  QQ+  F   FE +                 + S++    DS   +  I D+D+II T     N LN   I   + F+L++ DE H+  K HPYN+++F Y
Sbjct:  197 LKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQIPVYEQQATVFSRYFERL--------------GYNIASISGATSDSVSVQHIIEDNDIIILTPQILVNNLNNGAIPSLSVFTLMIFDECHNTSKNHPYNQIMFRY 346          

HSP 2 Score: 56.225 bits (134), Expect = 1.488e-7
Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKK-SQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTID 2482
            M++  QK  L+  R    + I+IATSV DEGID+ +C+LVI      +V  ++Q RGR R +DS+  +L      I+
Sbjct:  629 MTLPAQKCVLEAFRASGDNNILIATSVADEGIDIAECNLVILYEYVGNVIKMIQTRGRGRARDSKCFLLTSSADVIE 705          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ddx58 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:MGI Symbol;Acc:MGI:2442858])

HSP 1 Score: 76.2554 bits (186), Expect = 1.238e-13
Identity = 52/164 (31.71%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKAN-GKDCVIFLPTGTGKTFIAAMLMLKMLEENPFH---RVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDS-DHKCSIRDHDVIIATADFFKNILNKQQI-YWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            L+PR YQLE+   A  GK+ +I  PTG GKTF++ ++    L++ P     +V F  +++ +  QQ+  F   FE +                 + S++    DS   +  I D+D+II T     N LN   I   + F+L++ DE H+  K HPYN+++F Y
Sbjct:  242 LKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQIPVYEQQATVFSRYFERL--------------GYNIASISGATSDSVSVQHIIEDNDIIILTPQILVNNLNNGAIPSLSVFTLMIFDECHNTSKNHPYNQIMFRY 391          

HSP 2 Score: 56.6102 bits (135), Expect = 1.463e-7
Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKK-SQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTID 2482
            M++  QK  L+  R    + I+IATSV DEGID+ +C+LVI      +V  ++Q RGR R +DS+  +L      I+
Sbjct:  674 MTLPAQKCVLEAFRASGDNNILIATSVADEGIDIAECNLVILYEYVGNVIKMIQTRGRGRARDSKCFLLTSSADVIE 750          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Dhx58 (DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:MGI Symbol;Acc:MGI:1931560])

HSP 1 Score: 74.7146 bits (182), Expect = 3.080e-13
Identity = 54/164 (32.93%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIID-SDHKCSIRDHDVIIATADFFKNILNK----QQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            +E R YQ E+   A  GK+ +I+LPTG GKT  AA +  + LE     +V  LV++V LV Q ++ F+         R   +  TVT      +L+ ++   +      R HD++I TA+  +  LN     + +   +FSL+V+DE HH  K+  YN +L  Y
Sbjct:    1 MELRPYQWEVILPALEGKNIIIWLPTGAGKTRAAAFVAKRHLETVDRGKVVVLVNRVHLVSQHAEEFR---------RMLDKHWTVT------TLSGDMGSRAGFGLMARSHDLLICTAELLQLALNSSEEDEHVELREFSLIVVDECHHTHKDTVYNTILSRY 149          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ifih1 (interferon induced with helicase C domain 1 [Source:MGI Symbol;Acc:MGI:1918836])

HSP 1 Score: 71.2478 bits (173), Expect = 4.042e-12
Identity = 76/260 (29.23%), Postives = 125/260 (48.08%), Query Frame = 2
Query:  902 KLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS----IRDHDVIIATADFFKNIL------NKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDKTYELLKALLH---SLGDVGIVTVTENIDEL 1627
            +L+ R YQ+E+ + A +GK+ +I LPTG+GKT +A  +    L++    +   +V  LV+KV+L  Q    F+ +F              + +  ++I L+    D+  K S    ++ +DVII+TA   +N L      +   +  +DFSL+++DE HH  KE  YN ++  Y     +  L  N+L               +  +  I   +I+GLTASP G     K  E  K +L+   +L    I TV EN+ +L
Sbjct:  306 ELQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASESGKVIVLVNKVMLAEQL---FRKEFNPY-----------LKKWYRIIGLSG---DTQLKISFPEVVKSYDVIISTAQILENSLLNLESGDDDGVQLSDFSLIIIDECHHTNKEAVYNNIMRRY----LKQKLRNNDL--------------KKQNKPAIPLPQILGLTASP-GVGAAKKQSEAEKHILNICANLDAFTIKTVKENLGQL 529          

HSP 2 Score: 51.9878 bits (123), Expect = 3.691e-6
Identity = 25/68 (36.76%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            M+  EQK+ +   R  +  ++IAT+V +EG+D+ +C++VI     T+  A+VQ RGRAR  +S  +++
Sbjct:  766 MTQTEQKEVISKFRTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLV 833          
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Match: Ifih1 (interferon induced with helicase C domain 1 [Source:MGI Symbol;Acc:MGI:1918836])

HSP 1 Score: 71.2478 bits (173), Expect = 4.099e-12
Identity = 76/260 (29.23%), Postives = 125/260 (48.08%), Query Frame = 2
Query:  902 KLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS----IRDHDVIIATADFFKNIL------NKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDKTYELLKALLH---SLGDVGIVTVTENIDEL 1627
            +L+ R YQ+E+ + A +GK+ +I LPTG+GKT +A  +    L++    +   +V  LV+KV+L  Q    F+ +F              + +  ++I L+    D+  K S    ++ +DVII+TA   +N L      +   +  +DFSL+++DE HH  KE  YN ++  Y     +  L  N+L               +  +  I   +I+GLTASP G     K  E  K +L+   +L    I TV EN+ +L
Sbjct:  257 ELQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASESGKVIVLVNKVMLAEQL---FRKEFNPY-----------LKKWYRIIGLSG---DTQLKISFPEVVKSYDVIISTAQILENSLLNLESGDDDGVQLSDFSLIIIDECHHTNKEAVYNNIMRRY----LKQKLRNNDL--------------KKQNKPAIPLPQILGLTASP-GVGAAKKQSEAEKHILNICANLDAFTIKTVKENLGQL 480          

HSP 2 Score: 51.9878 bits (123), Expect = 3.378e-6
Identity = 25/68 (36.76%), Postives = 44/68 (64.71%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            M+  EQK+ +   R  +  ++IAT+V +EG+D+ +C++VI     T+  A+VQ RGRAR  +S  +++
Sbjct:  717 MTQTEQKEVISKFRTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLV 784          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|O95786|DDX58_HUMAN (Antiviral innate immune response receptor RIG-I OS=Homo sapiens OX=9606 GN=DDX58 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 8.274e-20
Identity = 143/563 (25.40%), Postives = 243/563 (43.16%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLM---LKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQI-YWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS-GEL-DFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTS-----LTNMESRI---VSYGESE-------------KDLRKL-MTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKS----ILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSI--INEIVKECKSLQDENRTILVLVEERRDAREYKNSLE-KEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALD-FIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTID 2482
             +PR YQLE+   A  GK+ +I  PTG GKTF++ ++    LK   +    +V F  +++ +  QQ   F   FE           +   R   +     E +  +    + ++D+II T     N L K  I   + F+L++ DE H+  K+HPYN ++F Y    Q++  +   L  V                        IGLTAS   G+  + D+  + +  L  SL    I TV  N++EL +           +ESRI     Y  ++             KDL  L    N  F  +K+E+ +  +    ++       + + +        L +    ++K     I++    + D ++ + +    +    FDEI   ++ T  ++  +   +++S++        EN  +  +  I++E   L  E  TIL  V+ R      KN +E   KL+F    I+   G+G  +++ GM++  QK  LD F       I+IATSV DEGID+ QC+LVI      +V  ++Q RGR R + S+  +L  +   I+
Sbjct:  241 FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFE-----------RHGYRVTGISGATAENVPVEQ--IVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNY--LDQKLGGSSGPLPQV------------------------IGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMV-----FQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEI--EQDLTQRFEEKLQELESVSRD-----PSNENPKLEDLCFILQEEYHLNPETITIL-FVKTRALVDALKNWIEGNPKLSFLKPGIL--TGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIE 749          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|Q09884|DCR1_SCHPO (Protein Dicer OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcr1 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 9.381e-20
Identity = 146/554 (26.35%), Postives = 232/554 (41.88%), Query Frame = 2
Query:  914 RKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEE-------NPFHR--VAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASP----SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNG-------IGNGLILSSDTSLTIEEINNLKSQLSGLLVDVRE---IQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFE-FQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTI---DILHE 2494
            RKYQ ++Y  A+ ++ ++ + TG GKT +A  L+ + LEE       N  H+    FLV+KV LV QQ++  + Q        +      ++ +L    L N I+          ++VI+ TAD F   L +  +   D +L++ DE HH +    Y +++ +++   + VL  K+  L                        +I G+TASP     G L + + Y+        L D     V+EN  EL ++  L   E   V Y        KL+      ++KK E  + G       +   L  + D  L   E      Q+   LVD  E   ++K  L   L+  D   AID +   +   K ++  +N      +D+         K F+LL           E++K      D  RT+ + VE  R A  +  SL  + LN    +     G   +      M+   QK  L   +  K  ++IAT+V +EGID+P C+LVI  N   +V   VQ RGRAR   S+ L+    ++ +    ILHE
Sbjct:   13 RKYQQDVYNIASKQNTLLVMRTGAGKTLLAVKLIKQKLEEQILIQESNLEHKKISVFLVNKVPLVFQQAEYIRSQLPAKVGMFYGELSIEMSEQL----LTNIILK---------YNVIVITADLFYLFLARGFLSINDLNLIIFDECHHAIGNDAYARIMNDFYHRAKAVLSKKHFTLP-----------------------RIFGMTASPFTGKKGNL-YHRLYQ-----WEQLFDSKAHVVSEN--ELADYFCLP--EESYVMYSN------KLVVPPSDSIIKKCEETLQGCKLISRAVKTALAETIDMGLWFGE------QVWLYLVDFVETKRLKKKALGKQLS-DDEELAIDRLKIFVEDWKNNKYSDNGPRIPVFDST----DVTDKVFKLL-----------ELLKATYRKSDSVRTV-IFVE--RKATAFTLSLFMKTLNLPNIRAHSFIGHGPSDQGEFSMTFRRQKDTLHKFKTGKYNVLIATAVAEEGIDVPSCNLVIRFNICRTVTQYVQSRGRARAMASKFLIFLNTEELLIHERILHE 489          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|Q7S8J7|DCL1_NEUCR (Dicer-like protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=dcl-1 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.301e-17
Identity = 73/236 (30.93%), Postives = 112/236 (47.46%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLM-------LKMLEENPFHRVAF-LVDKVLLVMQQ----SKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASP-SGELDFDKTYELLKALLHS 1579
            PR+YQ+E++E+A  ++ +  L TG+GKT IAAML+       L+  E+    R+AF LVDKV LV QQ    +K+     E +C E  E  E     K  L                  ++V++ TA+     L+   I     +L++ DEAHH  K+HPY +++  +++         +E L                     RR +I+GLTASP   ++D  +    L+ALLHS
Sbjct:  122 PREYQVELFERAKQQNTIAVLDTGSGKTLIAAMLLRWVITGELEDREKGLPRRIAFFLVDKVALVFQQHSFLTKNLDFPMEKLCGEMVEGVESKAFWKEAL----------------EQNEVVVCTAEILSTALHHSWIRMDQINLLIFDEAHHTKKDHPYARIIKNFYI---------DEQLE--------------------RRPRILGLTASPVDAKVDPRRAAAELEALLHS 312          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|Q2VF19|DCL1_CRYPA (Dicer-like protein 1 OS=Cryphonectria parasitica OX=5116 GN=DCL-1 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.605e-14
Identity = 68/233 (29.18%), Postives = 101/233 (43.35%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEEN--------PFHRVAFLVDKVLLVMQQSKSFKGQFE-DICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGEL-DFDKTYELLKALLHS 1579
            PR YQ+E++E+A  ++ +  L TG+GKT IAA+L+   + +         P     FLV+KV L  QQ    +      + +   ES + T T+      LA             DH+VI+ TA+     L    I     +L+V DEAHH  K HPY +++ +Y+         K+  L                     R  +I G+TASP   L D  +    L+ LLHS
Sbjct:   99 PRDYQMELFERAKQQNTIAVLDTGSGKTLIAALLLDHTVNQELEDRAKGLPRRIAFFLVEKVALAFQQHAVLECNLAHSVAVFSGESIKNTWTKGFWETQLA-------------DHEVIVCTAEILNQCLQYAYIRIDQINLLVFDEAHHTKKNHPYARIIKDYYAS------GKDRGL---------------------RLPRIFGMTASPVDALIDVRQAAIELEGLLHS 291          
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Match: sp|A2R345|DCL21_ASPNC (Dicer-like protein 2-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=dcl2-1 PE=3 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 7.127e-14
Identity = 56/204 (27.45%), Postives = 100/204 (49.02%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASP 1522
            PR YQ+E++E +  ++ ++ + TG+GKT IA + ++K LE NP   + FL   V L +QQ K        +       + +T+T  L  + L  E    D    +++  V+++T     + ++   +  T   L++ DEAHHC++ HP NK++ +++ +P    L ++   +V                      KI+GLTASP
Sbjct:   19 PRSYQVEMFEASLKENIIVTMGTGSGKTHIALLRIIKELESNPHKLIWFLTPTVALCLQQFKFLSDNIPAV-------RARTLT-SLDKVELWTEQPVWD--AILKEMQVVVSTHAVLADAMSHGFVKITQLGLMIFDEAHHCMRRHPANKIMQDFY-HPA---LERHGAEAVP---------------------KILGLTASP 187          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A1S3HGS0 (uncharacterized protein LOC106154762 OS=Lingula unguis OX=7574 GN=LOC106154762 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 8.056e-64
Identity = 196/659 (29.74%), Postives = 328/659 (49.77%), Query Frame = 2
Query:  593 CLLCQTKMNTDEQYAMHCSGSKHTKKIRSFNLSDHFILKEESYNEEMIDCKICNIKIH-RNNQDSHDKGKMHRDNLFKSKTEDIISQTVRKTELSD-GLKNLKLLKLE-PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSLGDVGIVTVTEN---IDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQL----SGLLVDVREIQ-------KSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNF-----KTISKEFQLLHQEQENS------SIINEIVKEC---KSLQDENRTILVLVEERRDAREYKNSL-EKEKL-NFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKD-SRLLMLCRD 2467
            C +C   +++  + + H  G  H K++ S   + +  L   ++   +  C  C +      +   H + + H+  L +S+     S  +   E+ D  +    L+    PR YQ+++YE A   D V+FLPTGTGKT I+AM++  ML+ NP   V FLVD+VLLVMQQSK  K +  D    R +   +   R+LK+ +L  E  D+  +  I   D+++ TA ++ N+L KQ + W D  L V DEAHHCVK HP+N+LL ++H    R L  K+                         R KI+GLTASP+G    + T ++LK LL ++GD  +  + EN     EL+++ + T + ++ +    +EK+L+  +   ++FL           GN      D+   ++   +LK  +       L D + I+       +++  H   L + + A+ +     A +   ++L   +   +      N      K++++ F L  +E++        ++  EI++        Q +   +LVLV+ R  A++   +L E E+L       +   G  G  S   GM++ +Q +AL+ IR  + Q+++ATSV +EG+D P+C+LVI +NPP+SV ALVQ RGRARK+  SR + LCR+
Sbjct:  341 CFICNVGLDSRIKSSQHFRGKNHAKQL-SRAKNGYLQL---TFVPGLYSCSECQVNFSGPESHAQHLQSEKHKAKLAQSQCVPERSLPLHVKEVVDCDMDPYSLMTTTLPRSYQIDLYEAAMKGDVVVFLPTGTGKTVISAMVVSHMLQLNPARPVVFLVDRVLLVMQQSKVLKTELGDKMYTRIDDGVQH-DRQLKIGTLCGEKQDTGGEL-IWKQDIVVTTAAYYLNLLEKQVVCWQDLCLAVFDEAHHCVKSHPFNRLLEQFH----RKLQLKH-------------------------RPKILGLTASPAGRETVEDTEKMLKRLLENIGDGKLAAIMENDRSFKELSKYKTQTKLIAKELGLTVNEKELQDEL-QKYLFLCYNRLSVETDFGN-----FDSREEVKTCQDLKGDVLEAFQIFLQDAKPIEPDRNIYIEALKLHCSVLCEALSAVGDGSVEFAFRVLQDLLNRSHPGSFEKAAELNLAHQKVKSLTEHFALRTEEEKEDDKMAVKTVAREILQGIDWDSREQGKQPFVLVLVKTRVVAQQMTEALKEMEELKECGICPVCIVGHGGGSSDGGGMTIKKQSRALEGIRNYEYQVVVATSVAEEGVDFPECELVIHMNPPSSVTALVQTRGRARKQGVSRFIALCRE 958          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A210PZ85 (Endoribonuclease Dicer-like 3a OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18042 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 9.028e-59
Identity = 195/652 (29.91%), Postives = 317/652 (48.62%), Query Frame = 2
Query:  740 CKICNIKI--HRNNQDSHDKGKMHRDNLFKSKTEDIISQTV----RKTELSDGLKNLKLLKLEPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQE--KTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIR---RCKIIGLTASPSGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGI-----GNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQ-------------------KSILNHILALVDIIEAIDNIGYTIAKKKFDEILE-NENETVWYDNNI-FNFKTI--SKEFQLLHQE-----------QENSSIINEIVK--------ECKSLQDENRTI-LVLVEERRDAREYKNSLE------KEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTIDILHELM 2500
            C  C + +   +  QD H KGK+HR    KS  E   S+ +    +        +     +  PR YQ E++ K    D + FLPTGTGKT I  M +  ML+ NP H+V FLV KVLLV+QQ K  + Q  +    RF+  +  KTV R+LK+  L      S     +  HD+I+ATA + +N+L  + + W D  LV+ DEAHHC K H YN L+  +H                                +KI    RCKI+GLTASP+G+ ++  T ++L+ L  ++GD  I  V    ++L  + S   +   ++    +E+  ++ +    V+LL+ + R           N  +  +  S++++++      ++G ++D  E+Q                   ++++ HI  +   I     +G   A ++  E++  N N+   +   I    + I  S E Q L Q+           QE SS +  ++K        +    Q +++ + LVLV+ R  A     +L       K KL+ E  +     G GA +  KGMSV +Q+K L+ I++ K Q++IAT+V +EGIDLP+C+LV+++NPP+++ ALVQ+RGRARK +S  +++C D K    L +L+
Sbjct: 1035 CPTCKVPMDTEKALQD-HLKGKLHR---MKSAKEPACSRQLPPLTKTISAPFPQEQNNFTETIPRNYQWELFHKVMTGDRICFLPTGTGKTLIGCMAIGAMLDLNPSHQVLFLVTKVLLVLQQGKYIRNQLANRKYRRFDPNDPSKTVERELKIAELCGG-QQSTGGVPLWQHDIIVATAAYCENMLTNKVLRWQDQCLVIFDEAHHCSKNHSYNNLMATHH--------------------------------YKINESFRCKILGLTASPAGKNNYSMTVDMLRQLQINMGDSLIAIVEYEKEKLKAYMSNAKIHIAVMETTPAEEQFQRDLR---VYLLQCYMRLAAETNIFEHSNLGLTGTSKSVSVQDLQRHAQDITGDVLD--ELQALIAMAKPNTSSVDKRIEVQNLIGHIKCICMTISVAMEMGIPQALEEMQELMATNLNQDFDFARQIGLPCQDILHSIEAQQLFQKSNLKVLDESISQEMSSNVKCLIKQLIYENYIQWNGGQGQSQQLALVLVKRRATATALHETLMNHPEIVKRKLSVEKMV-----GHGAAAAEKGMSVAQQRKTLEEIKDHKYQVVIATAVAEEGIDLPECELVVSMNPPSTMTALVQMRGRARKLNSHFVIVCNDSKEEAKLSDLL 1639          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A2B4RFJ4 (Dicer-like protein 1 OS=Stylophora pistillata OX=50429 GN=dcl1 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.332e-54
Identity = 189/667 (28.34%), Postives = 307/667 (46.03%), Query Frame = 2
Query:  581 NWITCLLCQTKMNTDEQYAMHCSGSKHTKKIRSFNLSDHFILKEESYNEEMIDCKICNIKIHRNNQ-DSHDKGKMHRDNLFKSKTEDIISQTVRKTELSDGLKNLKLLKL------------EPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICL--ER--FESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVN-----GIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQK-SILNHILALVDIIEAIDNIGYTIAKKKFDEILEN--ENETVWYDNNIFNFKTISKEFQLLHQEQENSSIINEIVKECKSLQDE-------------NRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRD 2467
            +W  C LC+    ++ QY  H   +KH  K+  F+          SY +    C+ CN+ ++  +Q + H     H              QTV K++ +   ++L L+K             +P  Y +E+Y KA   + V FLPTGTGKT +AA ++  ML+ NP  +V FLVD+VLLV+QQS   + +   I +  ER  FES     TR +++ ++  E+   +    I + DV+I TAD ++N LN   + + D SL+VLDEAHHC K+HPYN ++ +++L  + V L                            R KI+GLTASP+GE   +KT + L+ LL +LGD  ++ VT N  EL E T+    +    SY   E+DL  ++     ++ K F   V         +    SS    +I++I  +   +  +L    E    + L H   L + +  +   GY IA  +  E+ +    +   W ++       + + +  L+  Q   SII       + L ++             N   LVLV+ +  AR     L  ++     + +        +S  KG++   +      IRE K QI++ TS+ +EG+DLP+   V  ++P + V AL +IRGRA    +R + + R+
Sbjct:  423 SWTYCRLCKFSFASESQYEEHLRSTKHQNKVAKFS--------PISYKKY---CEYCNVHLNSESQANEHFNSARH-------------EQTVAKSQKAPPQQHLPLIKAPKEFVMEQFTRTQPFNYHIELYSKAMLTNGVCFLPTGTGKTLVAAQVIAHMLKLNPSRQVVFLVDRVLLVLQQSDCLRKELGHIRVADERGSFES-----TRPIRIGAVCGEMRKLEGNARIYEQDVLIITADCYRNHLNNGTLRFDDVSLIVLDEAHHCNKDHPYNVIIRDFYLQ-EDVHLG--------------------------HRPKILGLTASPAGETSLEKTTKRLQRLLGNLGDAELLVVTRNGQELEEKTNRATPDCISASYTTHERDLLDILVK---YVTKAFNLTVRLSDMKDYKDIFQPSSGGPFSIDDIYPVLGVIDNILQSQPEANALNALLHFQLLCEAVCTLQECGYQIALYQMTELAQEACPHGFHWAESMGLPCGEV-RAYLELYLRQGFPSIIERRNSGAERLMEQLVRVNWNGVIGRSNCLALVLVKRQHTARCLSKYLSNQR-ELTSRGVRTTFINAGRSADKGLAYPLEIDPFVQIREGKFQIVVTTSLAEEGLDLPEPQWVFQMDPSSPVLALREIRGRAPLNGARFVAISRN 1028          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A0L8GKZ1 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22031992mg PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.408e-50
Identity = 211/754 (27.98%), Postives = 338/754 (44.83%), Query Frame = 2
Query:  338 ESHNKGKLHLKK-SMKNDFIHFKCDETPIQNQFSNEANLVRSSENIDIVKPYEVLSMNENETNKPSDISPDILNLLKPHKEGNWITCLLCQTKMNTDEQYAMHCSGSKHTKKIRSFNLS-DHFILKEESYNEEMID--CKICNIKIH-RNNQDSHDKGKMHRDNLFKSKT------------EDIISQTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQ--EKTVTRKLKLISLANEIIDSDHKCSIRD----HDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRC-KIIGLTASPSGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESE----KDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKS--ILNHILALVD-IIEAIDN-IGYTIAKKKFDEILEN--------ENETVWYDN--NIFNFKTISKEFQLLHQEQENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQK 2473
            ESH KGK H KK S +  F    C   PI+ Q  + +N+      +  + PY   ++ E                  P +  N          ++ + Q    C   ++   +R  +L  + FI   +  ++E+I   C +C+ K+   +   SH +   H  N+ +  +            ED I +      L+D +         PR YQ+E++EK+   D +IFLPTGTGKT                  V F+VDKVLL +QQ    + + +D    RF++   E  + R LK+I      +   H  S ++    HDVII+TA +    + +  + W DFSLVV+DE HH  KEHP+ KLL E H                                 +   C +++GLTASP+G+    KT  +L+ L+ +L +  I  V E + EL ++ S   ++   V + ++E     + +K +      L+  F+     +   +I SS+  +    +N ++ +L  + + + E++K   ++NH   +V  II+A+D  I   + + KF     N            +  DN  ++ N   +S    +  Q       I E + + + +   +  ILV+V+ RR A E    ++   L  E +L V            GM V  Q+K    I+E K QIII TSV +EG+DLP+C LVIT+NPPTSV  LVQ+RGRARK +S  L++C + K
Sbjct:   25 ESHLKGKKHQKKFSERERF----CTSLPIR-QVESPSNVQPVHAALSNIPPYNTEAITE------------------PTRSQN----------VSINVQTTQTCKEDENIVSLRPTSLDRNEFIRIYKDEDDEIIGYKCTLCSKKLQCASAVTSHLQSSAHCKNVSEQPSKLYNLPPIVHHCEDPIDEAYC---LTDSI---------PRGYQVELFEKSYCYDSIIFLPTGTGKTXXXXR-----------RPVLFIVDKVLLALQQFNYIQNELKDQKFSRFDTTNIENIIERNLKIIC-----VYGGHPGSAKEPLSMHDVIISTAVYCDLRMKENVLRWKDFSLVVIDEVHHSDKEHPFRKLLKEEH------------------------------HTLEETDCPQLLGLTASPAGKETIPKTITMLQTLVTNLNNSKINIVKEEVKELMKYKSSAQLKICTVPFQDAELPYIAEFKKYLLECLKVLVDYFD-----LSQYIIPSSEDLIDKSFLNEIEERLRSVTI-IGEMEKGTILINHTKEIVSLIIDALDGGISCIVEELKFLSDPSNMKYSFTLASGTGLCCDNIRSVVNTIVVSYNIPISAQFNYLVKTIGEYITDDRDIL--SGLILVMVKRRRTAVELCKMMKTSPLVNE-KLSVVSITGHGGGGGDGMKVSSQRKVFQEIKEGKHQIIITTSVAEEGVDLPKCSLVITLNPPTSVITLVQMRGRARKNNSIFLVVCENTK 678          
BLAST of Dicer-like protein 1 vs. TrEMBL
Match: A0A1I8H7V4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.007e-49
Identity = 182/736 (24.73%), Postives = 306/736 (41.58%), Query Frame = 2
Query:  512 NETNKPSDISPD-----ILNLLKPHKEGN------------WITCLLCQTKMNTDEQYAMHCSGSKHTKKIRSFNLSDHFI----------LKEESYNE--EMID----CKICNIKIHRNNQDSHDKGKMHRDNL-FKSKTEDIISQTVRKTELSDGLKNLKL---LKLEPRKYQLEIYE---KANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERF----------ESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSLGDVGIV--TVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEI---NNLK-SQLSGLLVDVREI---QKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIF-------NFKTISKEFQLLHQEQENSSIINEIVKECKSLQDE------NRTILVLVEERRDAREYKNSLEKEKLNFEFQ-LIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTIDILHELM 2500
            N    PS +SP      +     PH+                + C +C  + NT +Q   H  G  H K++R   ++              L+  SY    ++ D    C +C I++H NN  +H  G+ HR  L  +    D      R+    + + N +     +L PR YQLE Y    +     CV  LPTGTGKT +AA+ +L  LE NP     FLVDKVLLV+QQ+   + Q   + + RF               TVTR L + ++  ++        +   D+++ TA F+ N L    +      L+ +DEAHHC   HPY+ L                ++LS+                 +++  +++G TASP+G+     T E+L  LL  LG   +   +  +   +L EF+    +  R+V     E      +  +   +L    +     G     +SD +L + ++     L    L+G+L +V E     + +   +  L  + E    +G  +       + E ++  +    +         + + +    QLL + Q  ++    ++   ++L D+       R  LV+V ER  AR   + L       +F  L          +   GMSV +Q++ L  +   ++  ++AT +  EG+DLP+CDL++  +PP+ V ALVQ RGR R    R L+ CR  +    L +L+
Sbjct: 1337 NAAASPSAVSPSAGSAALSGSAVPHQAAGQAQPLVESQANGMLRCTVCNVQCNTPDQMLNHKQGKNHLKRLRVSGITQPAAATDRAGPEPDLQAASYQPVVQLPDGYSLCNLCGIRLHGNNVAAHVAGRDHRRRLAVRCPAPD------RQAPACEFVANPRTDWPTQLRPRIYQLEAYRLCCRHGNALCV--LPTGTGKTMVAALAILAALEANPLRSAVFLVDKVLLVLQQAAFLRAQLAQVRMRRFFRPLPPPSSPALPTPTVTRSLAVAAVCGDLHSLPDDQPLAAADLVVTTAAFYANCLRTGALRLDQACLLAMDEAHHCDALHPYSLL--------------AGQVLSMP----------------ELKSPRLLGFTASPAGQASLPATQEMLVGLLDRLGGARLAWPSSPDAQAQLAEFSVRAGISGRLVPPLTEETAAVAALINHSALVLTALRKAAEASG-----ASDAALLVNQLLSNGGLDCPNLAGVLDEVAERTADSQPVRLLVEQLRRLSELRSALGLAVCGDSRQLVAELDDAALSSLLSRELLTEMRQSAEALVDALQLLREGQAATAGAGSVL---RALADDLRGTGGARLALVIVRERATARRLADLLASHSAFADFADLRPACLIGHGAAGDAGMSVAQQRRLLYSVARGEANALVATPIACEGLDLPRCDLLVLADPPSRVAALVQSRGRVRVDAGRCLVYCRSAEERQRLQDLL 2026          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:NCBI gene;Acc:103026821])

HSP 1 Score: 70.4774 bits (171), Expect = 5.907e-12
Identity = 60/203 (29.56%), Postives = 102/203 (50.25%), Query Frame = 2
Query:  812 NLFKSKTEDIIS---QTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ------IYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            +L+K   E++ +   QT    + S G K++ L     R YQ+E+   A  GK+ ++ LPTG+GKT +A  +  + LE         +V  LV+K+ LV Q    ++ +F      RF   + +V R    +S  +++  S  K  + ++D+II TA   +N L K +      +  + F+L+V+DE HH  K   YN ++  Y
Sbjct:  292 DLYKGSDEEMKTKEEQTAGSQDQSVGEKDIVL-----RDYQMEVARPALEGKNIIVCLPTGSGKTRVAVYITKRHLESRRRIGQPGKVVVLVNKIPLVEQH---YRAEFG-----RFLKHQYSVER----VSGDSQLKISFPKV-VENNDIIICTAQILENSLAKAKKGDEDGVKLSQFTLMVIDECHHTQKGEAYNHIMIRY 476          

HSP 2 Score: 55.0694 bits (131), Expect = 3.016e-7
Identity = 25/63 (39.68%), Postives = 42/63 (66.67%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDS 2443
            M+  EQK  L+  RE +  ++IAT+V +EG+D+ +C++V+     T+  A++Q RGR R +DS
Sbjct:  754 MTSAEQKNVLNKFREGEINLLIATTVAEEGLDVAECNVVVRYCLVTNETAMIQARGRGRAEDS 816          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: ifih1 (interferon induced with helicase C domain 1 [Source:NCBI gene;Acc:103026821])

HSP 1 Score: 70.4774 bits (171), Expect = 6.082e-12
Identity = 60/203 (29.56%), Postives = 102/203 (50.25%), Query Frame = 2
Query:  812 NLFKSKTEDIIS---QTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEE----NPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ------IYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            +L+K   E++ +   QT    + S G K++ L     R YQ+E+   A  GK+ ++ LPTG+GKT +A  +  + LE         +V  LV+K+ LV Q    ++ +F      RF   + +V R    +S  +++  S  K  + ++D+II TA   +N L K +      +  + F+L+V+DE HH  K   YN ++  Y
Sbjct:  292 DLYKGSDEEMKTKEEQTAGSQDQSVGEKDIVL-----RDYQMEVARPALEGKNIIVCLPTGSGKTRVAVYITKRHLESRRRIGQPGKVVVLVNKIPLVEQH---YRAEFG-----RFLKHQYSVER----VSGDSQLKISFPKV-VENNDIIICTAQILENSLAKAKKGDEDGVKLSQFTLMVIDECHHTQKGEAYNHIMIRY 476          

HSP 2 Score: 55.4546 bits (132), Expect = 2.913e-7
Identity = 25/63 (39.68%), Postives = 42/63 (66.67%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDS 2443
            M+  EQK  L+  RE +  ++IAT+V +EG+D+ +C++V+     T+  A++Q RGR R +DS
Sbjct:  720 MTSAEQKNVLNKFREGEINLLIATTVAEEGLDVAECNVVVRYCLVTNETAMIQARGRGRAEDS 782          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:103032392])

HSP 1 Score: 70.0922 bits (170), Expect = 6.241e-12
Identity = 50/162 (30.86%), Postives = 84/162 (51.85%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCS-IRDHDVIIATADFFKNIL----NKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            R YQ E+ ++A  G++ +I+LPTG GKT  A  +  K LE     +VA LV+KV LV Q   K F+ +   I               +K++ ++ +  + D     +++ D++I TA   +N L      + +   DF+L+++DE HH  K+  YNK++  Y
Sbjct:    7 RLYQKEVVQRALQGENSIIWLPTGGGKTRAAVYVAKKHLETRRNAKVAVLVNKVHLVDQHYQKEFQPRLGHI---------------VKIMPISGDSREKDFFGRVVKESDLVICTAQILENALINTEEDKHVELKDFTLLIIDECHHTHKDAVYNKIMARY 153          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016457.2 (DExD/H-box helicase 58 [Source:NCBI gene;Acc:103047126])

HSP 1 Score: 63.5438 bits (153), Expect = 7.642e-10
Identity = 67/267 (25.09%), Postives = 105/267 (39.33%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFH-RVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRD----HDVIIATADFFKNILNKQQIYWTD-FSLVVLDEAHHCVKEHPYNKLLFEY---------HLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSLGDVG---IVTVTENIDELNEFTSLTNME 1657
            R+YQ E+ E A +G++ +I  PTG GKT +A  +    L++ P   +V F+  KV +  QQ K F   F                 K   + +     D+D    +R     ++V++ T     N L  + +   D F+L++LDE H+   +HPYN ++  Y         H  PQ                                   ++G TAS  G   F    E    + H   ++    I TVT+NIDEL  +  +   E
Sbjct:  255 REYQKELAEAAFSGQNTIICAPTGCGKTIVALAICEHHLKKFPGKAKVVFMATKVEVYAQQYKLFIDHFS----------------KDPDVRVTGVCGDTDVGVCLRSVVDRNEVVVLTPQILVNALQNKDLPSLDVFTLLLLDECHNTTGKHPYNNIMSRYLDTKLTSSAHTLPQ-----------------------------------VVGFTAS-VGVGSFKNQQEAEMNICHLCANLDTRVIATVTKNIDELRSYVHIPEKE 469          

HSP 2 Score: 60.8474 bits (146), Expect = 5.568e-9
Identity = 31/69 (44.93%), Postives = 43/69 (62.32%), Query Frame = 2
Query: 2255 MSVGEQKKALD-FIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            M++  QK  LD F      +I+IATSV DEGID+PQC+LV+      +V  +VQ+RGR R   SR  ++
Sbjct:  685 MTLTSQKGVLDSFKTSDHIKILIATSVADEGIDIPQCNLVLMYEYVGNVVKMVQVRGRGRAAGSRCFLI 753          
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:103033221])

HSP 1 Score: 63.1586 bits (152), Expect = 1.291e-9
Identity = 42/163 (25.77%), Postives = 75/163 (46.01%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKM---LEENPFHRVAFLVDKVLLVMQQSKSFK-------GQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLL 1369
            PRKYQ+E+ E A   + ++ L TG+GKTFIA +L+ ++   +      R  FLV+    V+QQ+ + +       G++ D C    E + +                       I ++ V++ T   F + L    +  +  +L+V DE H  + +HPY  ++
Sbjct:   34 PRKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLIKELSHQIRRGNGRRTVFLVNAASSVVQQASTVRTHSDLQVGEYTDSCTSWLEEKWRQ---------------------DIMENQVLVMTCHIFLHALRSGVLCLSTINLLVFDECHLAITDHPYRDIM 175          

HSP 2 Score: 59.6918 bits (143), Expect = 1.656e-8
Identity = 27/70 (38.57%), Postives = 47/70 (67.14%), Query Frame = 2
Query: 2267 EQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKT 2476
            +Q++ L   R  ++ ++IATS+V+EG+D+P+C+LV+  + PT  ++ VQ +GRAR   S  +ML   + T
Sbjct:  485 KQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLADSECT 554          
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Match: dicer1 (dicer 1, ribonuclease type III [Source:NCBI gene;Acc:324724])

HSP 1 Score: 60.8474 bits (146), Expect = 1.127e-9
Identity = 28/77 (36.36%), Postives = 48/77 (62.34%), Query Frame = 2
Query: 2267 EQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTIDILHEL 2497
            +Q++ L   R  ++ +++ATS V+EG+DLP+C+LV+  +PP   ++ VQ +GRA+   S  +ML   Q+      EL
Sbjct:   42 KQEEVLRKFRAHETNLLVATSAVEEGVDLPKCNLVVRFDPPADYRSYVQSKGRAQAPVSNYVMLADAQRMPAFHREL 118          
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Match: DDX58 (DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:19102])

HSP 1 Score: 55.0694 bits (131), Expect = 5.583e-8
Identity = 27/69 (39.13%), Postives = 48/69 (69.57%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKK-SQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            M++ +Q  A+D  RE++ S ++IATSV DEG+D+ +C+LV+  +   +V   VQ RGR R ++S+ +++
Sbjct:  317 MTLNQQSGAVDEFREEQGSNLLIATSVADEGLDIQRCNLVLLYDYVGNVIKSVQTRGRGRAENSKCMLI 385          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO48835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIP7])

HSP 1 Score: 69.3218 bits (168), Expect = 1.112e-14
Identity = 28/52 (53.85%), Postives = 40/52 (76.92%), Query Frame = 2
Query: 1229 DHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHL 1384
            DHDV++ TAD +KN +N   + + D +L+VLDEAHHC KEHPYN ++ +Y+L
Sbjct:   12 DHDVLVVTADCYKNHINNGTLRFEDLALIVLDEAHHCNKEHPYNVIIRDYYL 63          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO39479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA09])

HSP 1 Score: 61.6178 bits (148), Expect = 6.024e-12
Identity = 29/71 (40.85%), Postives = 50/71 (70.42%), Query Frame = 2
Query: 2264 GEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRA-RKKDSRLLMLCRDQK 2473
            GEQ+  L   R  + +++I+TSV++EG+D+P C+LV+  +   ++++LVQ RGRA R+ DS  ++LC + K
Sbjct:    5 GEQEVILKSFRTGRIKLLISTSVLEEGLDVPVCNLVVRFDSTMNLKSLVQSRGRASRRSDSHFVVLCSNGK 75          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO32367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV86])

HSP 1 Score: 60.8474 bits (146), Expect = 1.779e-9
Identity = 42/154 (27.27%), Postives = 71/154 (46.10%), Query Frame = 2
Query:  914 RKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFE 1375
            R YQ  I +KA  ++ ++ LPTG GKTFIAA++M       P  +V F+     LV QQ    +  ++ + + + ++ E T             +  +  +   R   V   T    +N L++      D  L+V+DEAH  +  H Y +++ E
Sbjct:   86 RDYQFNIVQKALYQNIMVTLPTGLGKTFIAAVVMYNYYRWYPQGKVVFMAPTKPLVAQQ---IEACYKIMGIPQTDTAEMT-----------GNMAPTKRENLWRTKRVFFLTPQVLQNDLSRGSCAAADVVLLVVDEAHKALGNHSYCQVVRE 225          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO47177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY2])

HSP 1 Score: 58.9214 bits (141), Expect = 7.742e-9
Identity = 53/163 (32.52%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATAD----FFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            L+ R YQ E+ EKA  G + VI  PT +GKT++A  +    L++    +V F+V  V LV QQ++ FK   +D  + +  S           I L+  ++ S H        V++ TA        N L    +  +  SL+V DE HH  K+HPYNK++  Y
Sbjct:    1 LDLRGYQKELSEKALEGHNTVICAPTNSGKTYVALNIARNHLDKKKEGKVLFIVSTVNLVQQQTERFKLYLQDKYIVKDISGSNGCD-----IPLSG-LLGSSH--------VVVLTAQVMLCILVNALKDGSLQLSSVSLLVFDECHHTQKDHPYNKIMENY 149          
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Match: EDO44279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWA7])

HSP 1 Score: 57.7658 bits (138), Expect = 1.769e-8
Identity = 51/161 (31.68%), Postives = 76/161 (47.20%), Query Frame = 2
Query:  914 RKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFH-RVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNIL-NKQQIYWTDFSLVV---LDEAHHCVKEHPYNKLLFEY 1378
            RKYQ E+ E A  G + VI  PT +GKTF+A  +  + L+++  H +V F+V    LV+QQ + F+    +  +        T    LK +  AN              DV++ TA    N L NK ++     S +     DE HH  K H YNK++ +Y
Sbjct:    4 RKYQEELAEPAIQGYNTVICAPTNSGKTFVAMEIAKQHLDKHSDHAKVIFIVSTQNLVLQQRQRFEAYLSNYAVCDISGVNSTEI-PLKFLLKAN--------------DVVVLTAQILLNALQNKNELSSISLSDLSLLIFDECHHTNKNHSYNKIMHQY 149          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:101162602])

HSP 1 Score: 68.9366 bits (167), Expect = 1.632e-11
Identity = 74/258 (28.68%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  818 FKSKTEDIISQTVRKTELSDGLKNLK-------------LLKLEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFK---GQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNIL----NKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS 1525
            FK+ T D+ S+  R+ E +  L  LK             +   E  KYQ E+ E+A  G++ +I+LPTG GKT  A  +  + LE     +V  LV+ V LV Q  SK FK   G   ++      S+EK    K+                 ++ +DVII TA    N L      + +  +D +L+++DE HH  KE  YNK++     Y ++ L  + +L                         +I+GLTASP 
Sbjct:   13 FKTPTADLSSRR-RRGEAAGVLLTLKAFSHVWHTLKESTMADFELYKYQEEVVERALKGENIIIWLPTGGGKTRAAVYVAKRHLETTANAKVVVLVNMVHLVDQHYSKEFKPHLGSLYNLIKVSGVSEEKDFFGKV-----------------VQRNDVIICTAQILYNALIDKEEAKHVELSDITLLIIDECHHTHKEAVYNKVM---RCYMEKKLKGERQL------------------------PQILGLTASPG 225          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:101164359])

HSP 1 Score: 68.1662 bits (165), Expect = 4.146e-11
Identity = 50/173 (28.90%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKM-------LEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKL--LFEYHLYPQRVL 1402
            PRKYQ+E+ E A   + ++ L TG+GKTFIA +L  ++        +EN   R  FL +     +QQ+ + +   +    E  + QE T   + +                I D+ V++ T   F ++L    +  +  +LVV D+ H  + EHPY ++  LFE H    R+L
Sbjct:   34 PRKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLTKELSHQIRGSYQEN-ARRTVFLANATSSAVQQAAAVRTHSDLHVGEYSDPQEATTWSRQRWSR------------EIADNQVLVMTCHVFLHVLTNHILPLSKINLVVFDDCHLAITEHPYCEVMKLFEEHTCGSRIL 193          

HSP 2 Score: 62.003 bits (149), Expect = 3.266e-9
Identity = 27/70 (38.57%), Postives = 48/70 (68.57%), Query Frame = 2
Query: 2267 EQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKT 2476
            +Q++ L   R  ++ ++IATS+V+EG+D+P+C+LV+  + PT  ++ VQ +GRAR   S  +ML   ++T
Sbjct:  490 KQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLADSERT 559          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: ifih1 (interferon induced with helicase C domain 1 [Source:NCBI gene;Acc:101175445])

HSP 1 Score: 66.2402 bits (160), Expect = 1.082e-10
Identity = 49/164 (29.88%), Postives = 82/164 (50.00%), Query Frame = 2
Query:  920 YQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLE----ENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNK------QQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEY 1378
            YQ+E+ + A  GK+ +I LPTG+GKT +A  +  + L+    E    +V  LV+KV LV Q    +  +F       ++ +  +   +LK IS A           ++ +D+II TA   +N L +      + +  +D SL+++DE HH  K   YN ++  Y
Sbjct:  278 YQMEVAKPALEGKNIIICLPTGSGKTRVAVYITKEHLDLRRAEGKLGKVVVLVNKVPLVEQH---YTKEFTPYLKHSYKVERVSGDSQLK-ISFAK---------IVQRNDIIICTAQILENYLERATSGVDEGVKLSDLSLMIIDECHHTQKGEAYNHIMMRY 428          

HSP 2 Score: 50.447 bits (119), Expect = 8.098e-6
Identity = 23/63 (36.51%), Postives = 38/63 (60.32%), Query Frame = 2
Query: 2255 MSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDS 2443
            M+  EQK  L      +  +++AT+V +EG+D+P C+ VI     T+  A++Q +GR R +DS
Sbjct:  706 MTAAEQKDVLKKFSTGEVNLLVATTVAEEGLDIPACNFVIRYGHVTNEIAMIQSQGRGRAEDS 768          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dhx58 (DExH-box helicase 58 [Source:NCBI gene;Acc:101162602])

HSP 1 Score: 65.855 bits (159), Expect = 1.379e-10
Identity = 64/216 (29.63%), Postives = 96/216 (44.44%), Query Frame = 2
Query:  905 LEPRKYQLEIYEKA-NGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQ-SKSFK---GQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNIL----NKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPS 1525
             E  KYQ E+ E+A  G++ +I+LPTG GKT  A  +  + LE     +V  LV+ V LV Q  SK FK   G   ++      S+EK    K+                 ++ +DVII TA    N L      + +  +D +L+++DE HH  KE  YNK++     Y ++ L  + +L                         +I+GLTASP 
Sbjct:    4 FELYKYQEEVVERALKGENIIIWLPTGGGKTRAAVYVAKRHLETTANAKVVVLVNMVHLVDQHYSKEFKPHLGSLYNLIKVSGVSEEKDFFGKV-----------------VQRNDVIICTAQILYNALIDKEEAKHVELSDITLLIIDECHHTHKEAVYNKVM---RCYMEKKLKGERQL------------------------PQILGLTASPG 175          
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Match: dicer1 (dicer 1, ribonuclease III [Source:NCBI gene;Acc:101164359])

HSP 1 Score: 64.6994 bits (156), Expect = 4.466e-10
Identity = 48/171 (28.07%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  911 PRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKM-------LEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVL 1402
            PRKYQ+E+ E A   + ++ L TG+GKTFIA +L  ++        +EN   R  FL +     +QQ+ + +   +    E  + QE T   + +                I D+ V++ T   F ++L    +  +  +LVV D+ H  + EHPY +++ E H    R+L
Sbjct:   34 PRKYQVELLEAALEHNTIVCLNTGSGKTFIAVLLTKELSHQIRGSYQEN-ARRTVFLANATSSAVQQAAAVRTHSDLHVGEYSDPQEATTWSRQRWSR------------EIADNQVLVMTCHVFLHVLTNHILPLSKINLVVFDDCHLAITEHPYCEVMKE-HTCGSRIL 190          

HSP 2 Score: 62.003 bits (149), Expect = 2.584e-9
Identity = 27/70 (38.57%), Postives = 48/70 (68.57%), Query Frame = 2
Query: 2267 EQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKT 2476
            +Q++ L   R  ++ ++IATS+V+EG+D+P+C+LV+  + PT  ++ VQ +GRAR   S  +ML   ++T
Sbjct:  487 KQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPVSNYIMLADSERT 556          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000016950.1 (SMESG000016950.1)

HSP 1 Score: 1542.32 bits (3992), Expect = 0.000e+0
Identity = 813/825 (98.55%), Postives = 819/825 (99.27%), Query Frame = 2
Query:   83 MDQCYSEKIFDDSAKKIVITCKLCNKKCDTDDQLNIHNKSKNHLKKLTAKQAEVNFVFSNGKSENISCPLHCKICGIDCNTLDQLESHNKGKLHLKKSMKNDFIHFKCDETPIQNQFSNEANLVRSSENIDIVKPYEVLSMNENETNKPSDISPDILNLLKPHKEGNWITCLLCQTKMNTDEQYAMHCSGSKHTKKIRSFNLSDHFILKEESYNEEMIDCKICNIKIHRNNQDSHDKGKMHRDNLFKSKTEDIISQTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTIDILHELMXXXXXXXXXXXXLISENNY 2557
            MDQCYSEK+FDDSAKKIVITCKLCNKKCDTDDQLNIHNKSKNHLKK+TAKQAEVNFVFSNGKSENISCP HCKICGIDCNTLDQLESHNKGK HLKKS+KNDFI+FKCDETPIQNQFSNEANLVRSSENIDIVKPYEVLSMNENETNKPSDISPDILNLLKPHKEGNWI CLLCQTKMNTDEQYAMHCSGSKH KKIRSFNLSDHFILKEESYNEEMIDCKICNIKIHRNNQDSHDKGKMHRDNLFKSKTEDIISQTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANE+IDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQ VLLNKNELLSVSDIQSPPEIISSELEEWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDV+EIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVGHGGKGAKSKHKGMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPP SVQALVQIRGRARKKDSRLLMLCRDQKTIDILHELMKKEENINKAIEKLISENNY
Sbjct:    1 MDQCYSEKVFDDSAKKIVITCKLCNKKCDTDDQLNIHNKSKNHLKKITAKQAEVNFVFSNGKSENISCPFHCKICGIDCNTLDQLESHNKGKSHLKKSIKNDFINFKCDETPIQNQFSNEANLVRSSENIDIVKPYEVLSMNENETNKPSDISPDILNLLKPHKEGNWIACLLCQTKMNTDEQYAMHCSGSKHKKKIRSFNLSDHFILKEESYNEEMIDCKICNIKIHRNNQDSHDKGKMHRDNLFKSKTEDIISQTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANELIDSDHKCSIRDHDVIIATADFFKNILNKQQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQHVLLNKNELLSVSDIQSPPEIISSELEEWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSLGDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVQEIQKSILNHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVGHGGKGAKSKHKGMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPASVQALVQIRGRARKKDSRLLMLCRDQKTIDILHELMKKEENINKAIEKLISENNY 825          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014858.1 (SMESG000014858.1)

HSP 1 Score: 111.694 bits (278), Expect = 8.989e-25
Identity = 140/561 (24.96%), Postives = 246/561 (43.85%), Query Frame = 2
Query:  905 LEPRKYQLEIY-EKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ----IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCK-----IIGLTASP----SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELN-----------------------EFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSL--TIEEINNLKSQLSGLLVDVREIQKSIL-NHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSS---IINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            LE R YQ E+  E   GK+ +I  PTG+GKT +A  ++ + L+ NP  +VAFLV ++ LV QQ   FK ++ D  + R     K+ +  L             H   ++  D+ I T+D  +N L +          +FSL++ DE H+C K+HPYN+++  Y                                 +K+++ K     IIGLTAS     +G +  DK  + L  L  +L    + TV E  +EL+                       E   L ++  R++    +     K  TT  +F +   E R++    G +   +T L     E N+ +  +  +   +    ++++ NH+    D ++ I ++         D  LENEN        I   K  +       ++ EN S   + +EI ++ K  ++    I+V V ER   +  K+    +K   + +++V   G    ++  G++  E ++ L   R  +  ++++T+V +EG+D+  C+LVI     T+  A+VQ RGRAR  DS+ +++
Sbjct:  379 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFK-KYIDCKITRLTGSSKSSSTPL-----------VGH---LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHY---------------------------------FKLKKAKEKVPQIIGLTASTGTNKAGTM--DKALKRLFTLCANLDTCIVSTVKEFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIP--EDRLHHKYLGFVGKLNTELYNMTNEPNDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDL--------LD--LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLK--KNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVV---GNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVI 872          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014858.1 (SMESG000014858.1)

HSP 1 Score: 111.694 bits (278), Expect = 9.040e-25
Identity = 143/561 (25.49%), Postives = 250/561 (44.56%), Query Frame = 2
Query:  905 LEPRKYQLEIY-EKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ----IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCK-----IIGLTASP----SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELN-----------------------EFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSL--TIEEINNLKSQLSGLLVDVREIQKSIL-NHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSS---IINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            LE R YQ E+  E   GK+ +I  PTG+GKT +A  ++ + L+ NP  +VAFLV ++ LV QQ   FK ++ D  + R     K+ +  L             H   ++  D+ I T+D  +N L +          +FSL++ DE H+C K+HPYN+++  Y                                 +K+++ K     IIGLTAS     +G +  DK  + L  L  +L    + TV E  +EL+                       E   L ++  R++    +     K  TT  +F +   E R++    G +   +T L     E N+ +  +  +   +    ++++ NH+    D ++ I ++         D  LENEN        I   KTI  E++   ++ EN S   + +EI ++ K  ++    I+V V ER   +  K+    +K   + +++V   G    ++  G++  E ++ L   R  +  ++++T+V +EG+D+  C+LVI     T+  A+VQ RGRAR  DS+ +++
Sbjct:  562 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFK-KYIDCKITRLTGSSKSSSTPL-----------VGH---LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHY---------------------------------FKLKKAKEKVPQIIGLTASTGTNKAGTM--DKALKRLFTLCANLDTCIVSTVKEFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIP--EDRLHHKYLGFVGKLNTELYNMTNEPNDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDL--------LD--LENENPLTCKVERI--LKTIY-EYE-NREDSENPSLKCLQDEITEQLK--KNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVV---GNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVI 1051          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014858.1 (SMESG000014858.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.038e-24
Identity = 140/561 (24.96%), Postives = 246/561 (43.85%), Query Frame = 2
Query:  905 LEPRKYQLEIY-EKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ----IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCK-----IIGLTASP----SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELN-----------------------EFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSL--TIEEINNLKSQLSGLLVDVREIQKSIL-NHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSS---IINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            LE R YQ E+  E   GK+ +I  PTG+GKT +A  ++ + L+ NP  +VAFLV ++ LV QQ   FK ++ D  + R     K+ +  L             H   ++  D+ I T+D  +N L +          +FSL++ DE H+C K+HPYN+++  Y                                 +K+++ K     IIGLTAS     +G +  DK  + L  L  +L    + TV E  +EL+                       E   L ++  R++    +     K  TT  +F +   E R++    G +   +T L     E N+ +  +  +   +    ++++ NH+    D ++ I ++         D  LENEN        I   K  +       ++ EN S   + +EI ++ K  ++    I+V V ER   +  K+    +K   + +++V   G    ++  G++  E ++ L   R  +  ++++T+V +EG+D+  C+LVI     T+  A+VQ RGRAR  DS+ +++
Sbjct:  412 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFK-KYIDCKITRLTGSSKSSSTPL-----------VGH---LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHY---------------------------------FKLKKAKEKVPQIIGLTASTGTNKAGTM--DKALKRLFTLCANLDTCIVSTVKEFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIP--EDRLHHKYLGFVGKLNTELYNMTNEPNDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDL--------LD--LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLK--KNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVV---GNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVI 905          
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Match: SMESG000014858.1 (SMESG000014858.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.103e-24
Identity = 140/561 (24.96%), Postives = 246/561 (43.85%), Query Frame = 2
Query:  905 LEPRKYQLEIY-EKANGKDCVIFLPTGTGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLERFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNKQQ----IYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVXXXXXXXXXXXXXXXXWKIRRCK-----IIGLTASP----SGELDFDKTYELLKALLHSLGDVGIVTVTENIDELN-----------------------EFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLLKKFERRVNGIGNGLILSSDTSL--TIEEINNLKSQLSGLLVDVREIQKSIL-NHILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKEFQLLHQEQENSS---IINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEKEKLNFEFQLIVXXXXXXXXXXXXXMSVGEQKKALDFIREKKSQIIIATSVVDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLML 2458
            LE R YQ E+  E   GK+ +I  PTG+GKT +A  ++ + L+ NP  +VAFLV ++ LV QQ   FK ++ D  + R     K+ +  L             H   ++  D+ I T+D  +N L +          +FSL++ DE H+C K+HPYN+++  Y                                 +K+++ K     IIGLTAS     +G +  DK  + L  L  +L    + TV E  +EL+                       E   L ++  R++    +     K  TT  +F +   E R++    G +   +T L     E N+ +  +  +   +    ++++ NH+    D ++ I ++         D  LENEN        I   K  +       ++ EN S   + +EI ++ K  ++    I+V V ER   +  K+    +K   + +++V   G    ++  G++  E ++ L   R  +  ++++T+V +EG+D+  C+LVI     T+  A+VQ RGRAR  DS+ +++
Sbjct:  562 LEVRDYQSELAKEGIGGKNVLICSPTGSGKTIVAVKIVQEHLKINPNGKVAFLVHRIALVEQQYNQFK-KYIDCKITRLTGSSKSSSTPL-----------VGH---LKSFDLFILTSDILRNALEEDNETVLKSLNEFSLILFDECHNCDKKHPYNRIMNHY---------------------------------FKLKKAKEKVPQIIGLTASTGTNKAGTM--DKALKRLFTLCANLDTCIVSTVKEFKEELDSMQKKPVEEIKTPHLRQNDDFDTELQKLMHLCERMLHEMNNRDFFPKDPTTQAMFTIP--EDRLHHKYLGFVGKLNTELYNMTNEPNDGRKAIFAISSYLNAFVRALMVNHLFRAQDAVKLIKDL--------LD--LENENPLTCKVERILKSKLKAIYEYENREDSENPSLKCLQDEITEQLK--KNSQSRIIVFVRERNYTQILKSIFSSQKSLIKCEVVV---GNTISAEQGGLTQNELEEVLGRFRRGEINVLVSTTVAEEGLDIEHCNLVIRYGHVTNETAMVQSRGRARAADSKYVVI 1055          
The following BLAST results are available for this feature:
BLAST of Dicer-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX589.804e-2125.40DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
DDX581.723e-2025.40DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
IFIH11.975e-1329.18interferon induced with helicase C domain 1 [Sourc... [more]
DHX581.106e-1232.32DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX582.357e-1232.32DExH-box helicase 58 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drh-32.960e-2726.06Dicer Related Helicase [Source:UniProtKB/TrEMBL;A... [more]
dcr-12.902e-1128.74Endoribonuclease dcr-1 Death-promoting deoxyribonu... [more]
dcr-12.902e-1128.74Endoribonuclease dcr-1 Death-promoting deoxyribonu... [more]
drh-15.019e-1024.86Dicer Related Helicase [Source:UniProtKB/TrEMBL;A... [more]
drh-11.211e-924.86Dicer Related Helicase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dcr-21.523e-924.85gene:FBgn0034246 transcript:FBtr0086904[more]
Dcr-21.576e-924.85gene:FBgn0034246 transcript:FBtr0340217[more]
Dcr-17.220e-844.44gene:FBgn0039016 transcript:FBtr0084324[more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx581.265e-2326.12DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZF... [more]
dhx582.023e-2325.52DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:ZF... [more]
ifih15.670e-1131.16interferon induced with helicase C domain 1 [Sourc... [more]
ifih11.211e-1031.16interferon induced with helicase C domain 1 [Sourc... [more]
ifih11.534e-1031.63interferon induced with helicase C domain 1 [Sourc... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gaa2.150e-2625.87glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa2.874e-2625.87glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa3.363e-2625.87glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa3.363e-2625.87glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
gaa3.901e-2625.62glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx585.516e-1431.71DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:... [more]
Ddx581.238e-1331.71DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 [Source:... [more]
Dhx583.080e-1332.93DEXH (Asp-Glu-X-His) box polypeptide 58 [Source:MG... [more]
Ifih14.042e-1229.23interferon induced with helicase C domain 1 [Sourc... [more]
Ifih14.099e-1229.23interferon induced with helicase C domain 1 [Sourc... [more]
back to top
BLAST of Dicer-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95786|DDX58_HUMAN8.274e-2025.40Antiviral innate immune response receptor RIG-I OS... [more]
sp|Q09884|DCR1_SCHPO9.381e-2026.35Protein Dicer OS=Schizosaccharomyces pombe (strain... [more]
sp|Q7S8J7|DCL1_NEUCR1.301e-1730.93Dicer-like protein 1 OS=Neurospora crassa (strain ... [more]
sp|Q2VF19|DCL1_CRYPA5.605e-1429.18Dicer-like protein 1 OS=Cryphonectria parasitica O... [more]
sp|A2R345|DCL21_ASPNC7.127e-1427.45Dicer-like protein 2-1 OS=Aspergillus niger (strai... [more]
back to top
BLAST of Dicer-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HGS08.056e-6429.74uncharacterized protein LOC106154762 OS=Lingula un... [more]
A0A210PZ859.028e-5929.91Endoribonuclease Dicer-like 3a OS=Mizuhopecten yes... [more]
A0A2B4RFJ43.332e-5428.34Dicer-like protein 1 OS=Stylophora pistillata OX=5... [more]
A0A0L8GKZ11.408e-5027.98Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1I8H7V41.007e-4924.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifih15.907e-1229.56interferon induced with helicase C domain 1 [Sourc... [more]
ifih16.082e-1229.56interferon induced with helicase C domain 1 [Sourc... [more]
dhx586.241e-1230.86DExH-box helicase 58 [Source:NCBI gene;Acc:1030323... [more]
ENSAMXT00000016457.27.642e-1025.09DExD/H-box helicase 58 [Source:NCBI gene;Acc:10304... [more]
dicer11.291e-925.77dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dicer11.127e-936.36dicer 1, ribonuclease type III [Source:NCBI gene;A... [more]
DDX585.583e-839.13DExD/H-box helicase 58 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488351.112e-1453.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394796.024e-1240.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323671.779e-927.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471777.742e-932.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442791.769e-831.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dicer-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx581.632e-1128.68DExH-box helicase 58 [Source:NCBI gene;Acc:1011626... [more]
dicer14.146e-1128.90dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
ifih11.082e-1029.88interferon induced with helicase C domain 1 [Sourc... [more]
dhx581.379e-1029.63DExH-box helicase 58 [Source:NCBI gene;Acc:1011626... [more]
dicer14.466e-1028.07dicer 1, ribonuclease III [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Dicer-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016950.10.000e+098.55SMESG000016950.1[more]
SMESG000014858.18.989e-2524.96SMESG000014858.1[more]
SMESG000014858.19.040e-2525.49SMESG000014858.1[more]
SMESG000014858.11.038e-2424.96SMESG000014858.1[more]
SMESG000014858.11.103e-2424.96SMESG000014858.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009440 ID=SMED30009440|Name=Dicer-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2586bp
GGTATTTTAGAATATTAATTTTAGAACTTTAATACTATCAAACAATTGCG
GACAGGCAAAACAATTGAAATTAAGTTCAAACATGGATCAATGTTATTCC
GAAAAAATATTTGATGATTCTGCTAAAAAAATTGTTATTACGTGTAAATT
GTGTAACAAAAAATGTGATACTGATGATCAACTAAATATACACAATAAAA
GTAAAAATCATTTGAAAAAACTTACTGCTAAACAAGCTGAAGTAAATTTT
GTATTTTCAAATGGGAAATCTGAAAACATTTCCTGTCCTTTGCATTGTAA
AATTTGTGGCATAGATTGTAATACATTGGATCAATTAGAATCACATAACA
AGGGCAAATTACACTTAAAAAAATCTATGAAGAACGATTTTATACATTTT
AAATGTGATGAAACTCCAATTCAAAATCAATTTAGTAATGAAGCTAATTT
AGTTAGATCGTCAGAGAATATTGATATAGTAAAACCTTATGAAGTCCTAT
CAATGAACGAAAATGAAACGAATAAACCGTCAGATATATCCCCTGATATA
CTTAACTTATTAAAGCCTCATAAAGAAGGGAATTGGATAACATGCTTATT
GTGTCAAACTAAAATGAATACAGACGAGCAATATGCAATGCACTGTAGTG
GCAGTAAACATACAAAAAAAATACGATCGTTTAACCTTTCTGACCATTTT
ATTCTGAAAGAAGAATCATACAATGAGGAAATGATTGATTGCAAAATATG
CAACATCAAAATCCACAGAAACAATCAAGATTCCCACGATAAAGGCAAAA
TGCATAGGGACAATCTATTCAAATCCAAAACCGAGGATATTATTAGTCAA
ACGGTTCGCAAAACTGAATTATCAGACGGATTGAAAAATCTGAAACTACT
GAAGCTGGAACCGAGAAAATATCAACTAGAAATCTATGAGAAAGCCAATG
GGAAAGATTGCGTGATTTTCCTGCCAACCGGAACCGGTAAAACTTTCATC
GCTGCCATGCTGATGCTGAAAATGCTCGAGGAAAATCCATTTCACCGGGT
GGCATTTTTGGTTGACAAAGTGCTGCTGGTAATGCAGCAATCCAAATCGT
TTAAGGGGCAATTTGAGGATATTTGCTTGGAAAGGTTTGAATCTCAGGAG
AAGACTGTTACTCGAAAATTGAAATTAATTAGCTTAGCAAACGAAATAAT
TGACAGTGATCACAAATGCAGTATCCGTGATCATGATGTCATTATTGCTA
CAGCAGATTTCTTCAAAAATATTTTAAACAAACAACAAATTTATTGGACT
GATTTTAGCTTGGTGGTACTAGATGAAGCACATCACTGTGTGAAAGAGCA
CCCGTACAATAAATTGCTGTTTGAATATCATCTTTATCCTCAACGTGTGC
TACTCAATAAAAATGAATTATTATCCGTTTCTGATATTCAATCTCCGCCT
GAAATTATTAGCTCTGAGTTAGAGGAATGGAAAATTAGACGATGCAAGAT
CATTGGATTAACAGCTAGTCCTTCTGGAGAACTTGATTTTGATAAAACTT
ACGAGTTACTAAAGGCGTTGCTCCATTCATTAGGGGACGTCGGAATTGTT
ACTGTAACCGAAAATATTGATGAATTGAATGAATTCACATCTCTTACCAA
TATGGAGTCGAGAATTGTAAGTTATGGCGAATCAGAAAAAGATTTAAGGA
AACTTATGACGACTAATTTTGTGTTTTTATTAAAAAAATTTGAAAGACGG
GTAAATGGAATTGGAAATGGACTTATTTTATCTTCAGATACTTCATTGAC
AATAGAAGAAATTAATAATTTAAAAAGCCAACTATCCGGGCTTCTTGTTG
ATGTTCGAGAAATTCAAAAAAGTATTTTGAATCATATTTTGGCCCTAGTA
GACATTATCGAAGCAATCGACAATATTGGCTATACTATTGCTAAAAAGAA
ATTCGATGAAATTCTTGAGAATGAAAATGAAACAGTTTGGTATGATAACA
ATATTTTCAATTTCAAAACAATATCGAAAGAATTTCAATTACTCCATCAA
GAACAAGAAAATTCATCAATTATAAATGAAATTGTCAAGGAATGCAAAAG
TCTACAGGATGAAAATCGAACCATACTCGTTCTTGTTGAAGAACGTAGAG
ATGCTCGTGAATATAAAAATTCCCTTGAAAAGGAAAAACTTAATTTTGAA
TTTCAGTTAATAGTAGGCCACGGTGGCAAAGGAGCTAAAAGTAAACATAA
AGGCATGTCAGTAGGAGAGCAGAAAAAAGCTCTGGATTTCATCAGAGAAA
AAAAGAGTCAGATAATCATTGCAACATCTGTAGTTGATGAAGGAATCGAT
CTTCCTCAATGTGATCTTGTAATTACAGTGAATCCGCCTACTTCTGTGCA
AGCTCTAGTTCAAATCAGAGGTAGAGCCAGAAAGAAAGACAGTAGATTAT
TGATGTTGTGTCGGGATCAGAAGACTATTGACATTCTACATGAATTGATG
AAAAAAGAGGAGAATATCAATAAAGCTATTGAAAAATTGATCAGTGAAAA
TAATTATTAAAAATTACCATTTTATAATTTGATATG
back to top

protein sequence of SMED30009440-orf-1

>SMED30009440-orf-1 ID=SMED30009440-orf-1|Name=SMED30009440-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=826bp
MDQCYSEKIFDDSAKKIVITCKLCNKKCDTDDQLNIHNKSKNHLKKLTAK
QAEVNFVFSNGKSENISCPLHCKICGIDCNTLDQLESHNKGKLHLKKSMK
NDFIHFKCDETPIQNQFSNEANLVRSSENIDIVKPYEVLSMNENETNKPS
DISPDILNLLKPHKEGNWITCLLCQTKMNTDEQYAMHCSGSKHTKKIRSF
NLSDHFILKEESYNEEMIDCKICNIKIHRNNQDSHDKGKMHRDNLFKSKT
EDIISQTVRKTELSDGLKNLKLLKLEPRKYQLEIYEKANGKDCVIFLPTG
TGKTFIAAMLMLKMLEENPFHRVAFLVDKVLLVMQQSKSFKGQFEDICLE
RFESQEKTVTRKLKLISLANEIIDSDHKCSIRDHDVIIATADFFKNILNK
QQIYWTDFSLVVLDEAHHCVKEHPYNKLLFEYHLYPQRVLLNKNELLSVS
DIQSPPEIISSELEEWKIRRCKIIGLTASPSGELDFDKTYELLKALLHSL
GDVGIVTVTENIDELNEFTSLTNMESRIVSYGESEKDLRKLMTTNFVFLL
KKFERRVNGIGNGLILSSDTSLTIEEINNLKSQLSGLLVDVREIQKSILN
HILALVDIIEAIDNIGYTIAKKKFDEILENENETVWYDNNIFNFKTISKE
FQLLHQEQENSSIINEIVKECKSLQDENRTILVLVEERRDAREYKNSLEK
EKLNFEFQLIVGHGGKGAKSKHKGMSVGEQKKALDFIREKKSQIIIATSV
VDEGIDLPQCDLVITVNPPTSVQALVQIRGRARKKDSRLLMLCRDQKTID
ILHELMKKEENINKAIEKLISENNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR036236Znf_C2H2_sf
IPR003604Matrin/U1-like-C_Znf_C2H2
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR015880Znf_C2H2-like
IPR027417P-loop_NTPase
IPR006935Helicase/UvrB_N
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0016787hydrolase activity
GO:0005524ATP binding
GO:0003677DNA binding
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0003690double-stranded DNA binding
GO:0003723RNA binding
GO:0003725double-stranded RNA binding
GO:0004386helicase activity
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0004525ribonuclease III activity
GO:0004540ribonuclease activity
GO:0016891endoribonuclease activity, producing 5'-phosphomonoesters
GO:1990188euchromatin binding
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005719nuclear euchromatin
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016442RISC complex
GO:0031618nuclear pericentric heterochromatin
GO:0034399nuclear periphery
GO:0034507chromosome, centromeric outer repeat region
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0007049cell cycle
GO:0007059chromosome segregation
GO:0010629negative regulation of gene expression
GO:0030422production of siRNA involved in RNA interference
GO:0031047gene silencing by RNA
GO:0031048chromatin silencing by small RNA
GO:0033562co-transcriptional gene silencing by RNA interference machinery
GO:0034613cellular protein localization
GO:0035389establishment of chromatin silencing at silent mating-type cassette
GO:0051570regulation of histone H3-K9 methylation
GO:0070868heterochromatin organization involved in chromatin silencing
GO:0090052regulation of chromatin silencing at centromere
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090501RNA phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
GO:1904595positive regulation of termination of RNA polymerase II transcription
GO:1990141chromatin silencing at centromere outer repeat region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 587..607
NoneNo IPR availableCOILSCoilCoilcoord: 694..714
NoneNo IPR availableCOILSCoilCoilcoord: 812..832
NoneNo IPR availableGENE3DG3DSA:1.20.1320.30coord: 544..667
e-value: 2.4E-82
score: 279.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 531..828
e-value: 2.4E-82
score: 279.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 69..112
e-value: 7.5E-6
score: 27.4
NoneNo IPR availablePFAMPF12874zf-metcoord: 30..53
e-value: 0.012
score: 16.0
coord: 80..104
e-value: 0.0016
score: 18.8
coord: 181..203
e-value: 0.0086
score: 16.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 288..530
e-value: 2.4E-82
score: 279.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 177..212
e-value: 7.1E-6
score: 27.5
NoneNo IPR availablePANTHERPTHR14074HELICASE WITH DEATH DOMAIN-RELATEDcoord: 259..829
NoneNo IPR availableCDDcd18802SF2_C_dicercoord: 676..802
e-value: 3.24629E-21
score: 88.4171
NoneNo IPR availableCDDcd18034DEXHc_dicercoord: 286..519
e-value: 7.3498E-39
score: 141.25
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 29..53
e-value: 2.4
score: 17.2
coord: 80..104
e-value: 0.27
score: 20.3
coord: 179..203
e-value: 43.0
score: 7.6
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 31..53
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 82..104
IPR003604Matrin/U1-C-like, C2H2-type zinc fingerSMARTSM00451ZnF_U1_5coord: 225..258
e-value: 0.43
score: 15.1
coord: 77..111
e-value: 0.62
score: 13.9
coord: 176..210
e-value: 0.0065
score: 25.7
coord: 26..60
e-value: 1.0
score: 12.1
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 706..795
e-value: 3.2E-12
score: 56.6
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 679..792
e-value: 2.2E-15
score: 57.0
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 673..835
score: 14.547
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 283..525
e-value: 1.5E-18
score: 77.6
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 294..508
score: 16.256
IPR006935Helicase/UvrB, N-terminalPFAMPF04851ResIIIcoord: 287..438
e-value: 3.1E-15
score: 56.6
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 79..107
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 29..61
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 165..208
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 299..794