Pogo transposable element with KRAB

Overview
NamePogo transposable element with KRAB
Smed IDSMED30009416
Length (bp)1278
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pogo transposable element with KRAB (SMED30009416) t-SNE clustered cells

Violin plots show distribution of expression levels for Pogo transposable element with KRAB (SMED30009416) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pogo transposable element with KRAB (SMED30009416) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pogo transposable element with KRAB (SMED30009416) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009416

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30009416 dd_Smed_v4_12259_2_2dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30009416 dd_Smed_v4_12259_2_2dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30009416 dd_Smed_v4_12259_2_2dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pogo transposable element with KRAB vs. TrEMBL
Match: A0A0B1PG56 (Centromere binding protein B, DNA binding protein OS=Trichuris suis OX=68888 GN=D918_08811 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.130e-27
Identity = 48/109 (44.04%), Postives = 62/109 (56.88%), Query Frame = 2
Query:  146 QHDKTCFECGPTMAR-RLL*SFRQKMLEI*KYTVGAYKFKDTIFK*IFHQHAQAFIVRKSENTNLFIKLAQQFHISLGKLVASQHWVDGFLARNELSLRRSTTLFKLHD 469
            Q+DK C + G   A+ R   S RQ +           + +D I + I  + AQAFIVR+S+     ++ A    IS  K  ASQHW+D FL R+ELSLRRSTTLFKL D
Sbjct:   45 QYDKLCEKMGEGSAKKRKCGSGRQPLFP---------ELEDIICEWIADRRAQAFIVRRSDVQAFALETASHLEISTEKFKASQHWLDSFLQRHELSLRRSTTLFKLED 144          

HSP 2 Score: 75.485 bits (184), Expect = 3.130e-27
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 1
Query:  484 KRTLSFKSFIDHLNFTQYQL*NIIPMDETSIFFGQATQKTIDCRG*G----------STIVICILAINCSVRKLPPMLITKRK----SRVSSFAIN 729
            KR L+FKSF+  ++F++YQL ++I MDET++F GQ  Q TID +G            S  V CILAI    +K PP++ITK K     RVS   I+
Sbjct:  149 KRALAFKSFVGRIDFSKYQLFHMIAMDETAVFMGQGFQTTIDRKGASSIYIPSTGYESARVTCILAIRLDGKKAPPLIITKGKKNEIERVSERRID 244          
BLAST of Pogo transposable element with KRAB vs. TrEMBL
Match: A0A085MY47 (HTH CENPB-type domain-containing protein OS=Trichuris suis OX=68888 GN=M514_25628 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.999e-27
Identity = 48/109 (44.04%), Postives = 62/109 (56.88%), Query Frame = 2
Query:  146 QHDKTCFECGPTMAR-RLL*SFRQKMLEI*KYTVGAYKFKDTIFK*IFHQHAQAFIVRKSENTNLFIKLAQQFHISLGKLVASQHWVDGFLARNELSLRRSTTLFKLHD 469
            Q+DK C + G   A+ R   S RQ +           + +D I + I  + AQAFIVR+S+     ++ A    IS  K  ASQHW+D FL R+ELSLRRSTTLFKL D
Sbjct:   91 QYDKLCEKMGEGSAKKRKCGSGRQPLFP---------ELEDIICEWIADRRAQAFIVRRSDVQAFALETASHLEISTEKFKASQHWLDSFLQRHELSLRRSTTLFKLED 190          

HSP 2 Score: 75.0998 bits (183), Expect = 3.999e-27
Identity = 42/96 (43.75%), Postives = 57/96 (59.38%), Query Frame = 1
Query:  484 KRTLSFKSFIDHLNFTQYQL*NIIPMDETSIFFGQATQKTIDCRG*G----------STIVICILAINCSVRKLPPMLITKRK----SRVSSFAIN 729
            KR L+FKSF+  ++F++YQL ++I MDET++F GQ  Q TID +G            S  V CILAI    +K PP++ITK K     RVS   I+
Sbjct:  195 KRALAFKSFVGRIDFSKYQLFHMIAMDETAVFMGQGFQTTIDRKGASSIYIPSTGYESARVTCILAIRLDGKKAPPLIITKGKKNEIERVSERRID 290          
BLAST of Pogo transposable element with KRAB vs. TrEMBL
Match: A0A087T2U5 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_03396 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 7.789e-25
Identity = 41/113 (36.28%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  484 KRTLSFKSFIDHLNFTQYQL*NIIPMDETSIFFGQATQKTIDCR----------G*GSTIVICILAINCSVRKLPPMLITK-RKSRVSSFAINYFFSDDTYFSSRIQKAVKFL 789
            KR L+FK F+D ++F++YQL N+I MDET++F GQ  Q T+  +          G  S  V CILAI+   +K+ P LITK +K ++   +  Y    +  + ++  K V F+
Sbjct:  149 KRALAFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVTCILAIHLDGKKVSPFLITKGKKDQIQRVSGIYVIESENDWCTQAVKWVDFM 261          

HSP 2 Score: 65.855 bits (159), Expect = 7.789e-25
Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 2
Query:  254 KFKDTIFK*IFHQHAQAFIVRKSENTNLFIKLAQQFHISLGKLVASQHWVDGFLARNELSLRRSTTLFKLHD 469
            + +D I++ I  + A A +VR+++     ++ A +F IS  +  AS HW+D FL R ELSLRRSTTLFKL D
Sbjct:   73 ELEDCIWEWIAGRRAMALVVRRADIQKFALETAIEFDISTEEFKASSHWLDNFLKRYELSLRRSTTLFKLED 144          

HSP 3 Score: 24.6386 bits (52), Expect = 7.789e-25
Identity = 10/18 (55.56%), Postives = 12/18 (66.67%), Query Frame = 3
Query:  144 CNMIKLALSVVRRWRADY 197
            C    L L +VR+WRADY
Sbjct:   29 CKEKMLDLRMVRKWRADY 46          
BLAST of Pogo transposable element with KRAB vs. TrEMBL
Match: A0A087TJ39 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_07293 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.417e-24
Identity = 37/83 (44.58%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  484 KRTLSFKSFIDHLNFTQYQL*NIIPMDETSIFFGQATQKTIDCR----------G*GSTIVICILAINCSVRKLPPMLITKRK 702
            KR L+FK F+D ++F++YQL N+I MDET++F GQ  Q T+  +          G  S  V CILAI    +K+ P LITK K
Sbjct:  149 KRALAFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVTCILAIRLDGKKVSPFLITKGK 231          

HSP 2 Score: 65.855 bits (159), Expect = 2.417e-24
Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 2
Query:  254 KFKDTIFK*IFHQHAQAFIVRKSENTNLFIKLAQQFHISLGKLVASQHWVDGFLARNELSLRRSTTLFKLHD 469
            + +D I++ I  + A A +VR+++     ++ A +F IS  +  AS HW+D FL R ELSLRRSTTLFKL D
Sbjct:   73 ELEDCIWEWIAGRRAMALVVRRADIQKFALETAIEFDISTEEFKASSHWLDNFLKRYELSLRRSTTLFKLED 144          

HSP 3 Score: 24.6386 bits (52), Expect = 2.417e-24
Identity = 10/18 (55.56%), Postives = 12/18 (66.67%), Query Frame = 3
Query:  144 CNMIKLALSVVRRWRADY 197
            C    L L +VR+WRADY
Sbjct:   29 CKEKMLDLRMVRKWRADY 46          
BLAST of Pogo transposable element with KRAB vs. TrEMBL
Match: A0A087T8B4 (Pogo transposable element with KRAB (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_08095 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.498e-24
Identity = 37/83 (44.58%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  484 KRTLSFKSFIDHLNFTQYQL*NIIPMDETSIFFGQATQKTIDCR----------G*GSTIVICILAINCSVRKLPPMLITKRK 702
            KR L+FK F+D ++F++YQL N+I MDET++F GQ  Q T+  +          G  S  V CILAI    +K+ P LITK K
Sbjct:  153 KRALAFKLFVDGIDFSKYQLSNMIAMDETAVFLGQGAQTTVHHKASSSIYVPSTGYDSARVTCILAIRLDGKKVSPFLITKGK 235          

HSP 2 Score: 66.2402 bits (160), Expect = 2.498e-24
Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 2
Query:  254 KFKDTIFK*IFHQHAQAFIVRKSENTNLFIKLAQQFHISLGKLVASQHWVDGFLARNELSLRRSTTLFKLHD 469
            + +D I++ I  + A A +VR+++     ++ A +F IS  +  AS HW+D FL R ELSLRRSTTLFKL D
Sbjct:   77 ELEDCIWEWIAGRRAMALVVRRADIQKFALETAIEFDISTEEFKASSHWLDNFLKRYELSLRRSTTLFKLED 148          

HSP 3 Score: 24.6386 bits (52), Expect = 2.498e-24
Identity = 10/18 (55.56%), Postives = 12/18 (66.67%), Query Frame = 3
Query:  144 CNMIKLALSVVRRWRADY 197
            C    L L +VR+WRADY
Sbjct:   33 CKEKMLDLRMVRKWRADY 50          
BLAST of Pogo transposable element with KRAB vs. Planmine SMEST
Match: SMESG000009301.1 (SMESG000009301.1)

HSP 1 Score: 189.119 bits (479), Expect = 2.659e-53
Identity = 90/112 (80.36%), Postives = 96/112 (85.71%), Query Frame = -3
Query:  941 RLSILPTQNKSDFSNSYKRSNRRYEQLRSKQCWEYKKVGHIRGQCPNIKFSHCKKAGHLKFQCFDLRGTQSYIYQQNMAAITDQGDDENMMSDREYPNRNAPTKEEVIWAIN 1276
            R S+LP QN+SD SNSY+RSN+RYEQLRSKQCW  K+V HIR Q PNIK S CKKAGH KFQCFDLRGTQSY YQQNMAAI DQGDDENMMSD EYPN NAPT+EEVI AIN
Sbjct:  570 RSSLLPIQNRSDISNSYERSNKRYEQLRSKQCWGCKEVEHIRAQYPNIKCSQCKKAGHFKFQCFDLRGTQSYRYQQNMAAIIDQGDDENMMSDSEYPNGNAPTEEEVIGAIN 681          
BLAST of Pogo transposable element with KRAB vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 178.718 bits (452), Expect = 9.763e-49
Identity = 83/108 (76.85%), Postives = 95/108 (87.96%), Query Frame = -3
Query:  953 RLSILPTQNKSDFSNSYKRSNRRYEQLRSKQCWEYKKVGHIRGQCPNIKFSHCKKAGHLKFQCFDLRGTQSYIYQQNMAAITDQGDDENMMSDREYPNRNAPTKEEVI 1276
            R S+LPTQN+S+FSNSY+RSNRRYEQLRSKQCW YK+VGHIR Q PNIK S+CKKAGHLKF CFDLRGT+SY YQQNMAAI  QGDD+ MMSD +Y N NAPT+EE++
Sbjct: 1139 RPSVLPTQNRSNFSNSYERSNRRYEQLRSKQCWRYKEVGHIRAQYPNIKCSYCKKAGHLKFHCFDLRGTESYRYQQNMAAIAYQGDDKKMMSDSKYQNANAPTQEELL 1246          
BLAST of Pogo transposable element with KRAB vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 178.333 bits (451), Expect = 1.747e-48
Identity = 86/127 (67.72%), Postives = 102/127 (80.31%), Query Frame = -3
Query:  896 RLSILPTQNKSDFSNSYKRSNRRYEQLRSKQCWEYKKVGHIRGQCPNIKFSHCKKAGHLKFQCFDLRGTQSYIYQQNMAAITDQGDDENMMSDREYPNRNAPTKEEVIWAIN*M*VIS*AMIVFMIM 1276
            R S+LPTQN+S+FSNSY+RSNRRYEQLRSKQCW YK+VGHIR Q PNIK S+CKKAGHLKF CFDLRGT+SY YQQNMAAI  QGDD+ MMSD +Y N NAPT+EE     +   V+  A++  +I+
Sbjct: 1188 RPSVLPTQNRSNFSNSYERSNRRYEQLRSKQCWRYKEVGHIRAQYPNIKCSYCKKAGHLKFHCFDLRGTESYRYQQNMAAIAYQGDDKKMMSDSKYQNANAPTQEETNECEDAFQVLKKALVKALIL 1314          
BLAST of Pogo transposable element with KRAB vs. Planmine SMEST
Match: SMESG000064279.1 (SMESG000064279.1)

HSP 1 Score: 157.147 bits (396), Expect = 7.272e-46
Identity = 74/94 (78.72%), Postives = 81/94 (86.17%), Query Frame = -3
Query:  995 RLSILPTQNKSDFSNSYKRSNRRYEQLRSKQCWEYKKVGHIRGQCPNIKFSHCKKAGHLKFQCFDLRGTQSYIYQQNMAAITDQGDDENMMSDR 1276
            R S+LP QN+SDFSNSY++SNRRYE LRSKQ W  K+VGHIR Q PNIK SHCKK+GH KFQCFD RGTQSY YQQN+ AITDQGDDENMMSDR
Sbjct:   93 RPSVLPIQNRSDFSNSYEQSNRRYELLRSKQRWGCKEVGHIRAQYPNIKSSHCKKSGHFKFQCFDRRGTQSYRYQQNIVAITDQGDDENMMSDR 186          
BLAST of Pogo transposable element with KRAB vs. Planmine SMEST
Match: SMESG000037636.1 (SMESG000037636.1)

HSP 1 Score: 145.976 bits (367), Expect = 1.466e-37
Identity = 70/107 (65.42%), Postives = 83/107 (77.57%), Query Frame = -3
Query:  896 NRRYEQLRSKQCWEYKKVGHIRGQCPNIKFSHCKKAGHLKFQCFDLRGTQSYIYQQNMAAITDQGDDENMMSDREYPNRNAPTKEEVIWAIN*M*VIS*AMIVFMIM 1216
            N+RYEQLRSKQCW YK+VGHIR Q PNIK S+CKKAGHLKF CFDLRGT+SY YQQNMAAI  QGDD+ MMSD +Y N NAPT+EE     +   V+  A++  +I+
Sbjct: 1177 NQRYEQLRSKQCWRYKEVGHIRAQYPNIKCSYCKKAGHLKFHCFDLRGTESYRYQQNMAAIAYQGDDKKMMSDSKYQNANAPTQEETNECEDAFQVLKKALVKALIL 1283          
The following BLAST results are available for this feature:
BLAST of Pogo transposable element with KRAB vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B1PG563.130e-2744.04Centromere binding protein B, DNA binding protein ... [more]
A0A085MY473.999e-2744.04HTH CENPB-type domain-containing protein OS=Trichu... [more]
A0A087T2U57.789e-2536.28Pogo transposable element with KRAB (Fragment) OS=... [more]
A0A087TJ392.417e-2444.58Pogo transposable element with KRAB (Fragment) OS=... [more]
A0A087T8B42.498e-2444.58Pogo transposable element with KRAB (Fragment) OS=... [more]
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with KRAB vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009301.12.659e-5380.36SMESG000009301.1[more]
SMESG000037636.19.763e-4976.85SMESG000037636.1[more]
SMESG000037636.11.747e-4867.72SMESG000037636.1[more]
SMESG000064279.17.272e-4678.72SMESG000064279.1[more]
SMESG000037636.11.466e-3765.42SMESG000037636.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009416 ID=SMED30009416|Name=Pogo transposable element with KRAB|organism=Schmidtea mediterranea sexual|type=transcript|length=1278bp
TCCAATATTTAAGATATAAAAAATTTTATGATATATATTATGAATATATT
TGATCAATATTAGACGAAATATTTTAATATATAAGTTACTCAATATAAAA
TAAGCATTGTGAACGAATCGAATGATAAGTGTTTAACGGAATTTGCAACA
TGATAAAACTTGCTTTGAGTGTGGTCCGACGATGGCGCGCAGATTATTAT
AATCTTTTCGACAAAAAATGTTGGAAATTTAAAAGTACACAGTTGGTGCA
TATAAGTTTAAAGACACAATTTTTAAATAGATTTTTCACCAACATGCTCA
AGCTTTTATCGTTCGAAAATCAGAAAATACAAATCTTTTTATTAAATTGG
CTCAACAGTTTCATATCTCTTTGGGAAAACTTGTAGCTTCACAACACTGG
GTTGATGGGTTTCTAGCAAGGAATGAATTGTCTTTAAGAAGGTCAACGAC
ATTATTTAAGTTACATGATATATAGAGATTATAAAGAGGACATTATCATT
CAAATCATTTATAGATCATTTAAACTTTACCCAATATCAATTATAAAATA
TAATTCCTATGGATGAAACATCCATATTTTTCGGACAAGCTACACAAAAA
ACTATTGATTGTAGAGGATAAGGGAGTACCATAGTCATCTGTATTCTTGC
AATAAATTGTAGTGTCAGAAAACTGCCGCCAATGCTAATTACAAAAAGAA
AAAGTAGAGTATCTTCATTTGCAATTAATTATTTCTTTTCTGATGACACT
TATTTTAGCTCCCGTATCCAAAAGGCAGTTAAATTTCTCCGTTTATCGAT
TTTATATACAGTATCTATACATATAACATCAAGCATACTAACATCATCAT
ACCGAATATTATCAAAAAATTCAATTTCATGCAAACAATTAGAAACATTA
TCATAAATACAATCATTGCTCAAGATATTACTTACATTTAGTTTATCGCC
CAAATTACTTCCTCTTTTGTTGGAGCATTGCGATTTGGGTATTCTCTGTC
GGACATCATGTTCTCATCATCTCCTTGATCTGTAATTGCTGCCATATTCT
GTTGATATATGTAGCTCTGAGTTCCTCTTAGATCGAAGCATTGGAACTTT
AGATGGCCTGCCTTCTTGCAATGAGAAAATTTTATGTTCGGACATTGGCC
TCTTATATGTCCTACTTTTTTGTATTCCCAGCATTGTTTGGATCGTAGTT
GTTCGTATCTTCTATTTGACCGCTTATAAGAATTTGAAAAATCCGATTTG
TTTTGTGTCGGTAGAATTGAAAGTCGAC
back to top

protein sequence of SMED30009416-orf-1

>SMED30009416-orf-1 ID=SMED30009416-orf-1|Name=SMED30009416-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
RLSILPTQNKSDFSNSYKRSNRRYEQLRSKQCWEYKKVGHIRGQCPNIKF
SHCKKAGHLKFQCFDLRGTQSYIYQQNMAAITDQGDDENMMSDREYPNRN
APTKEEVIWAIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0003677DNA binding