SMED30009415

Overview
NameSMED30009415
Smed IDSMED30009415
Length (bp)311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009415 (SMED30009415) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009415 (SMED30009415) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009415 (SMED30009415) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009415 (SMED30009415) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009415

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 38

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30009415h1SMcG0005241 SmedASXL_017551SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30009415h1SMcG0005241 SmedASXL_012148SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30009415h1SMcG0005241 SmedASXL_017550SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30009415h1SMcG0005241 SmedASXL_017551SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009415h1SMcG0005241 SmedASXL_017551SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30009415h1SMcG0005241 SmedASXL_012148SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009415h1SMcG0005241 SmedASXL_012148SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30009415h1SMcG0005241 SmedASXL_017550SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009415h1SMcG0005241 SmedASXL_017550SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30009415h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009415h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009415h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009415h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009415h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009415h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009415h1SMcG0005241 Contig20539newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009415h1SMcG0005241 Contig20539uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009415h1SMcG0005241 Contig37647newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009415h1SMcG0005241 Contig37647uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30009415h1SMcG0005241 dd_Smed_v4_13700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009415h1SMcG0005241 dd_Smed_v4_13700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009415h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009415h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009415h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009415h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009415h1SMcG0005241 dd_Smed_v6_13700_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009415h1SMcG0005241 dd_Smed_v6_2548_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009415h1SMcG0005241 dd_Smed_v6_3777_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30009415h1SMcG0005241 dd_Smed_v6_2548_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009415h1SMcG0005241 dd_Smed_v6_3777_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30009415h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30009415h1SMcG0005241 dd_Smed_v4_13700_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009415h1SMcG0005241 SMED30023035smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30009415h1SMcG0005242 SMED30023035smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30009415h1SMcG0005242 SMED_29717_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009415h1SMcG0005242 SMED_29717_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009415h1SMcG0005241 SMED_29717_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009415h1SMcG0005241 SMED_29717_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009415 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002089:105143..105450 +1432
v31.007011:16643..16951 -1158
v31.007011:16778..17087 -1119
v31.002089:104872..105181 +1119
v31.002089:105008..105316 +1113
v31.007011:16558..16816 -1016
v31.002089:104760..105046 +584
Homology
BLAST of SMED30009415 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 182.57 bits (462), Expect = 1.167e-54
Identity = 96/103 (93.20%), Postives = 98/103 (95.15%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DKNSTVEKKNSVVITKNTRGRQK QINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESET DG  DK+SI+EKENS V
Sbjct: 2850 DKNSTVEKKNSVVITKNTRGRQKIQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETFDGYGDKNSIMEKENSAV 2952          

HSP 2 Score: 152.525 bits (384), Expect = 3.566e-44
Identity = 82/103 (79.61%), Postives = 91/103 (88.35%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DK+S VEK+NSVVITK  RGR KKQ+NESV+AQSALESETND N DKNS+VEK+N VV TK TRGR KKQ+NESVDAQSALESETNDGN DK+S VEK+NSVV
Sbjct: 2760 DKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVVFTKNTRGRQKKQINESVDAQSALESETNDGNGDKNSTVEKKNSVV 2862          

HSP 3 Score: 142.51 bits (358), Expect = 1.349e-40
Identity = 76/98 (77.55%), Postives = 84/98 (85.71%), Query Frame = 3
Query:   18 VEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            VE +NSVV  + +RGR KKQ+ ESVN QS  ESETND N DK+S+VEKEN VVITKK RGRPKKQVNESVDAQSALESETNDGN DK+SIVEK+NSVV
Sbjct: 2720 VENENSVVTIRKSRGRPKKQVTESVNVQSVFESETNDGNWDKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVV 2817          

HSP 4 Score: 95.5153 bits (236), Expect = 3.400e-24
Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESV 227
            DKNS +EK+NS VITK TRGR KKQ+NESV+AQS LESETND   DKNS++EK+N  VI KKTRGR KK + E++
Sbjct: 2940 DKNSIMEKENSAVITKKTRGRPKKQVNESVDAQSVLESETNDGYGDKNSVLEKDNSAVIIKKTRGRQKKPIIENL 3014          
BLAST of SMED30009415 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 182.57 bits (462), Expect = 1.225e-54
Identity = 96/103 (93.20%), Postives = 98/103 (95.15%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DKNSTVEKKNSVVITKNTRGRQK QINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESET DG  DK+SI+EKENS V
Sbjct: 2858 DKNSTVEKKNSVVITKNTRGRQKIQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETFDGYGDKNSIMEKENSAV 2960          

HSP 2 Score: 152.525 bits (384), Expect = 3.601e-44
Identity = 82/103 (79.61%), Postives = 91/103 (88.35%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DK+S VEK+NSVVITK  RGR KKQ+NESV+AQSALESETND N DKNS+VEK+N VV TK TRGR KKQ+NESVDAQSALESETNDGN DK+S VEK+NSVV
Sbjct: 2768 DKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVVFTKNTRGRQKKQINESVDAQSALESETNDGNGDKNSTVEKKNSVV 2870          

HSP 3 Score: 142.51 bits (358), Expect = 1.349e-40
Identity = 76/98 (77.55%), Postives = 84/98 (85.71%), Query Frame = 3
Query:   18 VEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            VE +NSVV  + +RGR KKQ+ ESVN QS  ESETND N DK+S+VEKEN VVITKK RGRPKKQVNESVDAQSALESETNDGN DK+SIVEK+NSVV
Sbjct: 2728 VENENSVVTIRKSRGRPKKQVTESVNVQSVFESETNDGNWDKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVV 2825          

HSP 4 Score: 95.5153 bits (236), Expect = 3.467e-24
Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESV 227
            DKNS +EK+NS VITK TRGR KKQ+NESV+AQS LESETND   DKNS++EK+N  VI KKTRGR KK + E++
Sbjct: 2948 DKNSIMEKENSAVITKKTRGRPKKQVNESVDAQSVLESETNDGYGDKNSVLEKDNSAVIIKKTRGRQKKPIIENL 3022          
BLAST of SMED30009415 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 182.57 bits (462), Expect = 1.237e-54
Identity = 96/103 (93.20%), Postives = 98/103 (95.15%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DKNSTVEKKNSVVITKNTRGRQK QINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESET DG  DK+SI+EKENS V
Sbjct: 2853 DKNSTVEKKNSVVITKNTRGRQKIQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETFDGYGDKNSIMEKENSAV 2955          

HSP 2 Score: 152.525 bits (384), Expect = 3.566e-44
Identity = 82/103 (79.61%), Postives = 91/103 (88.35%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DK+S VEK+NSVVITK  RGR KKQ+NESV+AQSALESETND N DKNS+VEK+N VV TK TRGR KKQ+NESVDAQSALESETNDGN DK+S VEK+NSVV
Sbjct: 2763 DKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVVFTKNTRGRQKKQINESVDAQSALESETNDGNGDKNSTVEKKNSVV 2865          

HSP 3 Score: 142.51 bits (358), Expect = 1.336e-40
Identity = 76/98 (77.55%), Postives = 84/98 (85.71%), Query Frame = 3
Query:   18 VEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            VE +NSVV  + +RGR KKQ+ ESVN QS  ESETND N DK+S+VEKEN VVITKK RGRPKKQVNESVDAQSALESETNDGN DK+SIVEK+NSVV
Sbjct: 2723 VENENSVVTIRKSRGRPKKQVTESVNVQSVFESETNDGNWDKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVV 2820          

HSP 4 Score: 95.5153 bits (236), Expect = 3.535e-24
Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESV 227
            DKNS +EK+NS VITK TRGR KKQ+NESV+AQS LESETND   DKNS++EK+N  VI KKTRGR KK + E++
Sbjct: 2943 DKNSIMEKENSAVITKKTRGRPKKQVNESVDAQSVLESETNDGYGDKNSVLEKDNSAVIIKKTRGRQKKPIIENL 3017          
BLAST of SMED30009415 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 182.57 bits (462), Expect = 1.237e-54
Identity = 96/103 (93.20%), Postives = 98/103 (95.15%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DKNSTVEKKNSVVITKNTRGRQK QINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESET DG  DK+SI+EKENS V
Sbjct: 2860 DKNSTVEKKNSVVITKNTRGRQKIQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETFDGYGDKNSIMEKENSAV 2962          

HSP 2 Score: 152.525 bits (384), Expect = 3.636e-44
Identity = 82/103 (79.61%), Postives = 91/103 (88.35%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            DK+S VEK+NSVVITK  RGR KKQ+NESV+AQSALESETND N DKNS+VEK+N VV TK TRGR KKQ+NESVDAQSALESETNDGN DK+S VEK+NSVV
Sbjct: 2770 DKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVVFTKNTRGRQKKQINESVDAQSALESETNDGNGDKNSTVEKKNSVV 2872          

HSP 3 Score: 142.51 bits (358), Expect = 1.362e-40
Identity = 76/98 (77.55%), Postives = 84/98 (85.71%), Query Frame = 3
Query:   18 VEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKENSVV 311
            VE +NSVV  + +RGR KKQ+ ESVN QS  ESETND N DK+S+VEKEN VVITKK RGRPKKQVNESVDAQSALESETNDGN DK+SIVEK+NSVV
Sbjct: 2730 VENENSVVTIRKSRGRPKKQVTESVNVQSVFESETNDGNWDKSSIVEKENSVVITKKIRGRPKKQVNESVDAQSALESETNDGNGDKNSIVEKKNSVV 2827          

HSP 4 Score: 95.5153 bits (236), Expect = 3.501e-24
Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 3
Query:    3 DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSLVEKENLVVITKKTRGRPKKQVNESV 227
            DKNS +EK+NS VITK TRGR KKQ+NESV+AQS LESETND   DKNS++EK+N  VI KKTRGR KK + E++
Sbjct: 2950 DKNSIMEKENSAVITKKTRGRPKKQVNESVDAQSVLESETNDGYGDKNSVLEKDNSAVIIKKTRGRQKKPIIENL 3024          
The following BLAST results are available for this feature:
BLAST of SMED30009415 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009415 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000050427.11.167e-5493.20SMESG000050427.1[more]
SMESG000050427.11.225e-5493.20SMESG000050427.1[more]
SMESG000050427.11.237e-5493.20SMESG000050427.1[more]
SMESG000050427.11.237e-5493.20SMESG000050427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009415 ID=SMED30009415|Name=SMED30009415|organism=Schmidtea mediterranea sexual|type=transcript|length=311bp
AAGATAAAAATAGCACTGTAGAAAAAAAGAATTCAGTTGTAATTACAAAG
AACACTCGTGGAAGACAAAAGAAGCAAATCAATGAAAGTGTGAATGCACA
AAGCGCATTGGAAAGTGAAACTAATGATAGAAATGAAGACAAAAATAGCC
TTGTAGAAAAAGAGAATTTAGTCGTAATCACTAAAAAAACTCGTGGAAGA
CCGAAAAAACAAGTCAACGAAAGTGTGGATGCACAAAGTGCTTTGGAAAG
TGAAACTAATGATGGAAATTGGGATAAAAGTAGTATTGTAGAAAAAGAGA
ATTCAGTCGTA
back to top

protein sequence of SMED30009415-orf-1

>SMED30009415-orf-1 ID=SMED30009415-orf-1|Name=SMED30009415-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
DKNSTVEKKNSVVITKNTRGRQKKQINESVNAQSALESETNDRNEDKNSL
VEKENLVVITKKTRGRPKKQVNESVDAQSALESETNDGNWDKSSIVEKEN
SVV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 63..101
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..50