Fructose-bisphosphate aldolase

Overview
NameFructose-bisphosphate aldolase
Smed IDSMED30009430
Length (bp)1655
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fructose-bisphosphate aldolase (SMED30009430) t-SNE clustered cells

Violin plots show distribution of expression levels for Fructose-bisphosphate aldolase (SMED30009430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fructose-bisphosphate aldolase (SMED30009430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fructose-bisphosphate aldolase (SMED30009430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
musculature systemSMED30009430SMESG000006056.1 dd_Smed_v6_591_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30009430SMESG000006056.1 dd_Smed_v6_591_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009430SMESG000006056.1 dd_Smed_v6_591_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30009430SMESG000006056.1 dd_Smed_v6_591_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009430SMESG000006056.1 dd_Smed_v4_591_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009430SMESG000006056.1 dd_Smed_v4_881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009430SMESG000006056.1 Contig49270uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009430SMESG000006056.1 Contig49270newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30009430SMESG000006056.1 OX_Smed_1.0.20607ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009430SMESG000006056.1 dd_Smed_v6_591_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30009430SMESG000006056.1 dd_Smed_v6_591_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 491.5 bits (1264), Expect = 1.084e-171
Identity = 243/364 (66.76%), Postives = 285/364 (78.30%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV G+TFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   +  AA  +SLFV+NHAY
Sbjct:    1 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 491.5 bits (1264), Expect = 1.084e-171
Identity = 243/364 (66.76%), Postives = 285/364 (78.30%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV G+TFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   +  AA  +SLFV+NHAY
Sbjct:    1 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 491.5 bits (1264), Expect = 1.084e-171
Identity = 243/364 (66.76%), Postives = 285/364 (78.30%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV G+TFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   +  AA  +SLFV+NHAY
Sbjct:    1 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 491.5 bits (1264), Expect = 1.084e-171
Identity = 243/364 (66.76%), Postives = 285/364 (78.30%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV G+TFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   +  AA  +SLFV+NHAY
Sbjct:    1 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 492.271 bits (1266), Expect = 3.067e-171
Identity = 243/364 (66.76%), Postives = 285/364 (78.30%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV G+TFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   +  AA  +SLFV+NHAY
Sbjct:   55 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 418          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-1 (Fructose-bisphosphate aldolase 1 [Source:UniProtKB/Swiss-Prot;Acc:P54216])

HSP 1 Score: 470.315 bits (1209), Expect = 9.420e-164
Identity = 236/369 (63.96%), Postives = 281/369 (76.15%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQ--NAE---ATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTG-DLKTAAGGKSLFVANHAY 1181
            M  Y+++LT  QEDELR+IA AIV PGKGILAADEST ++ KR  +IG+EN  +NR+ YR LLF+    L  +ISGVI++HET YQK DDG  F  LL+++GIIPGIKVD GVVP+AG+  E TTQGLD L  RCAQYKKDGAQFAKWRCV KI   +PS  A+ E A+ LARYASICQQNG+VPIVEPE+LPDG H L   QK+TE VL+YVY AL +HHV+LEGTLLKPNMVT+GQ+    +T E+  NA+   ATV ALQR VP AV GV FLSGGQSE DAT+NLNAIN+  G+KPW LTFS+GRALQAS L  W GK EN+ AAQ+ L+H A  N  A++GK+TG     AA  +SLFVANH+Y
Sbjct:    1 MASYSQFLTKAQEDELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKISSTTPSVTALKEIASNLARYASICQQNGLVPIVEPEILPDGEHCLARGQKITETVLSYVYHALNEHHVFLEGTLLKPNMVTSGQS----FTGEKPSNADIGLATVTALQRGVPSAVPGVVFLSGGQSEEDATLNLNAINQVSGKKPWALTFSYGRALQASCLAKWAGKDENIAAAQEVLLHRAQVNSLASVGKYTGDASADAAASQSLFVANHSY 365          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-1 (Fructose-bisphosphate aldolase 1 [Source:UniProtKB/Swiss-Prot;Acc:P54216])

HSP 1 Score: 470.315 bits (1209), Expect = 9.420e-164
Identity = 236/369 (63.96%), Postives = 281/369 (76.15%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQ--NAE---ATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTG-DLKTAAGGKSLFVANHAY 1181
            M  Y+++LT  QEDELR+IA AIV PGKGILAADEST ++ KR  +IG+EN  +NR+ YR LLF+    L  +ISGVI++HET YQK DDG  F  LL+++GIIPGIKVD GVVP+AG+  E TTQGLD L  RCAQYKKDGAQFAKWRCV KI   +PS  A+ E A+ LARYASICQQNG+VPIVEPE+LPDG H L   QK+TE VL+YVY AL +HHV+LEGTLLKPNMVT+GQ+    +T E+  NA+   ATV ALQR VP AV GV FLSGGQSE DAT+NLNAIN+  G+KPW LTFS+GRALQAS L  W GK EN+ AAQ+ L+H A  N  A++GK+TG     AA  +SLFVANH+Y
Sbjct:    1 MASYSQFLTKAQEDELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKISSTTPSVTALKEIASNLARYASICQQNGLVPIVEPEILPDGEHCLARGQKITETVLSYVYHALNEHHVFLEGTLLKPNMVTSGQS----FTGEKPSNADIGLATVTALQRGVPSAVPGVVFLSGGQSEEDATLNLNAINQVSGKKPWALTFSYGRALQASCLAKWAGKDENIAAAQEVLLHRAQVNSLASVGKYTGDASADAAASQSLFVANHSY 365          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-2 (Fructose-bisphosphate aldolase 2 [Source:UniProtKB/Swiss-Prot;Acc:P46563])

HSP 1 Score: 458.759 bits (1179), Expect = 2.765e-159
Identity = 237/360 (65.83%), Postives = 267/360 (74.17%), Query Frame = 3
Query:  102 YAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            +   LT  Q+DEL  IA  IV  GKGILAADEST TIGKR   I +ENN  NR+ YR LLF+   +L  HISGVILY ET +Q  D G  F  LL  +GI+PGIK+D GVVPLAG+  E TTQGLD LAER A +KK G  FAKWRCVL IG H+PSH  MLENANVLARYASICQ NG+VPIVEPEVL DG H L  AQKVTEQVLA+VYKALADHHVYLEGTLLKPNMVT GQ+  +K + E    ATV AL+R VP AV G+TFLSGGQSE DAT NLNAIN     KPW LTFS+GRALQASVL+AW GK EN+ AAQ  L+H + ANG A+LGK+ G+    A  +SLFVA H+Y
Sbjct:    8 FKDSLTQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFT-TPNLNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLCDGEHDLARAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTPGQSSASKASHEAIGLATVTALRRGVPAAVPGITFLSGGQSELDATANLNAINSVQLGKPWKLTFSYGRALQASVLKAWGGKDENIAAAQKTLLHRSKANGDASLGKYAGEDAAGAAAESLFVAKHSY 366          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-2 (Fructose-bisphosphate aldolase 2 [Source:UniProtKB/Swiss-Prot;Acc:P46563])

HSP 1 Score: 458.759 bits (1179), Expect = 2.765e-159
Identity = 237/360 (65.83%), Postives = 267/360 (74.17%), Query Frame = 3
Query:  102 YAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            +   LT  Q+DEL  IA  IV  GKGILAADEST TIGKR   I +ENN  NR+ YR LLF+   +L  HISGVILY ET +Q  D G  F  LL  +GI+PGIK+D GVVPLAG+  E TTQGLD LAER A +KK G  FAKWRCVL IG H+PSH  MLENANVLARYASICQ NG+VPIVEPEVL DG H L  AQKVTEQVLA+VYKALADHHVYLEGTLLKPNMVT GQ+  +K + E    ATV AL+R VP AV G+TFLSGGQSE DAT NLNAIN     KPW LTFS+GRALQASVL+AW GK EN+ AAQ  L+H + ANG A+LGK+ G+    A  +SLFVA H+Y
Sbjct:    8 FKDSLTQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFT-TPNLNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLCDGEHDLARAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTPGQSSASKASHEAIGLATVTALRRGVPAAVPGITFLSGGQSELDATANLNAINSVQLGKPWKLTFSYGRALQASVLKAWGGKDENIAAAQKTLLHRSKANGDASLGKYAGEDAAGAAAESLFVAKHSY 366          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-2 (Fructose-bisphosphate aldolase 2 [Source:UniProtKB/Swiss-Prot;Acc:P46563])

HSP 1 Score: 326.25 bits (835), Expect = 5.923e-109
Identity = 165/244 (67.62%), Postives = 183/244 (75.00%), Query Frame = 3
Query:  102 YAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTME 833
            +   LT  Q+DEL  IA  IV  GKGILAADEST TIGKR   I +ENN  NR+ YR LLF+   +L  HISGVILY ET +Q  D G  F  LL  +GI+PGIK+D GVVPLAG+  E TTQGLD LAER A +KK G  FAKWRCVL IG H+PSH  MLENANVLARYASICQ NG+VPIVEPEVL DG H L  AQKVTEQVLA+VYKALADHHVYLEGTLLKPNMVT GQ+  +K + E
Sbjct:    8 FKDSLTQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFT-TPNLNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLCDGEHDLARAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTPGQSSASKASHE 250          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0084995)

HSP 1 Score: 502.286 bits (1292), Expect = 2.868e-176
Identity = 255/363 (70.25%), Postives = 289/363 (79.61%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  Y  Y + E +DELR IA+ IVAPGKGILAADES  T+GKR  +IGVEN  DNR++YR LLFS D  L  +ISGVIL+HETLYQKADDGT F ++LK +GII GIKVD GVVPL GS DEVTTQGLD LA RCAQYKKDG  FAKWRCVLKIG ++PS+Q++LENANVLARYASICQ   IVPIVEPEVLPDG+H L+ AQKVTE VLA VYKAL+DHHVYLEGTLLKPNMVTAGQ+   K T E+ A ATV+AL+RTVP AV GVTFLSGGQSE +AT+NL+AIN     +PW LTFS+GRALQASVL AW GKKEN+ A Q++L+  A ANG AA GK+       AG  SLFVANHAY
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA-KKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVA-GSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0084999)

HSP 1 Score: 502.286 bits (1292), Expect = 2.868e-176
Identity = 255/363 (70.25%), Postives = 289/363 (79.61%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  Y  Y + E +DELR IA+ IVAPGKGILAADES  T+GKR  +IGVEN  DNR++YR LLFS D  L  +ISGVIL+HETLYQKADDGT F ++LK +GII GIKVD GVVPL GS DEVTTQGLD LA RCAQYKKDG  FAKWRCVLKIG ++PS+Q++LENANVLARYASICQ   IVPIVEPEVLPDG+H L+ AQKVTE VLA VYKAL+DHHVYLEGTLLKPNMVTAGQ+   K T E+ A ATV+AL+RTVP AV GVTFLSGGQSE +AT+NL+AIN     +PW LTFS+GRALQASVL AW GKKEN+ A Q++L+  A ANG AA GK+       AG  SLFVANHAY
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA-KKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVA-GSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0084994)

HSP 1 Score: 502.286 bits (1292), Expect = 2.868e-176
Identity = 255/363 (70.25%), Postives = 289/363 (79.61%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  Y  Y + E +DELR IA+ IVAPGKGILAADES  T+GKR  +IGVEN  DNR++YR LLFS D  L  +ISGVIL+HETLYQKADDGT F ++LK +GII GIKVD GVVPL GS DEVTTQGLD LA RCAQYKKDG  FAKWRCVLKIG ++PS+Q++LENANVLARYASICQ   IVPIVEPEVLPDG+H L+ AQKVTE VLA VYKAL+DHHVYLEGTLLKPNMVTAGQ+   K T E+ A ATV+AL+RTVP AV GVTFLSGGQSE +AT+NL+AIN     +PW LTFS+GRALQASVL AW GKKEN+ A Q++L+  A ANG AA GK+       AG  SLFVANHAY
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA-KKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVA-GSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0310660)

HSP 1 Score: 502.286 bits (1292), Expect = 2.868e-176
Identity = 255/363 (70.25%), Postives = 289/363 (79.61%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  Y  Y + E +DELR IA+ IVAPGKGILAADES  T+GKR  +IGVEN  DNR++YR LLFS D  L  +ISGVIL+HETLYQKADDGT F ++LK +GII GIKVD GVVPL GS DEVTTQGLD LA RCAQYKKDG  FAKWRCVLKIG ++PS+Q++LENANVLARYASICQ   IVPIVEPEVLPDG+H L+ AQKVTE VLA VYKAL+DHHVYLEGTLLKPNMVTAGQ+   K T E+ A ATV+AL+RTVP AV GVTFLSGGQSE +AT+NL+AIN     +PW LTFS+GRALQASVL AW GKKEN+ A Q++L+  A ANG AA GK+       AG  SLFVANHAY
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA-KKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVA-GSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0339614)

HSP 1 Score: 502.286 bits (1292), Expect = 2.868e-176
Identity = 255/363 (70.25%), Postives = 289/363 (79.61%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  Y  Y + E +DELR IA+ IVAPGKGILAADES  T+GKR  +IGVEN  DNR++YR LLFS D  L  +ISGVIL+HETLYQKADDGT F ++LK +GII GIKVD GVVPL GS DEVTTQGLD LA RCAQYKKDG  FAKWRCVLKIG ++PS+Q++LENANVLARYASICQ   IVPIVEPEVLPDG+H L+ AQKVTE VLA VYKAL+DHHVYLEGTLLKPNMVTAGQ+   K T E+ A ATV+AL+RTVP AV GVTFLSGGQSE +AT+NL+AIN     +PW LTFS+GRALQASVL AW GKKEN+ A Q++L+  A ANG AA GK+       AG  SLFVANHAY
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA-KKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVA-GSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldocb (aldolase C, fructose-bisphosphate, b [Source:NCBI gene;Acc:369193])

HSP 1 Score: 505.753 bits (1301), Expect = 1.585e-177
Identity = 243/356 (68.26%), Postives = 283/356 (79.49%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LT EQ+ EL+ IA+ IVAPGKGILAADEST ++ KR   IGVEN  +NR+ YR LLFS D+ +   I GVI +HETLYQ  DDGT F +L+KDRGI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG H L+  Q VTE+VLA  YKAL+DHHVYLEGTLLKPNMVTAG +CPTKY+ E+ A ATV AL+RTVPPAV+GVTFLSGGQSE +A++NLN+IN     KPWPLTFS+GRALQAS L AW+G K N KAA ++ +  A ANG AA GK+       A G+SL+VANHAY
Sbjct:    8 LTAEQKKELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFSADERIDKCIGGVIFFHETLYQNTDDGTNFAQLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSCPTKYSSEEIAMATVTALRRTVPPAVSGVTFLSGGQSEEEASVNLNSINNCPLAKPWPLTFSYGRALQASALSAWRGAKSNEKAATEEFIKRAEANGLAAQGKYVSSGTCGAAGQSLYVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldocb (aldolase C, fructose-bisphosphate, b [Source:NCBI gene;Acc:369193])

HSP 1 Score: 505.753 bits (1301), Expect = 1.585e-177
Identity = 243/356 (68.26%), Postives = 283/356 (79.49%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LT EQ+ EL+ IA+ IVAPGKGILAADEST ++ KR   IGVEN  +NR+ YR LLFS D+ +   I GVI +HETLYQ  DDGT F +L+KDRGI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG H L+  Q VTE+VLA  YKAL+DHHVYLEGTLLKPNMVTAG +CPTKY+ E+ A ATV AL+RTVPPAV+GVTFLSGGQSE +A++NLN+IN     KPWPLTFS+GRALQAS L AW+G K N KAA ++ +  A ANG AA GK+       A G+SL+VANHAY
Sbjct:    8 LTAEQKKELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFSADERIDKCIGGVIFFHETLYQNTDDGTNFAQLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSCPTKYSSEEIAMATVTALRRTVPPAVSGVTFLSGGQSEEEASVNLNSINNCPLAKPWPLTFSYGRALQASALSAWRGAKSNEKAATEEFIKRAEANGLAAQGKYVSSGTCGAAGQSLYVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldoab (aldolase a, fructose-bisphosphate, b [Source:ZFIN;Acc:ZDB-GENE-040426-2299])

HSP 1 Score: 490.73 bits (1262), Expect = 1.545e-171
Identity = 240/364 (65.93%), Postives = 288/364 (79.12%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP    +L+ +Q+ EL  IA+ IVAPGKGILAADEST ++ KRF +I  EN  +NR+ YR LLF+ D  +   I GVIL+HETLYQK DDG  F +L+K+RG++ GIKVD GVVPLAG++ E TTQGLDGL ERCAQYKKDGA FAKWRCVLKI P +PS+ A++ENANVLARYASICQ +GIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVTAG +C  KY+ ++ A ATV AL+RTVPPAV G+TFLSGGQSE +A+INL+ IN+    KPW LTFS+GRALQAS L+AW GKKEN KA Q++ +  A  N AAA+GK+     T AA G+SLFVANHAY
Sbjct:    1 MPHAYPFLSPDQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRIKPCIGGVILFHETLYQKTDDGKLFSQLIKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSNLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHSCSHKYSPQEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASINLSTINQCPLSKPWALTFSYGRALQASALKAWGGKKENGKACQEEFVKRAVNNSAAAVGKYVSKGDTGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldoaa (aldolase a, fructose-bisphosphate, a [Source:ZFIN;Acc:ZDB-GENE-030131-8369])

HSP 1 Score: 489.189 bits (1258), Expect = 5.909e-171
Identity = 243/365 (66.58%), Postives = 285/365 (78.08%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKF--TGDLKTAAGGKSLFVANHAY 1181
            MP    +LT EQ+ EL  IA+ IVAPGKGILAADEST ++ KRF +I  EN  +NR+ YR LLF+ D  +   I GVIL+HETLYQK DDG  F   LK+RG++ GIKVD GVVPLAG++ E TTQGLDGL ERCAQYKKDGA FAKWRCVLKI P +PS  A++ENANVLARYASICQ +GIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVTAG  C  K T ++ A ATV AL+RTVPPAV GVTFLSGGQSE +AT+NLNA+N+    +PW LTFS+GRALQAS L+AW GKKEN KA Q++ +  A  N  A +GK+  +GD K AA G+SLFVANHAY
Sbjct:    1 MPHAYPFLTPEQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRVKPCIGGVILFHETLYQKTDDGKVFSDYLKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSRLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHACSQKNTPQEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATLNLNAMNQCPLHRPWALTFSYGRALQASALKAWGGKKENGKACQEEFIKRALNNSQACVGKYVSSGD-KGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldoaa (aldolase a, fructose-bisphosphate, a [Source:ZFIN;Acc:ZDB-GENE-030131-8369])

HSP 1 Score: 489.189 bits (1258), Expect = 5.909e-171
Identity = 243/365 (66.58%), Postives = 285/365 (78.08%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKF--TGDLKTAAGGKSLFVANHAY 1181
            MP    +LT EQ+ EL  IA+ IVAPGKGILAADEST ++ KRF +I  EN  +NR+ YR LLF+ D  +   I GVIL+HETLYQK DDG  F   LK+RG++ GIKVD GVVPLAG++ E TTQGLDGL ERCAQYKKDGA FAKWRCVLKI P +PS  A++ENANVLARYASICQ +GIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVTAG  C  K T ++ A ATV AL+RTVPPAV GVTFLSGGQSE +AT+NLNA+N+    +PW LTFS+GRALQAS L+AW GKKEN KA Q++ +  A  N  A +GK+  +GD K AA G+SLFVANHAY
Sbjct:    1 MPHAYPFLTPEQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRVKPCIGGVILFHETLYQKTDDGKVFSDYLKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSRLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHACSQKNTPQEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATLNLNAMNQCPLHRPWALTFSYGRALQASALKAWGGKKENGKACQEEFIKRALNNSQACVGKYVSSGD-KGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: aldoc (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:407969])

HSP 1 Score: 500.36 bits (1287), Expect = 2.939e-175
Identity = 246/358 (68.72%), Postives = 287/358 (80.17%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKF--TGDLKTAAGGKSLFVANHAY 1181
            L+ EQ+ EL  IA+ IVAPGKGILAADES  ++ KR + IGV+N  +NR+ YR LLF GD+ +   I GVI +HET+YQ+ D GT FVK++KD+GI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A+LENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVTAG  CPTKYT E+ A ATV AL+RTVPPAV GVTFLSGGQSE +ATINLNAIN     +PW LTFS+GRALQAS L AW+GKKEN  AA ++ +  A ANG AALGK+  +GD    A G+SL+VANHAY
Sbjct:    8 LSAEQKKELADIAQKIVAPGKGILAADESVGSMAKRLSGIGVDNIEENRRLYRQLLFKGDERMQECIGGVIFFHETMYQQGDCGTNFVKMIKDKGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHACPTKYTAEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATINLNAINNCPLARPWALTFSYGRALQASALSAWRGKKENEDAATNEFLKRAEANGLAALGKYEQSGD-GCGAAGQSLYVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: aldoc (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:407969])

HSP 1 Score: 480.33 bits (1235), Expect = 2.090e-167
Identity = 239/358 (66.76%), Postives = 280/358 (78.21%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKF--TGDLKTAAGGKSLFVANHAY 1181
            L+ EQ+ EL  IA+ IVAPGKGILAADES  ++ KR + IGV+N  +NR+ YR LLF GD+ +   I GVI +HET+YQ+ D GT FVK++KD+GI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A+LENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+V        +DHHVYLEGTLLKPNMVTAG  CPTKYT E+ A ATV AL+RTVPPAV GVTFLSGGQSE +ATINLNAIN     +PW LTFS+GRALQAS L AW+GKKEN  AA ++ +  A ANG AALGK+  +GD    A G+SL+VANHAY
Sbjct:    8 LSAEQKKELADIAQKIVAPGKGILAADESVGSMAKRLSGIGVDNIEENRRLYRQLLFKGDERMQECIGGVIFFHETMYQQGDCGTNFVKMIKDKGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVSG----CNSDHHVYLEGTLLKPNMVTAGHACPTKYTAEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATINLNAINNCPLARPWALTFSYGRALQASALSAWRGKKENEDAATNEFLKRAEANGLAALGKYEQSGD-GCGAAGQSLYVANHAY 360          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: arfgef2 (ADP ribosylation factor guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-6041969])

HSP 1 Score: 476.863 bits (1226), Expect = 7.953e-166
Identity = 239/366 (65.30%), Postives = 283/366 (77.32%), Query Frame = 3
Query:   87 LNMPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFT-GDLKTAAGGKSLFVANHAY 1181
            + MP     LT EQ+ EL  IA+ IVA GKGILAADEST +I KR ++IG EN  +NR+ YR LLF+ D  +   I GVI +HETLY K+DDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKI  H+PSH A++ENANVLARYASICQQNGIVPIVEPEVLPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  KY  ++ A ATV AL+RTVPPAV G+TFLSGGQSE +AT++LNAIN+    KPWPLTFS+GRALQAS L+AW GKKEN K AQ++ +  A AN  A  GK+       AA G+SLFV+NHAY
Sbjct:    6 VTMPHQYPALTPEQKKELHDIAKRIVATGKGILAADESTGSIAKRLSSIGAENTEENRRLYRQLLFTADDRVNPCIGGVITFHETLYHKSDDGVAFTEVIKKKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISEHTPSHLAIIENANVLARYASICQQNGIVPIVEPEVLPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTKKYPPQEVAMATVTALRRTVPPAVGGITFLSGGQSEEEATVHLNAINQCPLIKPWPLTFSYGRALQASALKAWGGKKENTKKAQEEYVKRALANSLACQGKYVASGEAGAAAGESLFVSNHAY 371          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: arfgef2 (ADP ribosylation factor guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-6041969])

HSP 1 Score: 476.093 bits (1224), Expect = 1.093e-165
Identity = 239/364 (65.66%), Postives = 282/364 (77.47%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFT-GDLKTAAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA+ IVA GKGILAADEST +I KR ++IG EN  +NR+ YR LLF+ D  +   I GVI +HETLY K+DDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKI  H+PSH A++ENANVLARYASICQQNGIVPIVEPEVLPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  KY  ++ A ATV AL+RTVPPAV G+TFLSGGQSE +AT++LNAIN+    KPWPLTFS+GRALQAS L+AW GKKEN K AQ++ +  A AN  A  GK+       AA G+SLFV+NHAY
Sbjct:    1 MPHQYPALTPEQKKELHDIAKRIVATGKGILAADESTGSIAKRLSSIGAENTEENRRLYRQLLFTADDRVNPCIGGVITFHETLYHKSDDGVAFTEVIKKKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISEHTPSHLAIIENANVLARYASICQQNGIVPIVEPEVLPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTKKYPPQEVAMATVTALRRTVPPAVGGITFLSGGQSEEEATVHLNAINQCPLIKPWPLTFSYGRALQASALKAWGGKKENTKKAQEEYVKRALANSLACQGKYVASGEAGAAAGESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: arfgef2 (ADP ribosylation factor guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-6041969])

HSP 1 Score: 477.248 bits (1227), Expect = 2.207e-165
Identity = 239/364 (65.66%), Postives = 282/364 (77.47%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFT-GDLKTAAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA+ IVA GKGILAADEST +I KR ++IG EN  +NR+ YR LLF+ D  +   I GVI +HETLY K+DDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKI  H+PSH A++ENANVLARYASICQQNGIVPIVEPEVLPDG+H L+  Q VTE+VLA VYKAL+DHH+YLEGTLLKPNMVT G  C  KY  ++ A ATV AL+RTVPPAV G+TFLSGGQSE +AT++LNAIN+    KPWPLTFS+GRALQAS L+AW GKKEN K AQ++ +  A AN  A  GK+       AA G+SLFV+NHAY
Sbjct:   50 MPHQYPALTPEQKKELHDIAKRIVATGKGILAADESTGSIAKRLSSIGAENTEENRRLYRQLLFTADDRVNPCIGGVITFHETLYHKSDDGVAFTEVIKKKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISEHTPSHLAIIENANVLARYASICQQNGIVPIVEPEVLPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTKKYPPQEVAMATVTALRRTVPPAVGGITFLSGGQSEEEATVHLNAINQCPLIKPWPLTFSYGRALQASALKAWGGKKENTKKAQEEYVKRALANSLACQGKYVASGEAGAAAGESLFVSNHAY 413          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoa (aldolase A, fructose-bisphosphate [Source:MGI Symbol;Acc:MGI:87994])

HSP 1 Score: 491.886 bits (1265), Expect = 5.791e-172
Identity = 244/364 (67.03%), Postives = 286/364 (78.57%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   ++ AA  +SLF++NHAY
Sbjct:    1 MPHPYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoa (aldolase A, fructose-bisphosphate [Source:MGI Symbol;Acc:MGI:87994])

HSP 1 Score: 491.886 bits (1265), Expect = 5.791e-172
Identity = 244/364 (67.03%), Postives = 286/364 (78.57%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   ++ AA  +SLF++NHAY
Sbjct:    1 MPHPYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoa (aldolase A, fructose-bisphosphate [Source:MGI Symbol;Acc:MGI:87994])

HSP 1 Score: 492.656 bits (1267), Expect = 1.788e-171
Identity = 244/364 (67.03%), Postives = 286/364 (78.57%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            MP     LT EQ+ EL  IA  IVAPGKGILAADEST +I KR  +IG EN  +NR+ YR LL + D  +   I GVIL+HETLYQKADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GKKEN+KAAQ++ +  A AN  A  GK+T   ++ AA  +SLF++NHAY
Sbjct:   55 MPHPYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY 418          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoart1 (aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:MGI:2447811])

HSP 1 Score: 487.263 bits (1253), Expect = 2.779e-170
Identity = 241/364 (66.21%), Postives = 284/364 (78.02%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAA-GGKSLFVANHAY 1181
            MP     LTTEQ+ EL  IA  IVAPGKGILAADES  ++G R  +IG EN  +NR+ +R LL + D  +   I GVIL+HETLY+KADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L   Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GK+EN+KAAQ++ +  A AN  A  GK+T   KT A   +SLF++NHAY
Sbjct:    1 MPCPYPALTTEQKKELSDIAHRIVAPGKGILAADESIGSMGNRLQSIGTENTEENRRFFRQLLLTADDRVNPCIGGVILFHETLYEKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGKHTPSPLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLSCCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKEENLKAAQEEYIKRALANSLACQGKYTPSGKTGATASESLFISNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoart1 (aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:MGI:2447811])

HSP 1 Score: 488.034 bits (1255), Expect = 1.090e-169
Identity = 241/364 (66.21%), Postives = 284/364 (78.02%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAA-GGKSLFVANHAY 1181
            MP     LTTEQ+ EL  IA  IVAPGKGILAADES  ++G R  +IG EN  +NR+ +R LL + D  +   I GVIL+HETLY+KADDG  F +++K +G + GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKIG H+PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L   Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVT G  C  K++ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+INLNAINK    KPW LTFS+GRALQAS L+AW GK+EN+KAAQ++ +  A AN  A  GK+T   KT A   +SLF++NHAY
Sbjct:   56 MPCPYPALTTEQKKELSDIAHRIVAPGKGILAADESIGSMGNRLQSIGTENTEENRRFFRQLLLTADDRVNPCIGGVILFHETLYEKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGKHTPSPLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLSCCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKEENLKAAQEEYIKRALANSLACQGKYTPSGKTGATASESLFISNHAY 419          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|Q9GP32|ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis OX=6211 GN=FBPA PE=2 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 263/363 (72.45%), Postives = 300/363 (82.64%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  +  YL  E+  ELR  A AIVAPGKG+LAADEST TIGKRFA I +EN  +NR++YR LLF+ D     HISGVIL+HET+YQK  DG  FV+LL++RG++PGIKVD GVVPL G+ DE TTQGLD LA+RCAQY  DG +FAKWRCVLKI  H+PS+ AMLENANVLARYA ICQQNG+VPIVEPEVLPDG+H LE AQ+VTEQVL++VYKALADHHVYLEGTLLKPNMVT GQ+C  KY++E NA ATV+ALQRTVP AV GV FLSGGQSE DAT NLNAINKY G+KPW L+FSFGRALQAS + AW+GK ENVKA Q + + LA ANGAA+LGKF G+LKTAAG KSLFVANHAY
Sbjct:    1 MSRFVPYLCAEKMKELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKISSHNPSYLAMLENANVLARYAFICQQNGLVPIVEPEVLPDGDHDLETAQRVTEQVLSFVYKALADHHVYLEGTLLKPNMVTCGQSCTKKYSVEDNARATVEALQRTVPVAVPGVVFLSGGQSELDATRNLNAINKYPGKKPWALSFSFGRALQASAIAAWQGKPENVKAGQAEFLQLAKANGAASLGKFEGELKTAAGQKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|P53442|ALF_SCHMA (Fructose-bisphosphate aldolase OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 266/363 (73.28%), Postives = 299/363 (82.37%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  +  YLT  QE++LR IA+AI APGKGILAADESTAT+GKR   IGVENN +NR+ YR LLFS D  L  +ISGVIL+ ETL+QK+DDG T   LL +R IIPGIKVD GVVPLAG+ +E TTQGLD LA RCA+Y + G +FAKWRCVLKI  H+PS+ AMLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQ+VTEQVLA+VYKALADHHVYLEGTLLKPNMVTAGQ C   YT ++NA ATV+ALQRTVPPAV G+TFLSGGQSE DAT NLN INK  G KPW LTFSFGRALQASVL  WKGKKENV AAQ++L+ LA ANGAAA+GKF G++ T  G KSLFVANHAY
Sbjct:    1 MSRFQPYLTEAQENDLRRIAQAICAPGKGILAADESTATMGKRLQQIGVENNEENRRLYRQLLFSADHKLAENISGVILFEETLHQKSDDGKTLPTLLAERNIIPGIKVDKGVVPLAGTDNETTTQGLDDLASRCAEYWRLGCRFAKWRCVLKISSHTPSYLAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLLTAQRVTEQVLAFVYKALADHHVYLEGTLLKPNMVTAGQACKKAYTPQENALATVRALQRTVPPAVPGITFLSGGQSELDATKNLNEINKIPGPKPWALTFSFGRALQASVLATWKGKKENVHAAQEELLKLAKANGAAAVGKFEGNMGTTLGDKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|P53448|ALDOC_CARAU (Fructose-bisphosphate aldolase C OS=Carassius auratus OX=7957 GN=aldoc PE=2 SV=2)

HSP 1 Score: 507.294 bits (1305), Expect = 2.625e-177
Identity = 245/356 (68.82%), Postives = 286/356 (80.34%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LTTEQ+ EL+ IA+ IVAPGKGILAADEST ++ KR   IGVEN  +NR+ YR LLF+ D+ +   I GVI +HETLYQKADDGT F K++KDRGI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   SPS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA  YKAL+DHHVYLEGTLLKPNMVTAG +CPTK++ ++ A ATV AL+RTVPPAV GVTFLSGGQSE +A+INLNAIN     KPW LTFS+GRALQAS L AW+G KEN KAA ++ +  A ANG AA GK+       + G+SL+VANHAY
Sbjct:    8 LTTEQKRELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFTADERMDKCIGGVIFFHETLYQKADDGTPFAKMIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETSPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSCPTKFSNQEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINNCPLTKPWALTFSYGRALQASALSAWRGVKENEKAATEEFLKRAEANGLAAQGKYVSSGMDGSAGQSLYVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|Q8JH70|ALDCB_DANRE (Fructose-bisphosphate aldolase C-B OS=Danio rerio OX=7955 GN=aldocb PE=2 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 1.196e-176
Identity = 243/356 (68.26%), Postives = 283/356 (79.49%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LT EQ+ EL+ IA+ IVAPGKGILAADEST ++ KR   IGVEN  +NR+ YR LLFS D+ +   I GVI +HETLYQ  DDGT F +L+KDRGI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG H L+  Q VTE+VLA  YKAL+DHHVYLEGTLLKPNMVTAG +CPTKY+ E+ A ATV AL+RTVPPAV+GVTFLSGGQSE +A++NLN+IN     KPWPLTFS+GRALQAS L AW+G K N KAA ++ +  A ANG AA GK+       A G+SL+VANHAY
Sbjct:    8 LTAEQKKELQDIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFSADERIDKCIGGVIFFHETLYQNTDDGTNFAQLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSCPTKYSSEEIAMATVTALRRTVPPAVSGVTFLSGGQSEEEASVNLNSINNCPLAKPWPLTFSYGRALQASALSAWRGAKSNEKAATEEFIKRAEANGLAAQGKYVSSGTCGAAGQSLYVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|P07764|ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster OX=7227 GN=Ald1 PE=1 SV=5)

HSP 1 Score: 502.286 bits (1292), Expect = 2.875e-175
Identity = 255/363 (70.25%), Postives = 289/363 (79.61%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  Y  Y + E +DELR IA+ IVAPGKGILAADES  T+GKR  +IGVEN  DNR++YR LLFS D  L  +ISGVIL+HETLYQKADDGT F ++LK +GII GIKVD GVVPL GS DEVTTQGLD LA RCAQYKKDG  FAKWRCVLKIG ++PS+Q++LENANVLARYASICQ   IVPIVEPEVLPDG+H L+ AQKVTE VLA VYKAL+DHHVYLEGTLLKPNMVTAGQ+   K T E+ A ATV+AL+RTVP AV GVTFLSGGQSE +AT+NL+AIN     +PW LTFS+GRALQASVL AW GKKEN+ A Q++L+  A ANG AA GK+       AG  SLFVANHAY
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA-KKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVA-GSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: G7YM44 (Fructose-bisphosphate aldolase (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_111921 PE=3 SV=1)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 281/371 (75.74%), Postives = 313/371 (84.37%), Query Frame = 3
Query:   69 HQTIQILNMPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            H+   +  M  +A+YL+  Q  ELR IA+AIVAPGKGILAADESTAT+GKR  NIGVEN  ++R+ YR LLFSG      +ISGVIL+HETLYQK DDG   V LLK+R IIPGIKVD GVVPLAGS +E TTQGLDGLAERCAQYKKDG  FAKWRCVLKIGPH+PS+QAMLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQ+ TE+VL++VYKALADHHVYLEGTLLKPNMVTAGQ CP +Y+ EQNA ATV+ALQRTVPPAVAGVTFLSGGQSE DAT NLN INK  GRKPW LTFSFGRALQASVL+ WKGK ENV AAQ++ + LA ANGAAALG+FT ++ TAAG KSLFVANHAY
Sbjct:  503 HEMAHVSIMSRFAEYLSESQMKELREIAQAIVAPGKGILAADESTATMGKRLQNIGVENTEEHRRQYRQLLFSGSPEASKNISGVILFHETLYQKTDDGRPLVALLKERNIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKIGPHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLATAQRATEEVLSFVYKALADHHVYLEGTLLKPNMVTAGQACPKRYSPEQNAIATVEALQRTVPPAVAGVTFLSGGQSELDATKNLNEINKVPGRKPWALTFSFGRALQASVLDVWKGKPENVAAAQEEFLKLAKANGAAALGRFTAEMATAAGDKSLFVANHAY 873          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A1S8X7Q3 (Fructose-bisphosphate aldolase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01353 PE=3 SV=1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 282/363 (77.69%), Postives = 310/363 (85.40%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  +A+YL+  Q  ELR IA+AIVAPGKGILAADESTAT+GKR  NIGVEN  ++R+ YR LLFS +     +ISGVIL+HETLYQK DDG   V LLK+R IIPGIKVD GVVPLAGS +E TTQGLDGLAERCAQYKKDG  FAKWRCVLKIGPH+PS+QAMLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQ+VTE+VL++VYKALADHHVYLEGTLLKPNMVTAGQ CP +YT EQNA ATV+ALQRTVPPAVAGVTFLSGGQSE DAT NLN INK  GRKPW LTFSFGRALQASVL+ WKGK ENV AAQ + + LA ANGAAALG+FT D+ TAAG KSLFVANHAY
Sbjct:    1 MTRFAEYLSESQMKELREIAQAIVAPGKGILAADESTATMGKRLQNIGVENTEEHRRQYRQLLFSSNPEASKNISGVILFHETLYQKTDDGRPLVALLKERNIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKIGPHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLATAQRVTEEVLSFVYKALADHHVYLEGTLLKPNMVTAGQACPKRYTPEQNAVATVEALQRTVPPAVAGVTFLSGGQSELDATKNLNEINKVPGRKPWALTFSFGRALQASVLDVWKGKPENVAAAQGEFLKLAKANGAAALGQFTADMATAAGDKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A419PHW9 (Fructose-bisphosphate aldolase OS=Clonorchis sinensis OX=79923 GN=CSKR_1422s PE=3 SV=1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 280/363 (77.13%), Postives = 310/363 (85.40%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  +A+YL+  Q  ELR IA+AIVAPGKGILAADESTAT+GKR  NIGVEN  ++R+ YR LLFSG      +ISGVIL+HETLYQK DDG   V LLK+R IIPGIKVD GVVPLAGS +E TTQGLDGLAERCAQYKKDG  FAKWRCVLKIGPH+PS+QAMLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQ+ TE+VL++VYKALADHHVYLEGTLLKPNMVTAGQ CP +Y+ EQNA ATV+ALQRTVPPAVAGVTFLSGGQSE DAT NLN INK  GRKPW LTFSFGRALQASVL+ WKGK ENV AAQ++ + LA ANGAAALG+FT ++ TAAG KSLFVANHAY
Sbjct:    1 MSRFAEYLSESQMKELREIAQAIVAPGKGILAADESTATMGKRLQNIGVENTEEHRRQYRQLLFSGSPEASKNISGVILFHETLYQKTDDGRPLVALLKERNIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKIGPHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLATAQRATEEVLSFVYKALADHHVYLEGTLLKPNMVTAGQACPKRYSPEQNAIATVEALQRTVPPAVAGVTFLSGGQSELDATKNLNEINKVPGRKPWALTFSFGRALQASVLDVWKGKPENVAAAQEEFLKLAKANGAAALGRFTAEMATAAGDKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A075AIH6 (Fructose-bisphosphate aldolase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12938 PE=3 SV=1)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 282/363 (77.69%), Postives = 310/363 (85.40%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            M  +A+YL+  Q  ELR IA+AIVAPGKGILAADESTAT+GKR  NIGVEN  ++R+ YR LLFS +     +ISGVIL+HETLYQK DDG   V LLK+R IIPGIKVD GVVPLAGS +E TTQGLDGLAERCAQYKKDG  FAKWRCVLKIGPH+PS+QAMLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQ+VTE+VL++VYKALADHHVYLEGTLLKPNMVTAGQ CP +YT EQNA ATV+ALQRTVPPAVAGVTFLSGGQSE DAT NLN INK  GRKPW LTFSFGRALQASVL+ WKGK ENV AAQ + + LA ANGAAALG+FT D+ TAAG KSLFVANHAY
Sbjct:   32 MTRFAEYLSESQMKELREIAQAIVAPGKGILAADESTATMGKRLQNIGVENTEEHRRQYRQLLFSSNPEASKNISGVILFHETLYQKTDDGRPLVALLKERNIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKIGPHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLATAQRVTEEVLSFVYKALADHHVYLEGTLLKPNMVTAGQACPKRYTPEQNAVATVEALQRTVPPAVAGVTFLSGGQSELDATKNLNEINKVPGRKPWALTFSFGRALQASVLDVWKGKPENVAAAQGEFLKLAKANGAAALGQFTADMATAAGDKSLFVANHAY 394          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A504YE45 (Fructose-bisphosphate aldolase OS=Fasciola gigantica OX=46835 GN=FGIG_07052 PE=3 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 281/363 (77.41%), Postives = 309/363 (85.12%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            MP++ +YLT  Q  ELR IA+AIVAPGKGILAADESTATIGKR  NIGVEN  ++R+ YR LLFS +     +ISGVIL+HETLYQK DDG   V+LLK+R IIPGIKVD GVVPLAGS +E TTQGLDGLAERCAQYKKDG  FAKWRCVLKI  H+PS+QAMLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQKVTEQVLA+VYKALADHHVYLEGTLLKPNMVTAGQ CP KYT ++NA ATV+ALQRTVPPAVAGVTFLSGGQSE  ATINLN INK  GRKPW LTFSFGRALQASVL+ WKG+ +NV AAQ++ + LA ANGAAA G FT D+ TAAG KSLFVANHAY
Sbjct:   79 MPIFGEYLTESQMKELREIAQAIVAPGKGILAADESTATIGKRLQNIGVENTEEHRRQYRQLLFSSNPEAAKNISGVILFHETLYQKTDDGRPLVELLKERHIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKISSHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTAGQGCPQKYTPQENALATVRALQRTVPPAVAGVTFLSGGQSELAATINLNEINKVPGRKPWALTFSFGRALQASVLDVWKGQPQNVAAAQEEFLKLAKANGAAAQGTFTADMATAAGDKSLFVANHAY 441          

HSP 2 Score: 96.2857 bits (238), Expect = 1.564e-17
Identity = 45/65 (69.23%), Postives = 52/65 (80.00%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFS 287
            MP++ +YLT  Q  ELR IA+AIVAPGKGILAADESTATIGKR  NIGVEN  ++R+ YR L FS
Sbjct:    1 MPIFGEYLTESQMKELREIAQAIVAPGKGILAADESTATIGKRLQNIGVENTEEHRRQYRQLRFS 65          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldocb (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:103040804])

HSP 1 Score: 504.212 bits (1297), Expect = 4.919e-177
Identity = 242/356 (67.98%), Postives = 285/356 (80.06%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LT EQ+ EL+ IA+ IVAPGKGILAADEST ++ KR   IGVEN  +NR+ YR LLF+ D+ + + I GVI +HETLYQ ADDGT FVK++KDRGI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG H L+  Q VTE+VLA  YKAL+DHHVYLEGTLLKPNMVTAG +CPTKY+ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+INLNAIN     +PW LTFS+GRALQAS L AW+G ++N KAA ++ +  A ANG A+ GK+       A G+SL+VANHAY
Sbjct:    8 LTPEQKKELQEIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFTADQRIDSCIGGVIFFHETLYQNADDGTPFVKMIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSCPTKYSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINNCPLSRPWALTFSYGRALQASALNAWRGARDNEKAATEEFIKRAEANGLASRGKYVSSGTAGAAGQSLYVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldoaa (aldolase, fructose-bisphosphate A [Source:NCBI gene;Acc:103024532])

HSP 1 Score: 486.493 bits (1251), Expect = 5.165e-170
Identity = 240/365 (65.75%), Postives = 286/365 (78.36%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKF--TGDLKTAAGGKSLFVANHAY 1181
            MP    +LT EQ+ EL   A  IVAPGKGILAADEST ++ KRF +I  EN  +NR+ YR LLF+ D  +   I GVI +HETLYQK DDG  F +L+K+RG++ GIKVD GVVPLAG++ E TTQGLDGL ERCAQYKKDGA FAKWRCVLKI P +PS  A+ ENANVLARYASICQ +GIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL++HHVYLEGTLLKPNMVTAG +C  KY+ ++ A ATV AL+RTVPPAV G+TFLSGGQSE +A++NLNA+N     +PW LTFS+GRALQAS L+AW GKKEN KA Q++ +  A AN AA++GK+   GD K AA G+SLFVANHAY
Sbjct:    1 MPHAYPFLTPEQKKELSDNALKIVAPGKGILAADESTGSVAKRFQSINAENTEENRRFYRQLLFTADDRIKPCIGGVIFFHETLYQKTDDGKLFPQLIKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSSLAIKENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSEHHVYLEGTLLKPNMVTAGHSCSHKYSPQEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASVNLNAMNMCPLHRPWALTFSYGRALQASALKAWGGKKENAKACQEEFVKRALANSAASIGKYASAGD-KGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldoca (fructose-bisphosphate aldolase C-A [Source:NCBI gene;Acc:103030129])

HSP 1 Score: 471.47 bits (1212), Expect = 4.561e-164
Identity = 227/357 (63.59%), Postives = 276/357 (77.31%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTA-AGGKSLFVANHAY 1181
            LTTEQ+ EL  IA  IV+PGKGILAADES  ++GKR   IGVEN  +NR+ +R +LF+ D  + N I GVI +HETLYQ +DDG  FVK++KD+GI  GIKVD GVVPL G++ E TTQGLDGL+ERC+QYKKDGA FAKWRCV+K+   +PS   + ENANVLARYASICQQ+GIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKA+ DHHVYLEGTLLKPNMVT G  CPTKY+ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+ NLNAIN     KPW L+FSFGRALQAS L+ W+G++EN  AA ++ +  A  N  AA GK+ G   ++ A G S ++++HAY
Sbjct:    8 LTTEQKRELHEIALRIVSPGKGILAADESVGSMGKRLNQIGVENTEENRRLFRQVLFTADDRIDNCIGGVIFFHETLYQNSDDGVPFVKMIKDKGITIGIKVDKGVVPLPGTNGETTTQGLDGLSERCSQYKKDGADFAKWRCVMKVSDTTPSQLCITENANVLARYASICQQHGIVPIVEPEILPDGDHDLKRCQFVTERVLAAVYKAMFDHHVYLEGTLLKPNMVTPGHGCPTKYSAEEVAMATVTALRRTVPPAVTGVTFLSGGQSEEEASRNLNAINNCPLVKPWALSFSFGRALQASALKTWRGQRENQSAATEEFIKRAEVNSLAAQGKYCGGGDSSGATGLSHYLSSHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldoca (fructose-bisphosphate aldolase C-A [Source:NCBI gene;Acc:103030129])

HSP 1 Score: 471.47 bits (1212), Expect = 4.561e-164
Identity = 227/357 (63.59%), Postives = 276/357 (77.31%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTA-AGGKSLFVANHAY 1181
            LTTEQ+ EL  IA  IV+PGKGILAADES  ++GKR   IGVEN  +NR+ +R +LF+ D  + N I GVI +HETLYQ +DDG  FVK++KD+GI  GIKVD GVVPL G++ E TTQGLDGL+ERC+QYKKDGA FAKWRCV+K+   +PS   + ENANVLARYASICQQ+GIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKA+ DHHVYLEGTLLKPNMVT G  CPTKY+ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+ NLNAIN     KPW L+FSFGRALQAS L+ W+G++EN  AA ++ +  A  N  AA GK+ G   ++ A G S ++++HAY
Sbjct:    8 LTTEQKRELHEIALRIVSPGKGILAADESVGSMGKRLNQIGVENTEENRRLFRQVLFTADDRIDNCIGGVIFFHETLYQNSDDGVPFVKMIKDKGITIGIKVDKGVVPLPGTNGETTTQGLDGLSERCSQYKKDGADFAKWRCVMKVSDTTPSQLCITENANVLARYASICQQHGIVPIVEPEILPDGDHDLKRCQFVTERVLAAVYKAMFDHHVYLEGTLLKPNMVTPGHGCPTKYSAEEVAMATVTALRRTVPPAVTGVTFLSGGQSEEEASRNLNAINNCPLVKPWALSFSFGRALQASALKTWRGQRENQSAATEEFIKRAEVNSLAAQGKYCGGGDSSGATGLSHYLSSHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldoca (fructose-bisphosphate aldolase C-A [Source:NCBI gene;Acc:103030129])

HSP 1 Score: 455.292 bits (1170), Expect = 3.767e-158
Identity = 216/327 (66.06%), Postives = 258/327 (78.90%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASA 1094
            LTTEQ+ EL  IA  IV+PGKGILAADES  ++GKR   IGVEN  +NR+ +R +LF+ D  + N I GVI +HETLYQ +DDG  FVK++KD+GI  GIKVD GVVPL G++ E TTQGLDGL+ERC+QYKKDGA FAKWRCV+K+   +PS   + ENANVLARYASICQQ+GIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKA+ DHHVYLEGTLLKPNMVT G  CPTKY+ E+ A ATV AL+RTVPPAV GVTFLSGGQSE +A+ NLNAIN     KPW L+FSFGRALQAS L+ W+G++EN  AA ++ +  A A
Sbjct:    8 LTTEQKRELHEIALRIVSPGKGILAADESVGSMGKRLNQIGVENTEENRRLFRQVLFTADDRIDNCIGGVIFFHETLYQNSDDGVPFVKMIKDKGITIGIKVDKGVVPLPGTNGETTTQGLDGLSERCSQYKKDGADFAKWRCVMKVSDTTPSQLCITENANVLARYASICQQHGIVPIVEPEILPDGDHDLKRCQFVTERVLAAVYKAMFDHHVYLEGTLLKPNMVTPGHGCPTKYSAEEVAMATVTALRRTVPPAVTGVTFLSGGQSEEEASRNLNAINNCPLVKPWALSFSFGRALQASALKTWRGQRENQSAATEEFIKRAEA 334          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Sea Lamprey
Match: aldob (aldolase b, fructose-bisphosphate [Source:NCBI gene;Acc:321664])

HSP 1 Score: 462.611 bits (1189), Expect = 2.286e-161
Identity = 231/357 (64.71%), Postives = 274/357 (76.75%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFT-GDLKTAAGGKSLFVANHAY 1181
            LT EQ+ +L  IA+ IV+ GKGILAADEST T+GKR + I VEN  +NR+ YR LLFS D S+   I GVI Y ETLYQK DDGT FVKL+KDRGI+ GIKVD G VPLAG+  E TTQGLDGLAERCA+YKKDGA FAKWRCVLKI  ++PS  A+ ENANVLARYASICQQNG+VPIVEPE+LPDG+H L+  Q VTE+VLA  YKAL+DHHVYLEG+LLKPNMVT GQ    + + ++ A ATV AL+RTVP AV G+TFLSGGQSE DA++NLNAIN+    +PW L+FS+GRALQASVL+AW G   N+ AA+ +    A+ NG AA GK+       +A  +SLFVANH Y
Sbjct:    8 LTPEQKKDLAEIAQRIVSTGKGILAADESTGTMGKRLSAIKVENVEENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAATYKALSDHHVYLEGSLLKPNMVTVGQASKIRCSPQEVAMATVTALRRTVPSAVPGITFLSGGQSEEDASLNLNAINRVPLERPWALSFSYGRALQASVLKAWAGNPANIPAAKKEFEKRAAINGLAAQGKYVPAGSSGSAASESLFVANHNY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Sea Lamprey
Match: aldoaa (aldolase a, fructose-bisphosphate, a [Source:ZFIN;Acc:ZDB-GENE-030131-8369])

HSP 1 Score: 417.157 bits (1071), Expect = 1.902e-143
Identity = 218/370 (58.92%), Postives = 264/370 (71.35%), Query Frame = 3
Query:   90 NMPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGL-----DGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKT-AAGGKSLFVANHAY 1181
            NM  +   LT +Q+ EL  IA+ IVA GKGILAADES  T+GKR   IG+EN  ++R+ YR LLF+ D S+   I G+I +HETLYQK+D G  FVKL+KD GI+ GIKVD GVVPLAG++ E TTQ L     +G+A RC   ++D +      C     PH P    +     V  + A  CQQNG+VPIVEPE+LPDG+H L+  Q +TE+VLA  YKAL+DHHVYLEGTLLKPNMVTAG  C TKYT EQ   AT+ AL+RTVPPAV G+TFLSGGQSE DA+I+LNAINK H  KPW LTFS+GRALQASVL+AW GKKEN+KAAQD+LM  A  NG A+ G++     + AA G+SLFVANHAY
Sbjct:    3 NMSPHFPALTPDQKKELADIAQRIVASGKGILAADESVGTMGKRLTQIGLENTDEHRRFYRQLLFTTDPSIKESIGGIIFFHETLYQKSDSGVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQALAVNVGEGVA-RCGLRRRDASSSPMATC-----PHFPKSIKLEYGTGVDQQGAFSCQQNGLVPIVEPEILPDGDHDLKTCQYITEKVLAATYKALSDHHVYLEGTLLKPNMVTAGHACATKYTPEQVGMATLTALRRTVPPAVPGITFLSGGQSEEDASIHLNAINKLHLIKPWALTFSYGRALQASVLKAWGGKKENLKAAQDELMRRAKINGQASKGEYKPIAGSGAAAGESLFVANHAY 366          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Nematostella
Match: EDO37672 (Fructose-bisphosphate aldolase [Source:UniProtKB/TrEMBL;Acc:A7SF13])

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 260/357 (72.83%), Postives = 294/357 (82.35%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSH-DEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LT E + EL+ IAEAIVA GKGILAADEST T+GKR ANIGVEN  +NR+ YR LLF+  K + N ISGVIL+HET+YQKADDGT FV+LL+D+GIIPGIKVD GVV LAG+   E TTQGLDGL ERCAQYKKDG  FAKWRCVLKI  ++PS  AM ENANVLARYASICQQNG+VPIVEPEVL DG+HTLE AQKVTE VL+  YKAL DHH+YLEGTLLKPNMVTAGQ+CPTKYT EQ A+ATV AL RTVPPA+ GVTFLSGGQSE  ATI+LNAIN+Y G+KPW LTFSFGRALQAS L+AW GK   VKA Q++ +  A ANG AA+GK+ G  ++ AG +SLFVANH Y
Sbjct:    5 LTPELKAELKRIAEAIVADGKGILAADESTGTMGKRLANIGVENTEENRRLYRQLLFTSGKEMSNAISGVILFHETVYQKADDGTPFVRLLRDQGIIPGIKVDKGVVVLAGTDAGETTTQGLDGLGERCAQYKKDGCDFAKWRCVLKITDYTPSELAMKENANVLARYASICQQNGLVPIVEPEVLCDGDHTLERAQKVTEAVLSATYKALMDHHIYLEGTLLKPNMVTAGQSCPTKYTPEQCAQATVTALARTVPPAMPGVTFLSGGQSEEQATIHLNAINQYQGKKPWKLTFSFGRALQASALKAWSGKSGCVKAGQEEFLKRAKANGQAAMGKYAGG-QSLAGDQSLFVANHQY 360          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Nematostella
Match: EDO28958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T505])

HSP 1 Score: 92.0485 bits (227), Expect = 8.502e-23
Identity = 47/82 (57.32%), Postives = 59/82 (71.95%), Query Frame = 3
Query:  936 INLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            +N NA+ K    KPW LTFSFGRALQAS L+AW GK + VKA Q++ +  A ANG AA+GK+ G  ++ AG +SLFVANH Y
Sbjct:    1 MNTNAVYKCIIIKPWKLTFSFGRALQASALKAWSGKSDCVKAGQEEFLKRAKANGQAAMGKYAGG-QSLAGDQSLFVANHQY 81          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldocb (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:100049250])

HSP 1 Score: 500.745 bits (1288), Expect = 3.663e-174
Identity = 243/356 (68.26%), Postives = 285/356 (80.06%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LTTEQ+ EL+ IA+ IVAPGKGILAADEST ++ KR   IGVEN  +NR+ YR LLF+ D+ + + I GVI +HETLYQK DDG  F KL+KDRGI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVT G +CPTKY+ ++ A ATV AL+RTVPPAV GVTFLSGGQSE +A++NLNAIN     KPW LTFS+GRALQAS L AWKG+  N KAA ++ +  A ANG AALGK+      +A  +SL+VANHAY
Sbjct:  100 LTTEQKKELQEIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRRYRQLLFTADQRIDSCIGGVIFFHETLYQKTDDGIPFAKLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHSCPTKYSNQEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASVNLNAINTCPLLKPWALTFSYGRALQASALSAWKGELSNEKAATEEFIKRAEANGLAALGKYASSGSGSAASQSLYVANHAY 455          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldocb (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:100049250])

HSP 1 Score: 498.434 bits (1282), Expect = 6.397e-174
Identity = 243/356 (68.26%), Postives = 285/356 (80.06%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            LTTEQ+ EL+ IA+ IVAPGKGILAADEST ++ KR   IGVEN  +NR+ YR LLF+ D+ + + I GVI +HETLYQK DDG  F KL+KDRGI+ GIKVD GVVPLAG++ E TTQGLDGL+ERCAQYKKDGA FAKWR VLKI   +PS  A++ENANVLARYASICQQNGIVPIVEPE+LPDG+H L+  Q VTE+VLA VYKAL+DHHVYLEGTLLKPNMVT G +CPTKY+ ++ A ATV AL+RTVPPAV GVTFLSGGQSE +A++NLNAIN     KPW LTFS+GRALQAS L AWKG+  N KAA ++ +  A ANG AALGK+      +A  +SL+VANHAY
Sbjct:   58 LTTEQKKELQEIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRRYRQLLFTADQRIDSCIGGVIFFHETLYQKTDDGIPFAKLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHSCPTKYSNQEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASVNLNAINTCPLLKPWALTFSYGRALQASALSAWKGELSNEKAATEEFIKRAEANGLAALGKYASSGSGSAASQSLYVANHAY 413          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldoa (fructose-bisphosphate aldolase A [Source:NCBI gene;Acc:100049249])

HSP 1 Score: 493.041 bits (1268), Expect = 1.314e-172
Identity = 237/363 (65.29%), Postives = 286/363 (78.79%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            MP    +LT EQ+ EL  IA+ IVAPGKGILAADEST ++ KRF +I  EN  +NR+ YR LLF+ D  +   I GVIL+HET+YQK DDG  F + LK+RG++ GIKVD GVVPLAG++ E TTQGLDGL ERCAQYKKDGA FAKWR VLKI P +PSH A++ENANVLARYASICQ +GIVPIVEPE+LPDG+H L+  Q +TE+VLA VYKAL+DHHVYLEGTLLKPNMVTAG +C  KY  ++ A +TV AL+RTVPPAV G+TFLSGGQSE +AT+NLN++N+    +PW LTFS+GRALQAS L+AW GKKEN KA Q++ +  A AN  A +GK+     +AAGG+SLFVANHAY
Sbjct:    1 MPHAYPFLTPEQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRITPCIGGVILFHETMYQKTDDGKPFPQYLKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRSVLKITPTTPSHLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYITEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHSCSHKYNSQEIAMSTVTALRRTVPPAVPGITFLSGGQSEEEATVNLNSMNQCPLHRPWALTFSYGRALQASALKAWGGKKENGKACQEEFVKRALANSQACVGKYVSSGASAAGGESLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldoca (fructose-bisphosphate aldolase C [Source:NCBI gene;Acc:101163920])

HSP 1 Score: 468.774 bits (1205), Expect = 5.422e-163
Identity = 221/356 (62.08%), Postives = 275/356 (77.25%), Query Frame = 3
Query:  114 LTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            L+  Q+ +LR  A  IV+PGKGILAADES  ++ KR A +GVEN  +NR+ +R +LFS D  + + I GVI +HETLYQ +D G +FVK+++DRGI+ G+KVD GVVPL G+  E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKI   +PS  A++ENANVLARY+SICQQ+GIVP++EPE+LPDG+H L+  Q VTE+VL  VYKA++DHHVYLEGTLLKPNMVTAG +CPTKYT E+ A ATV A++RTVPPAVAG+ FLSGGQSE +AT++LNAIN     KPW LTFSFGRALQAS L AW+G +EN KAA +Q +  A AN  A  GK+T        G+ ++ + +AY
Sbjct:    8 LSEVQKRDLRETALRIVSPGKGILAADESVGSMAKRLAQVGVENTEENRRQFRQILFSADDRINSCIGGVIFFHETLYQHSDSGVSFVKMIRDRGIMIGVKVDKGVVPLPGTCGETTTQGLDGLSERCAQYKKDGAVFAKWRCVLKISEANPSKLAIMENANVLARYSSICQQHGIVPVIEPEILPDGDHDLKRCQYVTEKVLTAVYKAMSDHHVYLEGTLLKPNMVTAGHSCPTKYTPEEVAMATVTAMRRTVPPAVAGIAFLSGGQSEEEATVHLNAINNCPLPKPWILTFSFGRALQASALRAWRGHQENQKAATEQFIKRAEANSLACQGKYTAGDNHGDAGQRVYGSCYAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldoca (fructose-bisphosphate aldolase C [Source:NCBI gene;Acc:101163920])

HSP 1 Score: 455.292 bits (1170), Expect = 1.706e-157
Identity = 216/350 (61.71%), Postives = 271/350 (77.43%), Query Frame = 3
Query:   48 ICYVTSYHQTIQILN---MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLA 1088
            +C    + QT ++++   M +    L+  Q+ +LR  A  IV+PGKGILAADES  ++ KR A +GVEN  +NR+ +R +LFS D  + + I GVI +HETLYQ +D G +FVK+++DRGI+ G+KVD GVVPL G+  E TTQGLDGL+ERCAQYKKDGA FAKWRCVLKI   +PS  A++ENANVLARY+SICQQ+GIVP++EPE+LPDG+H L+  Q VTE+VL  VYKA++DHHVYLEGTLLKPNMVTAG +CPTKYT E+ A ATV A++RTVPPAVAG+ FLSGGQSE +AT++LNAIN     KPW LTFSFGRALQAS L AW+G +EN KAA +Q +  A
Sbjct:   25 LCRRHFHSQTRRLVDTSSMTLQFPTLSEVQKRDLRETALRIVSPGKGILAADESVGSMAKRLAQVGVENTEENRRQFRQILFSADDRINSCIGGVIFFHETLYQHSDSGVSFVKMIRDRGIMIGVKVDKGVVPLPGTCGETTTQGLDGLSERCAQYKKDGAVFAKWRCVLKISEANPSKLAIMENANVLARYSSICQQHGIVPVIEPEILPDGDHDLKRCQYVTEKVLTAVYKAMSDHHVYLEGTLLKPNMVTAGHSCPTKYTPEEVAMATVTAMRRTVPPAVAGIAFLSGGQSEEEATVHLNAINNCPLPKPWILTFSFGRALQASALRAWRGHQENQKAATEQFIKRA 374          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000006056.1 (SMESG000006056.1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 363/363 (100.00%), Postives = 363/363 (100.00%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY
Sbjct:    1 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000027545.1 (SMESG000027545.1)

HSP 1 Score: 507.294 bits (1305), Expect = 2.742e-178
Identity = 247/363 (68.04%), Postives = 283/363 (77.96%), Query Frame = 3
Query:   93 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            MP +A YL+ E++ ELR  A AI  PGKG+LAADEST TIG RF +I +ENN +NR++YR LLFS D  L  +ISGVI++HE+ YQK D G  F KLL+++GIIPGIKVD GVV LAGS DE TTQGLD L ERCA Y  DGA+FAKWRCVLKIGP +PS Q+MLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQKVTEQVLA+ Y AL+ H+VYLEGTLLKPNMVTAG  CP KY   +NA ATV ALQRTVP AV GV FLSGGQSE +AT+NLNAIN    ++PW LTFSFGRALQ SVL+ W+GK ENVKAAQ QL+HLA  NG A+LGK+    +      SLFV  H Y
Sbjct:    1 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDELGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVAS-ENQGDTTSLFVEKHVY 362          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000034563.1 (SMESG000034563.1)

HSP 1 Score: 149.828 bits (377), Expect = 3.833e-42
Identity = 98/235 (41.70%), Postives = 129/235 (54.89%), Query Frame = 3
Query:  477 DGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            +GL ERCA YKKDG  FAKWR VLKIG H+PS+ AMLENANVLARYA ICQ+NG+VPIVEPEVLPDG H L  AQK    ++ Y+ K    + ++   +LL+ N                         +  +PP++  +  L+  Q+        + I K+ G+               +V+ A   + E +K AQ        ANGAA++G+F G L T AG +SLFVANHAY
Sbjct:   20 NGLDERCAIYKKDGCHFAKWRSVLKIGQHNPSYLAMLENANVLARYAMICQKNGLVPIVEPEVLPDGTHDLFTAQK----IIIYILKVPYLNQIW---SLLECN-----------------------RQENIMPPSI--LMQLTDIQA--------SVIQKWKGK-------------MENVIPA---QMELLKLAQ--------ANGAASMGRFEGVLDTTAGAQSLFVANHAY 190          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000034563.1 (SMESG000034563.1)

HSP 1 Score: 135.191 bits (339), Expect = 9.999e-37
Identity = 63/81 (77.78%), Postives = 68/81 (83.95%), Query Frame = 3
Query:  477 DGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQV 719
            +GL ERCA YKKDG  FAKWR VLKIG H+PS+ AMLENANVLARYA ICQ+NG+VPIVEPEVLPDG H L  AQKVTE V
Sbjct:   20 NGLDERCAIYKKDGCHFAKWRSVLKIGQHNPSYLAMLENANVLARYAMICQKNGLVPIVEPEVLPDGTHDLFTAQKVTEDV 100          

HSP 2 Score: 78.5666 bits (192), Expect = 1.241e-16
Identity = 37/58 (63.79%), Postives = 46/58 (79.31%), Query Frame = 3
Query: 1008 LQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            +QASV++ WKGK ENV  AQ +L+ LA ANGAA++G+F G L T AG +SLFVANHAY
Sbjct:  130 IQASVIQKWKGKMENVIPAQMELLKLAQANGAASMGRFEGVLDTTAGAQSLFVANHAY 187          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000034563.1 (SMESG000034563.1)

HSP 1 Score: 130.954 bits (328), Expect = 3.117e-35
Identity = 61/86 (70.93%), Postives = 68/86 (79.07%), Query Frame = 3
Query:  477 DGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVY 734
            +GL ERCA YKKDG  FAKWR VLKIG H+PS+ AMLENANVLARYA ICQ+NG+VPIVEPEVLPDG H L  AQK+   +L   Y
Sbjct:   19 NGLDERCAIYKKDGCHFAKWRSVLKIGQHNPSYLAMLENANVLARYAMICQKNGLVPIVEPEVLPDGTHDLFTAQKIIIYILKVPY 104          

HSP 2 Score: 78.5666 bits (192), Expect = 1.122e-16
Identity = 37/58 (63.79%), Postives = 46/58 (79.31%), Query Frame = 3
Query: 1008 LQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 1181
            +QASV++ WKGK ENV  AQ +L+ LA ANGAA++G+F G L T AG +SLFVANHAY
Sbjct:  132 IQASVIQKWKGKMENVIPAQMELLKLAQANGAASMGRFEGVLDTTAGAQSLFVANHAY 189          
The following BLAST results are available for this feature:
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALDOA1.084e-17166.76aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
ALDOA1.084e-17166.76aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
ALDOA1.084e-17166.76aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
ALDOA1.084e-17166.76aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
ALDOA3.067e-17166.76aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldo-19.420e-16463.96Fructose-bisphosphate aldolase 1 [Source:UniProtK... [more]
aldo-19.420e-16463.96Fructose-bisphosphate aldolase 1 [Source:UniProtK... [more]
aldo-22.765e-15965.83Fructose-bisphosphate aldolase 2 [Source:UniProtK... [more]
aldo-22.765e-15965.83Fructose-bisphosphate aldolase 2 [Source:UniProtK... [more]
aldo-25.923e-10967.62Fructose-bisphosphate aldolase 2 [Source:UniProtK... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ald12.868e-17670.25gene:FBgn0000064 transcript:FBtr0084995[more]
Ald12.868e-17670.25gene:FBgn0000064 transcript:FBtr0084999[more]
Ald12.868e-17670.25gene:FBgn0000064 transcript:FBtr0084994[more]
Ald12.868e-17670.25gene:FBgn0000064 transcript:FBtr0310660[more]
Ald12.868e-17670.25gene:FBgn0000064 transcript:FBtr0339614[more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldocb1.585e-17768.26aldolase C, fructose-bisphosphate, b [Source:NCBI ... [more]
aldocb1.585e-17768.26aldolase C, fructose-bisphosphate, b [Source:NCBI ... [more]
aldoab1.545e-17165.93aldolase a, fructose-bisphosphate, b [Source:ZFIN;... [more]
aldoaa5.909e-17166.58aldolase a, fructose-bisphosphate, a [Source:ZFIN;... [more]
aldoaa5.909e-17166.58aldolase a, fructose-bisphosphate, a [Source:ZFIN;... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldoc2.939e-17568.72aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldoc2.090e-16766.76aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
arfgef27.953e-16665.30ADP ribosylation factor guanine nucleotide exchang... [more]
arfgef21.093e-16565.66ADP ribosylation factor guanine nucleotide exchang... [more]
arfgef22.207e-16565.66ADP ribosylation factor guanine nucleotide exchang... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldoa5.791e-17267.03aldolase A, fructose-bisphosphate [Source:MGI Symb... [more]
Aldoa5.791e-17267.03aldolase A, fructose-bisphosphate [Source:MGI Symb... [more]
Aldoa1.788e-17167.03aldolase A, fructose-bisphosphate [Source:MGI Symb... [more]
Aldoart12.779e-17066.21aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:M... [more]
Aldoart11.090e-16966.21aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GP32|ALF_ECHMU0.000e+072.45Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]
sp|P53442|ALF_SCHMA0.000e+073.28Fructose-bisphosphate aldolase OS=Schistosoma mans... [more]
sp|P53448|ALDOC_CARAU2.625e-17768.82Fructose-bisphosphate aldolase C OS=Carassius aura... [more]
sp|Q8JH70|ALDCB_DANRE1.196e-17668.26Fructose-bisphosphate aldolase C-B OS=Danio rerio ... [more]
sp|P07764|ALF_DROME2.875e-17570.25Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YM440.000e+075.74Fructose-bisphosphate aldolase (Fragment) OS=Clono... [more]
A0A1S8X7Q30.000e+077.69Fructose-bisphosphate aldolase (Fragment) OS=Opist... [more]
A0A419PHW90.000e+077.13Fructose-bisphosphate aldolase OS=Clonorchis sinen... [more]
A0A075AIH60.000e+077.69Fructose-bisphosphate aldolase (Fragment) OS=Opist... [more]
A0A504YE451.564e-1777.41Fructose-bisphosphate aldolase OS=Fasciola giganti... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldocb4.919e-17767.98aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldoaa5.165e-17065.75aldolase, fructose-bisphosphate A [Source:NCBI gen... [more]
aldoca4.561e-16463.59fructose-bisphosphate aldolase C-A [Source:NCBI ge... [more]
aldoca4.561e-16463.59fructose-bisphosphate aldolase C-A [Source:NCBI ge... [more]
aldoca3.767e-15866.06fructose-bisphosphate aldolase C-A [Source:NCBI ge... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aldob2.286e-16164.71aldolase b, fructose-bisphosphate [Source:NCBI gen... [more]
aldoaa1.902e-14358.92aldolase a, fructose-bisphosphate, a [Source:ZFIN;... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO376720.000e+072.83Fructose-bisphosphate aldolase [Source:UniProtKB/... [more]
EDO289588.502e-2357.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldocb3.663e-17468.26aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldocb6.397e-17468.26aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldoa1.314e-17265.29fructose-bisphosphate aldolase A [Source:NCBI gene... [more]
aldoca5.422e-16362.08fructose-bisphosphate aldolase C [Source:NCBI gene... [more]
aldoca1.706e-15761.71fructose-bisphosphate aldolase C [Source:NCBI gene... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006056.10.000e+0100.00SMESG000006056.1[more]
SMESG000027545.12.742e-17868.04SMESG000027545.1[more]
SMESG000034563.13.833e-4241.70SMESG000034563.1[more]
SMESG000034563.19.999e-3777.78SMESG000034563.1[more]
SMESG000034563.13.117e-3570.93SMESG000034563.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009430 ID=SMED30009430|Name=Fructose-bisphosphate aldolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1655bp
GTTTGTTTTAATAAATAATGTTTATATTTAAAAATATATATAAGGCGATT
TGTTACGTGACCTCATATCATCAAACAATTCAAATTCTAAATATGCCAGT
TTATGCTAAGTATTTGACAACAGAACAGGAGGATGAATTGCGAGCAATTG
CTGAGGCGATTGTAGCACCTGGTAAAGGAATTCTAGCAGCTGACGAAAGC
ACAGCCACTATTGGAAAAAGATTTGCTAACATTGGAGTTGAAAATAACGT
AGATAACAGAAAAAGTTACAGACATTTACTTTTCTCTGGTGACAAATCAC
TAGGAAATCATATTTCTGGAGTTATTTTATATCATGAAACTCTTTATCAA
AAAGCCGATGATGGTACTACATTTGTTAAACTACTGAAAGATAGAGGTAT
TATTCCTGGAATCAAAGTTGATAGTGGTGTAGTGCCATTGGCTGGTTCTC
ATGATGAAGTTACTACACAAGGTTTAGATGGATTAGCCGAAAGATGTGCA
CAGTATAAAAAAGATGGAGCTCAATTCGCTAAATGGAGATGTGTTTTAAA
AATTGGACCTCATTCACCTAGCCATCAAGCTATGTTAGAGAATGCAAACG
TTTTAGCAAGATATGCTTCCATTTGTCAGCAGAATGGAATTGTTCCAATT
GTTGAACCAGAAGTTTTACCAGATGGTAATCATACATTGGAAGAAGCTCA
GAAAGTAACCGAACAAGTCTTGGCATATGTATACAAAGCTTTAGCTGACC
ATCATGTTTATTTGGAAGGTACTTTATTAAAACCAAATATGGTCACTGCA
GGTCAAACTTGTCCCACAAAATACACTATGGAGCAAAACGCTGAAGCAAC
AGTAAAAGCTTTACAACGCACAGTACCACCGGCCGTTGCTGGTGTTACAT
TTTTGTCAGGTGGTCAATCAGAATCGGACGCTACAATTAATTTAAATGCT
ATTAATAAATACCACGGTCGAAAACCGTGGCCTCTTACTTTTAGCTTTGG
TAGAGCTTTACAAGCTTCAGTTTTAGAGGCGTGGAAAGGTAAAAAGGAAA
ATGTAAAAGCAGCACAAGACCAATTAATGCACTTGGCTTCGGCAAATGGC
GCTGCGGCACTTGGAAAGTTTACGGGAGATTTGAAAACCGCAGCCGGTGG
AAAAAGTCTTTTCGTTGCAAATCATGCTTATTAGATATTTCTTAGTTTTA
TTTATCCGACTTTGAACTGTCCCAACTGGTTTAAGTTTCATTTTAGATGT
AGTTTTTGCCACAACAAATATATATATTATATTATTTCAGTTGTAATTTT
CCTTGAATTATTTATACATTAAACGCGTACAATCGTGATCTTTCATAAAT
ATTTGTGTAAGCCTGTGTGTTATTTATAAACATAATCGATTTGTTGTTTG
TGATATTTATTCAATGTGTTTCAATTATCGAATGTCAAATTAAATTTATT
TCTTTAGTTTTAGAAAAAAAGATTCAAATGAGTTCTGAATTTAATTCAAA
TTATTTCTTTGGACCGTTTGATCGATAACAAAATATTTGCACTTAATTGA
TTGCAACATGACATCAATGCTAGGTCAATTTTGAGCCGTATTATATCACA
ATGTTATTTAGCTTTATATTTTGAGAATTTAATAATTGTGTATCATATTC
TGATG
back to top

protein sequence of SMED30009430-orf-1

>SMED30009430-orf-1 ID=SMED30009430-orf-1|Name=SMED30009430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
MFIFKNIYKAICYVTSYHQTIQILNMPVYAKYLTTEQEDELRAIAEAIVA
PGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHIS
GVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTT
QGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYA
SICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLE
GTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQ
SESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQ
DQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0000484secretory system
Vocabulary: INTERPRO
TermDefinition
IPR013785Aldolase_TIM
IPR000741FBA_I
IPR029768Aldolase_I_AS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004332fructose-bisphosphate aldolase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000741Fructose-bisphosphate aldolase, class-IPFAMPF00274Glycolyticcoord: 40..388
e-value: 2.7E-180
score: 598.6
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 27..388
e-value: 3.9E-178
score: 593.5
NoneNo IPR availablePANTHERPTHR11627:SF3FRUCTOSE-BISPHOSPHATE ALDOLASE Ccoord: 34..388
NoneNo IPR availablePANTHERPTHR11627FRUCTOSE-BISPHOSPHATE ALDOLASEcoord: 34..388
NoneNo IPR availableCDDcd00948FBP_aldolase_I_acoord: 38..368
e-value: 0.0
score: 623.887
NoneNo IPR availableSUPERFAMILYSSF51569Aldolasecoord: 30..388
IPR029768Fructose-bisphosphate aldolase class-I active sitePROSITEPS00158ALDOLASE_CLASS_Icoord: 247..257