Metastasis suppressor 1

Overview
NameMetastasis suppressor 1
Smed IDSMED30009412
Length (bp)2052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metastasis suppressor 1 (SMED30009412) t-SNE clustered cells

Violin plots show distribution of expression levels for Metastasis suppressor 1 (SMED30009412) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metastasis suppressor 1 (SMED30009412) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metastasis suppressor 1 (SMED30009412) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009412

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009412h1SMcG0004722 SmedASXL_016923SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30009412h1SMcG0004722 dd_Smed_v4_10542_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metastasis suppressor 1 vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 115.931 bits (289), Expect = 3.946e-26
Identity = 68/222 (30.63%), Postives = 125/222 (56.31%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            I+D+K S   WED   K+ KL + L+ TV    +  ++   ++D+  N++  G  + G+ L+ + ++ +SI  KL   +S++ + L + L   ++ WK+    + KD   + K+A+ ++KK  S+  KL+ K+ K  T+ +  +      Q+D A Q++ +K   LEE E+ ++RK + EER R+  FI  LRPV++ ++SM  E+  LQ + + L S + D
Sbjct:   20 ISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTR-GGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKVDTLGRGDIQP----QLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMD 236          
BLAST of Metastasis suppressor 1 vs. Ensembl Human
Match: MTSS2 (MTSS I-BAR domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25094])

HSP 1 Score: 111.694 bits (278), Expect = 7.377e-25
Identity = 68/218 (31.19%), Postives = 121/218 (55.50%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
            A +ND+KSS   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK+    + KD   + KRA+ ++KK  S+  KL+ K+ K L + K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L
Sbjct:   17 AIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKEL-LGKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 228          
BLAST of Metastasis suppressor 1 vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 111.309 bits (277), Expect = 9.835e-25
Identity = 69/223 (30.94%), Postives = 123/223 (55.16%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNK-RLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            I+D+K S   WED   K+ KL + L+ TV    +  ++   ++D+  N++  G  + G+ L+ + ++ +SI  KL   +S++ + L + L   ++ WK+    + KD   + K+A+ ++KK  S+  KL+ K+ K R  I           Q+D A Q++ +K   LEE E+ ++RK + EER R+  FI  LRPV++ ++SM  E+  LQ + + L S + D
Sbjct:   20 ISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTR-GGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQP---------QLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMD 232          
BLAST of Metastasis suppressor 1 vs. Ensembl Human
Match: MTSS1 (MTSS I-BAR domain containing 1 [Source:HGNC Symbol;Acc:HGNC:20443])

HSP 1 Score: 110.538 bits (275), Expect = 1.888e-24
Identity = 69/223 (30.94%), Postives = 123/223 (55.16%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNK-RLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            I+D+K S   WED   K+ KL + L+ TV    +  ++   ++D+  N++  G  + G+ L+ + ++ +SI  KL   +S++ + L + L   ++ WK+    + KD   + K+A+ ++KK  S+  KL+ K+ K R  I           Q+D A Q++ +K   LEE E+ ++RK + EER R+  FI  LRPV++ ++SM  E+  LQ + + L S + D
Sbjct:   20 ISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTR-GGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQP---------QLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMD 232          
BLAST of Metastasis suppressor 1 vs. Ensembl Human
Match: MTSS2 (MTSS I-BAR domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25094])

HSP 1 Score: 106.301 bits (264), Expect = 4.526e-23
Identity = 66/218 (30.28%), Postives = 118/218 (54.13%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
            A +ND+KSS   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK+    + KD   + KRA+ ++KK  S+  KL+ +  K     K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L
Sbjct:   17 AIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKRRAK--VPGKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 227          
BLAST of Metastasis suppressor 1 vs. Ensembl Celegans
Match: M04F3.5 (pep chromosome:WBcel235:I:4773818:4788358:-1 gene:WBGene00019771.1 transcript:M04F3.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.5)

HSP 1 Score: 62.7734 bits (151), Expect = 5.201e-10
Identity = 55/219 (25.11%), Postives = 98/219 (44.75%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSS 735
            ++D+K +   W+ ++ K+QKL T L+ T Q  ++  E++  + D  +N K +     G  ++ + I++++I N++     ++   LA  L    + W       K  CH   K A   +KK  S          +R  +                     N+QR     E C+  KV+ E+R ++  FI  L PVL+AQ++M  E   L+ + D L S+
Sbjct:   21 VHDMKHTYPGWDALSQKAQKLGTQLRATAQCLSTFTEAMQGVCDNANNLKGAS-RDVGACVTRVCIKQRAIENRMRSWADALCEELAISLQQRGNYW-------KSRCHDMDKTAAKHVKKVRSR--------KQRPDVTAM------------------NEQR-----EICT--KVLTEQRTQFSFFIGTLMPVLNAQMNMLDEGAHLRQVVDNLDST 198          
BLAST of Metastasis suppressor 1 vs. Ensembl Celegans
Match: M04F3.5 (pep chromosome:WBcel235:I:4773818:4777717:-1 gene:WBGene00019771.1 transcript:M04F3.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M04F3.5)

HSP 1 Score: 62.7734 bits (151), Expect = 5.369e-10
Identity = 55/219 (25.11%), Postives = 98/219 (44.75%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSS 735
            ++D+K +   W+ ++ K+QKL T L+ T Q  ++  E++  + D  +N K +     G  ++ + I++++I N++     ++   LA  L    + W       K  CH   K A   +KK  S          +R  +                     N+QR     E C+  KV+ E+R ++  FI  L PVL+AQ++M  E   L+ + D L S+
Sbjct:   18 VHDMKHTYPGWDALSQKAQKLGTQLRATAQCLSTFTEAMQGVCDNANNLKGAS-RDVGACVTRVCIKQRAIENRMRSWADALCEELAISLQQRGNYW-------KSRCHDMDKTAAKHVKKVRSR--------KQRPDVTAM------------------NEQR-----EICT--KVLTEQRTQFSFFIGTLMPVLNAQMNMLDEGAHLRQVVDNLDST 195          
BLAST of Metastasis suppressor 1 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0332941)

HSP 1 Score: 112.464 bits (280), Expect = 2.726e-25
Identity = 70/228 (30.70%), Postives = 122/228 (53.51%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILP 762
            IND+K++   WED   K+ KL+T L+  +Q   +  ++   ++D   NS+ +   + G  L+ + ++ K++  +L    S++ + L   L   I+ WKRT+A I KD   + KR + +LKK  S+  +L+ K+ K  T    SL D+         Q++  ++  LEE+E+ SLR  + EER RY  F+  L+PV+  +  + +EL  LQ     + +  T + S+LP
Sbjct:   20 INDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGAS-KEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKGQTDGLQSLMDSH-------MQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSI-ALVTKEPSVLP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0332943)

HSP 1 Score: 112.464 bits (280), Expect = 3.434e-25
Identity = 70/228 (30.70%), Postives = 122/228 (53.51%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILP 762
            IND+K++   WED   K+ KL+T L+  +Q   +  ++   ++D   NS+ +   + G  L+ + ++ K++  +L    S++ + L   L   I+ WKRT+A I KD   + KR + +LKK  S+  +L+ K+ K  T    SL D+         Q++  ++  LEE+E+ SLR  + EER RY  F+  L+PV+  +  + +EL  LQ     + +  T + S+LP
Sbjct:   20 INDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGAS-KEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKGQTDGLQSLMDSH-------MQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSI-ALVTKEPSVLP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0306614)

HSP 1 Score: 111.694 bits (278), Expect = 5.356e-25
Identity = 69/228 (30.26%), Postives = 121/228 (53.07%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILP 762
            IND+K++   WED   K+ KL+T L+  +Q   +  ++   ++D   NS+ +   + G  L+ + ++ K++  +L    S++ + L   L   I+ WKRT+A I KD   + KR + +LKK  S+  +L+ K+ K  T       D     +D   Q++  ++  LEE+E+ SLR  + EER RY  F+  L+PV+  +  + +EL  LQ     + +  T + S+LP
Sbjct:   20 INDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGAS-KEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKGQT-------DGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSI-ALVTKEPSVLP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0332942)

HSP 1 Score: 112.079 bits (279), Expect = 5.426e-25
Identity = 69/228 (30.26%), Postives = 121/228 (53.07%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILP 762
            IND+K++   WED   K+ KL+T L+  +Q   +  ++   ++D   NS+ +   + G  L+ + ++ K++  +L    S++ + L   L   I+ WKRT+A I KD   + KR + +LKK  S+  +L+ K+ K  T       D     +D   Q++  ++  LEE+E+ SLR  + EER RY  F+  L+PV+  +  + +EL  LQ     + +  T + S+LP
Sbjct:   20 INDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGAS-KEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKGQT-------DGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSI-ALVTKEPSVLP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Fly
Match: mim (gene:FBgn0053558 transcript:FBtr0302578)

HSP 1 Score: 112.079 bits (279), Expect = 5.722e-25
Identity = 69/228 (30.26%), Postives = 121/228 (53.07%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILP 762
            IND+K++   WED   K+ KL+T L+  +Q   +  ++   ++D   NS+ +   + G  L+ + ++ K++  +L    S++ + L   L   I+ WKRT+A I KD   + KR + +LKK  S+  +L+ K+ K  T       D     +D   Q++  ++  LEE+E+ SLR  + EER RY  F+  L+PV+  +  + +EL  LQ     + +  T + S+LP
Sbjct:   20 INDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQKIADAATNSRGAS-KEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVATIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKGQT-------DGLQSLMDSHMQDVTLRRAELEEVEKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSI-ALVTKEPSVLP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Zebrafish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 116.701 bits (291), Expect = 1.282e-26
Identity = 67/229 (29.26%), Postives = 124/229 (54.15%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            +ND+K+S  AWED   K  KL + L+ T+   +S  ++   ++DI   ++     + G+ L+ + ++ +SI NKL +  +++ +NL + L   I+ WK+  + + KD   + K+A+ ++KK  S+          +L        D   +Q+D A Q++  +   LEE E+ ++ + + EER R+  F+  L+PVLD ++SM  E+  LQ + + L  + T D + LPP
Sbjct:   20 MNDMKASYPAWEDFVTKGAKLQSQLRTTIIVTSSFLDAFQKVADIATGTR-GATKEIGSALTRMCMRHRSIENKLKLFTTALMDNLITPLELKIEEWKKVASQLDKDHAKEYKKARSEIKKKSSD--------TIKLQKKVKKGKDEVRMQLDSALQDVNTRYAVLEETEKRAVCRALIEERGRFCSFVTMLKPVLDEEISMLGEVTHLQTILEDL-GNLTADPNTLPP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Zebrafish
Match: mtss1lb (MTSS I-BAR domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-140718-4])

HSP 1 Score: 111.694 bits (278), Expect = 5.666e-25
Identity = 68/244 (27.87%), Postives = 129/244 (52.87%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+K S   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK+T   + KD   + KR++ ++KK  S+  KL+ K+ K               Q+D A Q++ +    +EE E+ ++R+ + EER R+  FI  L+PV++ +++M  E+  LQ + D L +  T D   LPP  +  +++ +  D
Sbjct:   22 AIVNDMKCSYPVWEDFNAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIEAKLRHFTNALMESLITPLQDRIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARKG--------RGDLQPQLDSAMQDVNDMYLLMEETEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDL-TVLTSDPHKLPPASEQVIKDLKGSD 255          
BLAST of Metastasis suppressor 1 vs. Ensembl Zebrafish
Match: mtss1la (MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030219-89])

HSP 1 Score: 107.457 bits (267), Expect = 1.157e-23
Identity = 64/224 (28.57%), Postives = 118/224 (52.68%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            A +ND+K S   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++   +   L   I+ WK+T A + KD   + KR++ ++KK  S+  KL+ K+ K L             Q++ A Q++ +    +EE E+ ++R+ + EER RY  FI  L+PV+  +++M  E   LQ + + L   +TD
Sbjct:   17 AIVNDMKYSYPVWEDFITKATKLHSQLRTTVLATAAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIEAKLRHFTNALMEKMIGPLQDKIEEWKKTAALLDKDHAKEYKRSRQEIKKKSSDTIKLQKKARKELPGR-----GGLQPQLNSAMQDVNDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVVGEIAMLGEATHLQAIIEDLTVLTTD 234          
BLAST of Metastasis suppressor 1 vs. Ensembl Zebrafish
Match: mtss1la (MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030219-89])

HSP 1 Score: 104.375 bits (259), Expect = 1.114e-22
Identity = 63/224 (28.12%), Postives = 117/224 (52.23%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            A +ND+K S   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++   +   L   I+ WK+T A + KD   + KR++ ++KK  S+  KL+ K+ K               Q++ A Q++ +    +EE E+ ++R+ + EER RY  FI  L+PV+  +++M  E   LQ + + L   +TD
Sbjct:   65 AIVNDMKYSYPVWEDFITKATKLHSQLRTTVLATAAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIEAKLRHFTNALMEKMIGPLQDKIEEWKKTAALLDKDHAKEYKRSRQEIKKKSSDTIKLQKKARKG--------RGGLQPQLNSAMQDVNDMYLLMEETEKQAVRRALLEERGRYCTFISFLQPVVVGEIAMLGEATHLQAIIEDLTVLTTD 279          
BLAST of Metastasis suppressor 1 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 112.849 bits (281), Expect = 2.852e-25
Identity = 66/218 (30.28%), Postives = 125/218 (57.34%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
            A IND+K+S   WED + K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI +KL    +++  +L + L   I+ WK+T   + K+   + KRA+ ++KK  S+  KL+ K+ K + + K  L      Q+D+A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ ++ M AE+  LQ + + L
Sbjct:   17 AIINDMKNSYPIWEDFSSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARKEV-LGKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 228          
BLAST of Metastasis suppressor 1 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 112.464 bits (280), Expect = 3.743e-25
Identity = 66/218 (30.28%), Postives = 125/218 (57.34%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
            A IND+K+S   WED + K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI +KL    +++  +L + L   I+ WK+T   + K+   + KRA+ ++KK  S+  KL+ K+ K + + K  L      Q+D+A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ ++ M AE+  LQ + + L
Sbjct:   17 AIINDMKNSYPIWEDFSSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARKEV-LGKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 228          
BLAST of Metastasis suppressor 1 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 110.538 bits (275), Expect = 1.764e-24
Identity = 66/218 (30.28%), Postives = 123/218 (56.42%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
            A IND+K+S   WED + K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI +KL    +++  +L + L   I+ WK+T   + K+   + KRA+ ++KK  S+  KL+ K+ K     K  L      Q+D+A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ ++ M AE+  LQ + + L
Sbjct:   17 AIINDMKNSYPIWEDFSSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARK----GKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 225          
BLAST of Metastasis suppressor 1 vs. Ensembl Xenopus
Match: acss2.2 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:Xenbase;Acc:XB-GENE-5916994])

HSP 1 Score: 85.8853 bits (211), Expect = 8.881e-17
Identity = 53/196 (27.04%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  139 LNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
              ++ + TV    +  ++   ++D+  N++       G+ L+ + ++ +SI +KL    +++  +L + L   I+ WK+T   + K+   + KRA+ ++KK  S+  KL+ K+ K     K  L      Q+D+A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ ++ M AE+  LQ + + L
Sbjct:   58 FTSSFRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANTLDKEHAREYKRARHEIKKKSSDTLKLQKKARK----GKGDLQP----QLDHALQDVNDMYLLLEETEKQAVRRALIEERGRFCSFITLLQPVVNGEIHMLAEVTHLQAIIEDL 244          
BLAST of Metastasis suppressor 1 vs. Ensembl Xenopus
Match: ENSXETT00000003339.1 (metastasis suppressor 1, gene 2 [Source:NCBI gene;Acc:100492573])

HSP 1 Score: 85.1149 bits (209), Expect = 1.513e-16
Identity = 51/196 (26.02%), Postives = 103/196 (52.55%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVL 666
            IND+K+S   WED   K+ KL ++LK  +    S  ++   ++D+  N++     + G+ L+ + ++ ++I ++L  L  ++ ++L + L   I+ WK+    + KD   + K+A+ D+KK  S+          +L        D   +Q+D   Q++ +K   LEE E+ ++ + + EER R+  F+  L+P++
Sbjct:   20 INDMKASYPTWEDFVSKATKLQSHLKTMIIVTGSFLDAFQKIADMAINTR-GATKEIGSALTRMCMRHRNIESRLKHLTVALSDSLINPLEGKIEEWKKVANQLDKDHAKEYKKARADIKKKSSD--------TIKLQKKVKKGKDDARVQLDSVLQDVNDKYLLLEETEKKAVYRALVEERGRFCMFVSFLKPLI 206          
BLAST of Metastasis suppressor 1 vs. Ensembl Mouse
Match: Mtss1 (MTSS I-BAR domain containing 1 [Source:MGI Symbol;Acc:MGI:2384818])

HSP 1 Score: 112.849 bits (281), Expect = 2.480e-25
Identity = 68/222 (30.63%), Postives = 124/222 (55.86%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            I+D+K S   WED   K+ KL + L+ TV    +  ++   ++D+  N++  G  + G+ L+ + ++ +SI  KL   +S++ + L + L   ++ WK+    + KD   + K+A+ ++KK  S+  KL+ K+ K   ++     D    Q+D A Q++ +K   LEE E+ ++RK + EER R+  FI  LRPV++ ++SM  E+  LQ + + L S + D
Sbjct:   20 ISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTR-GGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKK---VDAQGRGD-IQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMD 236          
BLAST of Metastasis suppressor 1 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 110.923 bits (276), Expect = 1.081e-24
Identity = 73/244 (29.92%), Postives = 131/244 (53.69%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+KSS   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK++   + KD   + KRA+ ++KK  S+  KL+ K+ K     K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L    T D   LPP  +  +++ +  D
Sbjct:   17 AIVNDMKSSYPIWEDFNSKAAKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK----GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLV-VLTADPHKLPPASEQVIKDLKGSD 250          
BLAST of Metastasis suppressor 1 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 83.9593 bits (206), Expect = 2.807e-16
Identity = 56/185 (30.27%), Postives = 100/185 (54.05%), Query Frame = 1
Query:  250 GNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK++   + KD   + KRA+ ++KK  S+  KL+ K+ K     K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L    T D   LPP  +  +++ +  D
Sbjct:   13 GSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK----GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLV-VLTADPHKLPPASEQVIKDLKGSD 188          
BLAST of Metastasis suppressor 1 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 69.3218 bits (168), Expect = 1.990e-12
Identity = 47/146 (32.19%), Postives = 79/146 (54.11%), Query Frame = 1
Query:  367 WKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            WK++   + KD   + KRA+ ++KK  S+  KL+ K+ K     K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L    T D   LPP  +  +++ +  D
Sbjct:    4 WKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK----GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLV-VLTADPHKLPPASEQVIKDLKGSD 140          
BLAST of Metastasis suppressor 1 vs. Ensembl Mouse
Match: Mtss2 (MTSS I-BAR domain containing 2 [Source:MGI Symbol;Acc:MGI:3039591])

HSP 1 Score: 63.929 bits (154), Expect = 2.416e-10
Identity = 45/140 (32.14%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  385 NIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
             + KD   + KRA+ ++KK  S+  KL+ K+ K     K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L    T D   LPP  +  +++ +  D
Sbjct:    6 QLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK----GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLV-VLTADPHKLPPASEQVIKDLKGSD 136          
BLAST of Metastasis suppressor 1 vs. UniProt/SwissProt
Match: sp|Q765P7|MTSS2_HUMAN (Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.543e-24
Identity = 68/218 (31.19%), Postives = 121/218 (55.50%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
            A +ND+KSS   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK+    + KD   + KRA+ ++KK  S+  KL+ K+ K L + K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L
Sbjct:   17 AIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKEL-LGKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDL 228          
BLAST of Metastasis suppressor 1 vs. UniProt/SwissProt
Match: sp|O43312|MTSS1_HUMAN (Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 4.723e-24
Identity = 69/223 (30.94%), Postives = 123/223 (55.16%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNK-RLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            I+D+K S   WED   K+ KL + L+ TV    +  ++   ++D+  N++  G  + G+ L+ + ++ +SI  KL   +S++ + L + L   ++ WK+    + KD   + K+A+ ++KK  S+  KL+ K+ K R  I           Q+D A Q++ +K   LEE E+ ++RK + EER R+  FI  LRPV++ ++SM  E+  LQ + + L S + D
Sbjct:   20 ISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTR-GGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQP---------QLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMD 232          
BLAST of Metastasis suppressor 1 vs. UniProt/SwissProt
Match: sp|Q6P9S0|MTSS2_MOUSE (Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.559e-24
Identity = 73/244 (29.92%), Postives = 131/244 (53.69%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+KSS   WED   K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK++   + KD   + KRA+ ++KK  S+  KL+ K+ K     K  L      Q+D A Q++ +    LEE E+ ++R+ + EER R+  FI  L+PV++ +L+M  E+  LQ + D L    T D   LPP  +  +++ +  D
Sbjct:   17 AIVNDMKSSYPIWEDFNSKAAKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARK----GKGDLQP----QLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGIIDDLV-VLTADPHKLPPASEQVIKDLKGSD 250          
BLAST of Metastasis suppressor 1 vs. UniProt/SwissProt
Match: sp|Q8R1S4|MTSS1_MOUSE (Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.512e-24
Identity = 67/222 (30.18%), Postives = 123/222 (55.41%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTD 744
            I+D+K S   WED   K+ KL + L+ TV    +  ++   ++D+  N++  G  + G+ L+ + ++ +SI  KL   +S++ + L + L   ++ WK+    + KD   + K+A+ ++K   S+  KL+ K+ K   ++     D    Q+D A Q++ +K   LEE E+ ++RK + EER R+  FI  LRPV++ ++SM  E+  LQ + + L S + D
Sbjct:   20 ISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTR-GGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKNKSSDTLKLQKKAKK---VDAQGRGD-IQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMD 236          
BLAST of Metastasis suppressor 1 vs. TrEMBL
Match: A0A0B7A6N4 (IMD domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF96433 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.613e-28
Identity = 79/242 (32.64%), Postives = 136/242 (56.20%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            INDL+ S   WED   KS KL+T+LK TV    +  E+   ++D+  +SK     + G+ L+ + ++ +SI + L  L SS+ +NL + L   ++ WK+++A I KD   + K+AK D+KKA S+  +L+ K  K  T  K  +      ++D A  ++ +K   LEE E+ S+R  + EER+R+  FI CL+P +D +L +  E+  +  + + L   ++D  +ILP   +  + + + VD
Sbjct:   33 INDLRGSSPIWEDFTYKSVKLHTSLKTTVVAVGAFLEAFQKVADMATSSK-GATREIGSALTRLCMRHRSIESHLKALTSSILDNLVAPLQDKLEDWKKSVAQIDKDHSRENKKAKQDIKKAASDTIRLQKKVRKGSTHGKSDMQQ----KLDSAMLDVNSKYHQLEETEKNSVRSALIEERSRFCLFITCLKPFVDQELKLLTEMTHINEIMENLCMQASDP-AILPASSEQVIMDLKGVD 268          
BLAST of Metastasis suppressor 1 vs. TrEMBL
Match: A0A0B7A3X7 (IMD domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF96429 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.968e-27
Identity = 79/242 (32.64%), Postives = 136/242 (56.20%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            INDL+ S   WED   KS KL+T+LK TV    +  E+   ++D+  +SK     + G+ L+ + ++ +SI + L  L SS+ +NL + L   ++ WK+++A I KD   + K+AK D+KKA S+  +L+ K  K  T  K  +      ++D A  ++ +K   LEE E+ S+R  + EER+R+  FI CL+P +D +L +  E+  +  + + L   ++D  +ILP   +  + + + VD
Sbjct:   33 INDLRGSSPIWEDFTYKSVKLHTSLKTTVVAVGAFLEAFQKVADMATSSK-GATREIGSALTRLCMRHRSIESHLKALTSSILDNLVAPLQDKLEDWKKSVAQIDKDHSRENKKAKQDIKKAASDTIRLQKKVRKGSTHGKSDMQQ----KLDSAMLDVNSKYHQLEETEKNSVRSALIEERSRFCLFITCLKPFVDQELKLLTEMTHINEIMENLCMQASDP-AILPASSEQVIMDLKGVD 268          
BLAST of Metastasis suppressor 1 vs. TrEMBL
Match: A0A0B7A4B2 (IMD domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF96425 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 6.099e-27
Identity = 79/242 (32.64%), Postives = 137/242 (56.61%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            INDL+ S   WED   KS KL+T+LK TV    +  E+   ++D+  +SK +   + G+ L+ + ++ +SI + L  L SS+ +NL + L   ++ WK+++A I KD   + K+AK D+KKA S+  +L+ K  K  T  K  +      ++D A  ++ +K   LEE E+ S+R  + EER+R+  FI CL+P +D +L +  E+  +  + + L   ++D  +ILP   +  + + + VD
Sbjct:   33 INDLRGSSPIWEDFTYKSVKLHTSLKTTVVAVGAFLEAFQKVADMATSSKGA-TREIGSALTRLCMRHRSIESHLKALTSSILDNLVAPLQDKLEDWKKSVAQIDKDHSRENKKAKQDIKKAASDTIRLQKKVRKGSTHGKSDMQQ----KLDSAMLDVNSKYHQLEETEKNSVRSALIEERSRFCLFITCLKPFVDQELKLLTEMTHINEIMENLCMQASDP-AILPASSEQVIMDLKGVD 268          
BLAST of Metastasis suppressor 1 vs. TrEMBL
Match: A0A553QHX9 (Uncharacterized protein OS=Danionella translucida OX=623744 GN=DNTS_016323 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.978e-26
Identity = 70/229 (30.57%), Postives = 127/229 (55.46%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            +ND+K+S  AWED   K  KL + L+ T+   +S  ++   ++DI   ++     + G+ L+ + ++ +SI NKL +  +++ +NL + L   I+ WK+  + + KD   + K+A+ ++KK  S+  KL+ K  K          D   +Q+D A Q++  +   LEE E+ ++ + + EER R+  F+  L+PVLD ++SM  E+  LQ + + L  + T D + LPP
Sbjct:   64 MNDMKASYPAWEDFVTKGAKLQSQLRTTIIVTSSFLDAFQKVADIATGTR-GATKEIGSALTRMCMRHRSIENKLKLFTTALMDNLIAPLELKIEEWKKVASQLDKDHAKEYKKARSEIKKKSSDTIKLQKKVRKG--------KDEVRMQLDNALQDVNTRYAILEETEKRAVCRALIEERGRFCSFVTMLKPVLDEEISMLGEVTHLQTILEDL-GNLTADPNTLPP 282          
BLAST of Metastasis suppressor 1 vs. TrEMBL
Match: A0A553QHY9 (Uncharacterized protein OS=Danionella translucida OX=623744 GN=DNTS_016323 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 7.417e-26
Identity = 70/229 (30.57%), Postives = 127/229 (55.46%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            +ND+K+S  AWED   K  KL + L+ T+   +S  ++   ++DI   ++     + G+ L+ + ++ +SI NKL +  +++ +NL + L   I+ WK+  + + KD   + K+A+ ++KK  S+  KL+ K  K          D   +Q+D A Q++  +   LEE E+ ++ + + EER R+  F+  L+PVLD ++SM  E+  LQ + + L  + T D + LPP
Sbjct:   64 MNDMKASYPAWEDFVTKGAKLQSQLRTTIIVTSSFLDAFQKVADIATGTR-GATKEIGSALTRMCMRHRSIENKLKLFTTALMDNLIAPLELKIEEWKKVASQLDKDHAKEYKKARSEIKKKSSDTIKLQKKVRKG--------KDEVRMQLDNALQDVNTRYAILEETEKRAVCRALIEERGRFCSFVTMLKPVLDEEISMLGEVTHLQTILEDL-GNLTADPNTLPP 282          
BLAST of Metastasis suppressor 1 vs. Ensembl Cavefish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 117.087 bits (292), Expect = 6.939e-27
Identity = 67/229 (29.26%), Postives = 122/229 (53.28%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            +ND+K+S   WED   K  KL + L+ T+    S  ++   ++DI   ++     + G+ L+ + ++ +SI +KL +  +++ +NL   L   I+ WK+    + KD   + K+A+ D+KK  S+  +L+ K  K          D   +Q+D A Q++  +   LEE E+ ++ + + EER R+  F+  L+PVLD ++ M  E+  LQ + + L  S T + + LPP
Sbjct:   20 MNDMKASYPVWEDFVTKGAKLQSQLRTTIIVTGSFLDAFQKVADIATGTR-GATKEIGSALTRMCMRHRSIESKLKLFTAALMDNLIGPLELKIEEWKKVSGQLDKDHAKEYKKARADIKKKSSDTIRLQKKVKKG--------KDEVRMQLDSALQDVNIRYAELEETEKRAVCRALVEERGRFCSFVTMLKPVLDEEIGMLGEVTHLQSILEDL-CSLTAEPNTLPP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Cavefish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 117.087 bits (292), Expect = 9.627e-27
Identity = 67/229 (29.26%), Postives = 122/229 (53.28%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            +ND+K+S   WED   K  KL + L+ T+    S  ++   ++DI   ++     + G+ L+ + ++ +SI +KL +  +++ +NL   L   I+ WK+    + KD   + K+A+ D+KK  S+  +L+ K  K          D   +Q+D A Q++  +   LEE E+ ++ + + EER R+  F+  L+PVLD ++ M  E+  LQ + + L  S T + + LPP
Sbjct:   20 MNDMKASYPVWEDFVTKGAKLQSQLRTTIIVTGSFLDAFQKVADIATGTR-GATKEIGSALTRMCMRHRSIESKLKLFTAALMDNLIGPLELKIEEWKKVSGQLDKDHAKEYKKARADIKKKSSDTIRLQKKVKKG--------KDEVRMQLDSALQDVNIRYAELEETEKRAVCRALVEERGRFCSFVTMLKPVLDEEIGMLGEVTHLQSILEDL-CSLTAEPNTLPP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Cavefish
Match: mtss1 (MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081105-141])

HSP 1 Score: 116.701 bits (291), Expect = 1.224e-26
Identity = 67/229 (29.26%), Postives = 122/229 (53.28%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            +ND+K+S   WED   K  KL + L+ T+    S  ++   ++DI   ++     + G+ L+ + ++ +SI +KL +  +++ +NL   L   I+ WK+    + KD   + K+A+ D+KK  S+  +L+ K  K          D   +Q+D A Q++  +   LEE E+ ++ + + EER R+  F+  L+PVLD ++ M  E+  LQ + + L  S T + + LPP
Sbjct:   20 MNDMKASYPVWEDFVTKGAKLQSQLRTTIIVTGSFLDAFQKVADIATGTR-GATKEIGSALTRMCMRHRSIESKLKLFTAALMDNLIGPLELKIEEWKKVSGQLDKDHAKEYKKARADIKKKSSDTIRLQKKVKKG--------KDEVRMQLDSALQDVNIRYAELEETEKRAVCRALVEERGRFCSFVTMLKPVLDEEIGMLGEVTHLQSILEDL-CSLTAEPNTLPP 238          
BLAST of Metastasis suppressor 1 vs. Ensembl Cavefish
Match: mtss1lb (MTSS I-BAR domain containing 2 [Source:NCBI gene;Acc:103026560])

HSP 1 Score: 113.235 bits (282), Expect = 1.630e-25
Identity = 68/244 (27.87%), Postives = 130/244 (53.28%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+K S   WED + K+ KL+  L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI +KL    +++  +L + L   I+ WK+T   + KD   + KR++ ++KK  S+  KL+ K+ K               Q+D A Q++ +    +EE E+ ++R+ + EER R+  FI  L+PV++ +++M  E+  LQ + D L   +TD    LPP  +  +++ +  D
Sbjct:   17 AIVNDMKCSYPVWEDFSAKATKLHAQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARKG--------RGDLQPQLDSAMQDVNDMYLLMEETEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHK-LPPASEQVIKDLKGSD 250          
BLAST of Metastasis suppressor 1 vs. Ensembl Cavefish
Match: mtss1lb (MTSS I-BAR domain containing 2 [Source:NCBI gene;Acc:103026560])

HSP 1 Score: 113.235 bits (282), Expect = 1.677e-25
Identity = 65/230 (28.26%), Postives = 123/230 (53.48%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILP 762
            A +ND+K S   WED + K+ KL+  L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI +KL    +++  +L + L   I+ WK+T   + KD   + KR++ ++KK  S+  KL+ K+ K               Q+D A Q++ +    +EE E+ ++R+ + EER R+  FI  L+PV++ +++M  E+  LQ + D L   +TD   + P
Sbjct:   17 AIVNDMKCSYPVWEDFSAKATKLHAQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIESKLRHFTNALMESLINPLQERIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARKG--------RGDLQPQLDSAMQDVNDMYLLMEETEKQAVRRALVEERGRFCTFISFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHKLPP 237          
BLAST of Metastasis suppressor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001774.1 (pep scaffold:Pmarinus_7.0:GL476804:163249:239367:-1 gene:ENSPMAG00000001586.1 transcript:ENSPMAT00000001774.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 2.353e-28
Identity = 73/231 (31.60%), Postives = 127/231 (54.98%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            A IND+K S   WED   K+ KLN+ L+ T     +  ++   ++D+  N++ S   + G+ L+ + I+ +SI +KL  +++++  +L S L   I+ WKR+   + KD   + KR + ++KK  S+  KL+ K  K   ++          Q++ A Q++ +    LEE E+ ++R+ + EER R+  F+  LRPVLD ++SM  E+  LQ +   L ++ T D   LPP
Sbjct:   18 AVINDMKGSYPVWEDFVNKATKLNSQLRTTTVAVVAFLDAFQKVADMATNTRGS-TREIGSALTRVCIRHRSIESKLRQVSTALMESLVSPLQEKIEDWKRSANQLDKDHAKEYKRVRQEIKKKSSDTLKLQKKVRKGKGVD-------VQPQLELALQDVNDSYLLLEETEKGAVRRALIEERGRFCTFVYHLRPVLDQEISMLEEVTHLQTIVQDL-TNMTSDPHRLPP 239          
BLAST of Metastasis suppressor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002029.1 (pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002029.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.612e-13
Identity = 46/149 (30.87%), Postives = 81/149 (54.36%), Query Frame = 1
Query:  319 SVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            ++ +NL   L   ++ WK+T A + KD   + K+A+ ++KK  ++  +L+ K+ K +  N+          +D A Q + +    L+E E+ ++R+ + EER+RY  F   LR VL  +++M  ++  LQ + D L SS T D   LPP
Sbjct:    1 ALASNLLGPLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKKEIIGNR-----EVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDL-SSLTKDPHALPP 143          
BLAST of Metastasis suppressor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002039.1 (pep scaffold:Pmarinus_7.0:GL477038:84867:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 3.497e-12
Identity = 45/149 (30.20%), Postives = 79/149 (53.02%), Query Frame = 1
Query:  319 SVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            ++ +NL   L   ++ WK+T A + KD   + K+A+ ++KK  ++  +L+ K+ K         +      +D A Q + +    L+E E+ ++R+ + EER+RY  F   LR VL  +++M  ++  LQ + D L SS T D   LPP
Sbjct:    1 ALASNLLGPLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKKG--------NREVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDL-SSLTKDPHALPP 140          
BLAST of Metastasis suppressor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002035.1 (pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 gene:ENSPMAG00000001830.1 transcript:ENSPMAT00000002035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 5.604e-12
Identity = 45/149 (30.20%), Postives = 79/149 (53.02%), Query Frame = 1
Query:  319 SVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPP 765
            ++ +NL   L   ++ WK+T A + KD   + K+A+ ++KK  ++  +L+ K+ K         +      +D A Q + +    L+E E+ ++R+ + EER+RY  F   LR VL  +++M  ++  LQ + D L SS T D   LPP
Sbjct:    1 ALASNLLGPLQEKLEEWKKTAAQLDKDHAKEYKKARQEIKKKSTDTIRLQKKAKKG--------NREVQPALDSALQEVTDTYLLLQEEEKQAVRRALLEERSRYCTFTYMLRDVLTHEVAMLGDVTHLQAILDDL-SSLTKDPHALPP 140          
BLAST of Metastasis suppressor 1 vs. Ensembl Medaka
Match: MTSS2 (MTSS1-like protein [Source:NCBI gene;Acc:101154768])

HSP 1 Score: 114.775 bits (286), Expect = 5.093e-26
Identity = 68/244 (27.87%), Postives = 131/244 (53.69%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+K S   WED + K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK+T   + KD   + KR++ ++KK  S+  KL+ K+ K               Q+D A Q++ +    +EE+E+ ++R+ + EER R+  FI  L+PV++ +++M  E+  LQ + D L   +TD    LPP  +  +++ +  D
Sbjct:   17 AIVNDMKCSYPVWEDFSAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLIAPLQDKIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARKG--------RGDLQPQLDNAVQDVSDMCLLMEEMEKQAVRRALVEERGRFCTFIGFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHK-LPPASEQVIKDLKGSD 250          
BLAST of Metastasis suppressor 1 vs. Ensembl Medaka
Match: MTSS2 (MTSS1-like protein [Source:NCBI gene;Acc:101154768])

HSP 1 Score: 114.005 bits (284), Expect = 8.979e-26
Identity = 68/244 (27.87%), Postives = 131/244 (53.69%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+K S   WED + K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK+T   + KD   + KR++ ++KK  S+  KL+ K+ K               Q+D A Q++ +    +EE+E+ ++R+ + EER R+  FI  L+PV++ +++M  E+  LQ + D L   +TD    LPP  +  +++ +  D
Sbjct:   23 AIVNDMKCSYPVWEDFSAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLIAPLQDKIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARKG--------RGDLQPQLDNAVQDVSDMCLLMEEMEKQAVRRALVEERGRFCTFIGFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHK-LPPASEQVIKDLKGSD 256          
BLAST of Metastasis suppressor 1 vs. Ensembl Medaka
Match: MTSS2 (MTSS1-like protein [Source:NCBI gene;Acc:101154768])

HSP 1 Score: 114.005 bits (284), Expect = 9.614e-26
Identity = 68/244 (27.87%), Postives = 131/244 (53.69%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+K S   WED + K+ KL++ L+ TV    +  ++   ++D+  N++       G+ L+ + ++ +SI  KL    +++  +L + L   I+ WK+T   + KD   + KR++ ++KK  S+  KL+ K+ K               Q+D A Q++ +    +EE+E+ ++R+ + EER R+  FI  L+PV++ +++M  E+  LQ + D L   +TD    LPP  +  +++ +  D
Sbjct:   23 AIVNDMKCSYPVWEDFSAKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTR-GATRDIGSALTRMCMRHRSIEAKLRQFTNALMESLIAPLQDKIEDWKKTANQLDKDHAKEYKRSRHEIKKKSSDTMKLQKKARKG--------RGDLQPQLDNAVQDVSDMCLLMEEMEKQAVRRALVEERGRFCTFIGFLQPVVNGEIAMLGEITHLQAIIDDLTVLTTDPHK-LPPASEQVIKDLKGSD 256          
BLAST of Metastasis suppressor 1 vs. Ensembl Medaka
Match: mtss1la (MTSS1-like protein [Source:NCBI gene;Acc:101164641])

HSP 1 Score: 112.464 bits (280), Expect = 2.318e-25
Identity = 68/244 (27.87%), Postives = 129/244 (52.87%), Query Frame = 1
Query:   73 AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            A +ND+KSS   WED + K+ KL+  L+ T+    +  ++   ++D+  NS+       G+ L+ + ++ +SI  KL   ++ +   L + L   I+ WK+T   + KD   + KR++ ++K+   +  KL+ K+ K               Q+D A Q++ +    +EE E+ ++R+ + EER RY  FI  L+PV++ +++M  E+  LQ + + L +  T+D   LPP  +  +R+ +  D
Sbjct:   17 AIVNDMKSSYPVWEDFSAKATKLHAQLRTTILAAVAFLDAFQKVADMATNSR-GATRDIGSALTRMCMRHRSIEAKLRHFSNVLMEGLVTPLQDRIEEWKKTANQLDKDHTKEYKRSRQEIKRKSLDTIKLQKKARKG--------RGNLRPQLDSAMQDVNDLYLLMEETEKQAVRRALLEERGRYCSFISLLQPVVNVEIAMLGEITHLQAIVEDL-TVLTEDPHKLPPASEQVIRDLKGSD 250          
BLAST of Metastasis suppressor 1 vs. Ensembl Medaka
Match: MTSS1 (metastasis suppressor protein 1 [Source:NCBI gene;Acc:101157392])

HSP 1 Score: 112.464 bits (280), Expect = 2.804e-25
Identity = 75/243 (30.86%), Postives = 125/243 (51.44%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNK-RLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVD 804
            I D+KSS   WED   K+ KL + L+ T     +  ++   ++D+  NS+  G    G+ L+ + ++ +SI  KL   +      L + L   ++ WKR +  + KD   + K+A+ ++KK  S+  KL+ K+ K R  I           Q++ A Q++ +K   LEE E+ +LRK + EER R+  F+  LRPV+D + SM  EL  LQ + + L  + T D   LPP  +  + + +  D
Sbjct:   20 IGDMKSSCPIWEDFINKAGKLQSQLRATAVAVAAFLDAFQKVADLATNSR-GGTRDIGSALTRMCMRHRSIEAKLKQFSMCFLEGLINPLQEQMEEWKRGVNTLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQP---------QLNSAMQDVSDKYILLEETEKQALRKALIEERQRFCCFVAMLRPVVDEETSMLGELTHLQTISEDL-KALTSDPHKLPPACEQVITDLKASD 251          
BLAST of Metastasis suppressor 1 vs. Planmine SMEST
Match: SMESG000031527.1 (SMESG000031527.1)

HSP 1 Score: 1150.58 bits (2975), Expect = 0.000e+0
Identity = 598/603 (99.17%), Postives = 602/603 (99.83%), Query Frame = 1
Query:   34 MASGDENNYLSLSAYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREYQPVDXXXXXXXXXXXXXXXXQLSLSGSHCSFESSYTLPIYCHMLNSSCSSSEFQKNDKQLDNSSSTIVDINANSSQYAMXXXXXXXXXXXXXXXKLDQKLPSSVLEEPLYPNQAIPPPRYSNLRELKQIADKKYGTVSSVRDQTESTYGDCIRSSLFVNNDIPKQSHYQDNLNYSQNHNYKDIDGYGSVYDSISDVTNSTSTFKRRKPSVITAIETPKINNDRICLQNGIRSDIRNNRSASVNRSCSQISQVCSGVEKTHLGSRLPPSRNGGIENVRNSMYAGDIPMAQSATGMYMSTNQLQQQRITDNSFNCKNSLSNDLQFKQQLLKVIQGDRQIPQKPVSIISSQMF 1842
            MASGDENNYLSLSAYINDLKSSISAWEDMAMKSQKLNTNLKIT QNFN+IAESLTLLS+IKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVR+YQPVDSSRVSSVSSLYSRANSQLSLSGSHCSFESSYTLPIYCHMLNSSCSSSEFQKNDKQLDNSSSTIVDINANSSQYAMTDNNDSDEETSSSDEKLDQKLPSSVLEEPLYPNQAIPPPRYSNLRELKQIADKKYGTVSSVRDQTESTYGDCIRSSLFVNNDIPKQSHYQDNLNYSQNHNYKDIDGYGSVYDSISDVTNSTSTFKRRKPSVITAIETPKINNDRICLQNGIRSDIRNNRSASVNRSCSQISQVCSGVEKTHLGSRLPPSRNGG+ENVRNSMYAGDIPMAQSATGMYMSTNQLQQQRITDNSFNCKNSLSNDLQFKQQLLKVIQGDRQIPQKPVSIISSQMF
Sbjct:    1 MASGDENNYLSLSAYINDLKSSISAWEDMAMKSQKLNTNLKITAQNFNAIAESLTLLSNIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVRQYQPVDSSRVSSVSSLYSRANSQLSLSGSHCSFESSYTLPIYCHMLNSSCSSSEFQKNDKQLDNSSSTIVDINANSSQYAMTDNNDSDEETSSSDEKLDQKLPSSVLEEPLYPNQAIPPPRYSNLRELKQIADKKYGTVSSVRDQTESTYGDCIRSSLFVNNDIPKQSHYQDNLNYSQNHNYKDIDGYGSVYDSISDVTNSTSTFKRRKPSVITAIETPKINNDRICLQNGIRSDIRNNRSASVNRSCSQISQVCSGVEKTHLGSRLPPSRNGGMENVRNSMYAGDIPMAQSATGMYMSTNQLQQQRITDNSFNCKNSLSNDLQFKQQLLKVIQGDRQIPQKPVSIISSQMF 603          
BLAST of Metastasis suppressor 1 vs. Planmine SMEST
Match: SMESG000038660.1 (SMESG000038660.1)

HSP 1 Score: 153.68 bits (387), Expect = 1.557e-38
Identity = 86/238 (36.13%), Postives = 149/238 (62.61%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREY 792
            IN LKS++  WED+  KS K + ++K+   + + + +SL  + DI   S    +   G  L+ + +++K I  K+S LNS +  NL+S+L   +  W++T  N+K++   D K+A ++ +K+ +E  + E K  K+    K  LS+T SLQIDYA Q+ QNK+R++EELER ++R+   EER R+KQF+  L+P+LD QLSM+ +L+ L+ +  +LY   +++L   P +++  ++E+
Sbjct:   13 INSLKSNLCIWEDLISKSLKFHNSIKLMTLSSSDLLDSLHSVCDIASKSPCC-IKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKK-NAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEH 248          
BLAST of Metastasis suppressor 1 vs. Planmine SMEST
Match: SMESG000038660.1 (SMESG000038660.1)

HSP 1 Score: 153.295 bits (386), Expect = 1.695e-38
Identity = 86/238 (36.13%), Postives = 149/238 (62.61%), Query Frame = 1
Query:   79 INDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYVREY 792
            IN LKS++  WED+  KS K + ++K+   + + + +SL  + DI   S    +   G  L+ + +++K I  K+S LNS +  NL+S+L   +  W++T  N+K++   D K+A ++ +K+ +E  + E K  K+    K  LS+T SLQIDYA Q+ QNK+R++EELER ++R+   EER R+KQF+  L+P+LD QLSM+ +L+ L+ +  +LY   +++L   P +++  ++E+
Sbjct:   13 INSLKSNLCIWEDLISKSLKFHNSIKLMTLSSSDLLDSLHSVCDIASKSPCC-IKNTGISLTKLVLRQKKIEQKVSTLNSYLNENLSSELDKFLVEWRKTSLNLKRERDHDWKKANLEYQKSLAEVERTEKKLRKK-NAGKVGLSETASLQIDYANQDAQNKRRYVEELERSAMRRAAIEERQRFKQFLVLLKPILDCQLSMREDLDNLEEVVSQLYGEKSENLDEFPEELEQNIQEH 248          
BLAST of Metastasis suppressor 1 vs. Planmine SMEST
Match: SMESG000038576.1 (SMESG000038576.1)

HSP 1 Score: 122.094 bits (305), Expect = 1.436e-28
Identity = 71/231 (30.74%), Postives = 131/231 (56.71%), Query Frame = 1
Query:   52 NNYLSLS----AYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKLYS 732
            NN+ SLS      ++DLK SI  W+D+ +K  +L+  ++  VQ  +S  ES   ++D+  NS        G  L+ + ++++S+  K+  +N S+   +   +   +D WKR    I KD   + +RAK +LKKA  E ++L+ K+ KR ++       +  +Q++ A +   +K + LE +E   +R+VV EER+R+  F++CL PVL+ Q++M +E++ L+ + + + S
Sbjct:    6 NNFKSLSELFDCTLSDLKGSIPLWDDLVIKITRLHAAMRSVVQANSSFLESFQKIADLATNSSALASKDIGTSLTRLSLRQRSLHLKMKTMNESMACRIIDPMQQRLDEWKRCNLQIDKDRIKETRRAKSELKKASEEKNRLQKKAMKRGSMKGLG---SLQMQVEVALKEAADKYQALENIEYDCVRRVVIEERSRFCYFVNCLMPVLECQINMFSEMQTLEEIRNTITS 233          
BLAST of Metastasis suppressor 1 vs. Planmine SMEST
Match: SMESG000028682.1 (SMESG000028682.1)

HSP 1 Score: 79.337 bits (194), Expect = 5.251e-15
Identity = 54/214 (25.23%), Postives = 108/214 (50.47%), Query Frame = 1
Query:   85 DLKSSISAWEDMAMKSQKLNTNLKITVQNFNSIAESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNNLASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNKRLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRYKQFIDCLRPVLDAQLSMKAELEELQLLYDKL 726
            D K+S   WED   KS KL+  LK  +    +  E+   ++D+  +++     + G   + + ++++ +  K+  L++ +  +L++ +   ++ WKR    + KD   + K+AK   KKA  E  +L+ K+ KR ++       +   Q++ A +N   K   L+ +E   LR+ +  ER R+     C++PVL++Q+S+  ++  L  L   L
Sbjct:    8 DFKNSSPIWEDFLSKSNKLHNALKNVLLCSTAFWEAFQKIADLATDTQ-GATKEIGASFTRLCMRQRLMECKIKTLSNHLIGSLSNPVQDKLEDWKRYSNQLDKDRIKETKKAKTHWKKASGESVRLQKKAVKRGSMRGLG---SLQNQVEGALKNAAEKYTSLQTVESIYLRRAMTHERERFCFLFSCMKPVLESQISLLTDISSLDELMKTL 217          
The following BLAST results are available for this feature:
BLAST of Metastasis suppressor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTSS13.946e-2630.63MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
MTSS27.377e-2531.19MTSS I-BAR domain containing 2 [Source:HGNC Symbol... [more]
MTSS19.835e-2530.94MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
MTSS11.888e-2430.94MTSS I-BAR domain containing 1 [Source:HGNC Symbol... [more]
MTSS24.526e-2330.28MTSS I-BAR domain containing 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
M04F3.55.201e-1025.11pep chromosome:WBcel235:I:4773818:4788358:-1 gene:... [more]
M04F3.55.369e-1025.11pep chromosome:WBcel235:I:4773818:4777717:-1 gene:... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mim2.726e-2530.70gene:FBgn0053558 transcript:FBtr0332941[more]
mim3.434e-2530.70gene:FBgn0053558 transcript:FBtr0332943[more]
mim5.356e-2530.26gene:FBgn0053558 transcript:FBtr0306614[more]
mim5.426e-2530.26gene:FBgn0053558 transcript:FBtr0332942[more]
mim5.722e-2530.26gene:FBgn0053558 transcript:FBtr0302578[more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mtss11.282e-2629.26MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss1lb5.666e-2527.87MTSS I-BAR domain containing 2b [Source:ZFIN;Acc:Z... [more]
mtss1la1.157e-2328.57MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:Z... [more]
mtss1la1.114e-2228.13MTSS I-BAR domain containing 2a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss2.22.852e-2530.28acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.23.743e-2530.28acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.21.764e-2430.28acyl-CoA synthetase short-chain family member 2, g... [more]
acss2.28.881e-1727.04acyl-CoA synthetase short-chain family member 2, g... [more]
ENSXETT00000003339.11.513e-1626.02metastasis suppressor 1, gene 2 [Source:NCBI gene;... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtss12.480e-2530.63MTSS I-BAR domain containing 1 [Source:MGI Symbol;... [more]
Mtss21.081e-2429.92MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss22.807e-1630.27MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss21.990e-1232.19MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
Mtss22.416e-1032.14MTSS I-BAR domain containing 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Metastasis suppressor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q765P7|MTSS2_HUMAN3.543e-2431.19Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE... [more]
sp|O43312|MTSS1_HUMAN4.723e-2430.94Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE... [more]
sp|Q6P9S0|MTSS2_MOUSE7.559e-2429.92Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 P... [more]
sp|Q8R1S4|MTSS1_MOUSE9.512e-2430.18Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 P... [more]
back to top
BLAST of Metastasis suppressor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7A6N42.613e-2832.64IMD domain-containing protein (Fragment) OS=Arion ... [more]
A0A0B7A3X72.968e-2732.64IMD domain-containing protein (Fragment) OS=Arion ... [more]
A0A0B7A4B26.099e-2732.64IMD domain-containing protein OS=Arion vulgaris OX... [more]
A0A553QHX96.978e-2630.57Uncharacterized protein OS=Danionella translucida ... [more]
A0A553QHY97.417e-2630.57Uncharacterized protein OS=Danionella translucida ... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtss16.939e-2729.26MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss19.627e-2729.26MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss11.224e-2629.26MTSS I-BAR domain containing 1 [Source:ZFIN;Acc:ZD... [more]
mtss1lb1.630e-2527.87MTSS I-BAR domain containing 2 [Source:NCBI gene;A... [more]
mtss1lb1.677e-2528.26MTSS I-BAR domain containing 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000001774.12.353e-2831.60pep scaffold:Pmarinus_7.0:GL476804:163249:239367:-... [more]
ENSPMAT00000002029.11.612e-1330.87pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 ... [more]
ENSPMAT00000002039.13.497e-1230.20pep scaffold:Pmarinus_7.0:GL477038:84867:99356:-1 ... [more]
ENSPMAT00000002035.15.604e-1230.20pep scaffold:Pmarinus_7.0:GL477038:82432:99356:-1 ... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metastasis suppressor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTSS25.093e-2627.87MTSS1-like protein [Source:NCBI gene;Acc:101154768... [more]
MTSS28.979e-2627.87MTSS1-like protein [Source:NCBI gene;Acc:101154768... [more]
MTSS29.614e-2627.87MTSS1-like protein [Source:NCBI gene;Acc:101154768... [more]
mtss1la2.318e-2527.87MTSS1-like protein [Source:NCBI gene;Acc:101164641... [more]
MTSS12.804e-2530.86metastasis suppressor protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of Metastasis suppressor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031527.10.000e+099.17SMESG000031527.1[more]
SMESG000038660.11.557e-3836.13SMESG000038660.1[more]
SMESG000038660.11.695e-3836.13SMESG000038660.1[more]
SMESG000038576.11.436e-2830.74SMESG000038576.1[more]
SMESG000028682.15.251e-1525.23SMESG000028682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009412 ID=SMED30009412|Name=Metastasis suppressor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2052bp
AATTCTAAACAGAAAAATTAGTTCAGATCAAATATGGCATCAGGAGATGA
AAATAATTATCTTAGTTTAAGTGCGTATATCAACGATTTAAAATCAAGTA
TTTCTGCATGGGAAGATATGGCAATGAAATCACAAAAACTCAATACTAAT
CTCAAAATTACTGTCCAAAATTTTAATTCTATAGCTGAATCACTAACCCT
TTTAAGTGATATAAAGGACAATTCAAAATTTTCAGGATTATATCAAGCTG
GAAATTTATTATCTGACATTGGTATTCAGGAAAAATCTATTGCTAATAAA
CTTTCTGTGCTCAATAGTTCAGTACAAAACAATCTTGCTTCTAAATTGTC
CTTTCATATCGACAGTTGGAAACGGACAATTGCTAACATTAAAAAAGATT
GCCACACAGACAGAAAGCGAGCGAAAATTGACTTGAAAAAAGCTGAATCG
GAATTTTCAAAATTAGAAAGCAAATCGAATAAGCGATTGACGATAAATAA
GTTTTCTCTGAGCGATACGTTTTCCTTGCAAATCGATTACGCGAAACAAA
ACCTTCAAAACAAGCAACGATTTCTTGAGGAATTGGAAAGATGCTCCTTG
AGAAAAGTTGTCTGTGAAGAAAGAAATCGTTATAAGCAATTCATAGATTG
CTTGAGGCCAGTTTTGGATGCACAATTGTCTATGAAAGCTGAATTAGAAG
AATTGCAATTGTTATATGATAAATTGTATTCTTCATCTACAGACGATTTG
AGTATATTACCACCTGATATTGACGCTTATGTTAGAGAGTATCAGCCGGT
TGATAGTTCCAGAGTAAGTAGTGTTTCAAGTCTGTATTCAAGAGCAAATA
GCCAACTGAGTTTATCTGGTAGTCATTGCTCGTTTGAAAGTTCTTACACT
CTTCCGATATATTGTCATATGCTCAATTCATCTTGTAGTTCTTCTGAATT
TCAAAAAAATGATAAACAACTTGACAATAGCTCTTCAACAATCGTTGACA
TAAACGCCAATTCATCTCAATATGCAATGACAGATAATAATGATAGTGAT
GAAGAGACTTCTAGTAGTGATGAGAAATTAGATCAGAAACTCCCTTCCTC
TGTACTTGAGGAACCTCTTTATCCAAATCAAGCCATACCACCACCTCGAT
ATTCCAATTTACGGGAATTGAAACAAATTGCCGACAAAAAATATGGAACA
GTTAGCTCAGTTCGTGATCAAACTGAATCAACATACGGAGATTGTATACG
CAGTTCATTATTTGTAAATAATGACATTCCAAAACAATCTCATTATCAAG
ATAATTTAAATTATTCCCAGAATCACAATTATAAAGACATTGACGGATAT
GGGTCTGTTTACGATTCCATTTCTGATGTCACCAACAGCACTTCAACTTT
CAAACGACGAAAACCCAGTGTAATAACAGCTATTGAAACCCCGAAAATTA
ACAATGATAGAATTTGTCTTCAAAATGGAATAAGATCAGATATAAGAAAT
AATCGCAGTGCTAGCGTGAACCGAAGTTGTAGTCAAATTTCTCAAGTTTG
TAGTGGTGTAGAAAAAACACATTTGGGTTCCAGATTGCCTCCAAGTCGAA
ATGGCGGCATCGAGAATGTCCGTAACAGTATGTATGCGGGGGATATTCCT
ATGGCTCAATCGGCAACAGGGATGTATATGTCCACTAATCAATTGCAGCA
GCAACGAATCACAGATAACAGTTTCAACTGTAAAAATTCTCTCAGCAATG
ATTTACAGTTTAAACAGCAATTGCTTAAGGTAATCCAAGGAGACAGACAA
ATCCCACAAAAGCCAGTCTCAATAATATCTAGTCAAATGTTCTAGGACTC
ATTGAAACCTTTCAATGGCTATTAACTGCATTTACACGAATTACGCATTC
ACTTCTTTCTTATAATGTGCTGCTGGTCACTTCAATTTCTTTATTGTATG
AATTTAAGTGGTGCCTTTCCACTCCGTCATTGACAAAATCTATGTATTGT
TCGTTCAGTAATGCTCATACTACCATGTACACTGAATTTTCTGAGATCGG
AA
back to top

protein sequence of SMED30009412-orf-1

>SMED30009412-orf-1 ID=SMED30009412-orf-1|Name=SMED30009412-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=604bp
MASGDENNYLSLSAYINDLKSSISAWEDMAMKSQKLNTNLKITVQNFNSI
AESLTLLSDIKDNSKFSGLYQAGNLLSDIGIQEKSIANKLSVLNSSVQNN
LASKLSFHIDSWKRTIANIKKDCHTDRKRAKIDLKKAESEFSKLESKSNK
RLTINKFSLSDTFSLQIDYAKQNLQNKQRFLEELERCSLRKVVCEERNRY
KQFIDCLRPVLDAQLSMKAELEELQLLYDKLYSSSTDDLSILPPDIDAYV
REYQPVDSSRVSSVSSLYSRANSQLSLSGSHCSFESSYTLPIYCHMLNSS
CSSSEFQKNDKQLDNSSSTIVDINANSSQYAMTDNNDSDEETSSSDEKLD
QKLPSSVLEEPLYPNQAIPPPRYSNLRELKQIADKKYGTVSSVRDQTEST
YGDCIRSSLFVNNDIPKQSHYQDNLNYSQNHNYKDIDGYGSVYDSISDVT
NSTSTFKRRKPSVITAIETPKINNDRICLQNGIRSDIRNNRSASVNRSCS
QISQVCSGVEKTHLGSRLPPSRNGGIENVRNSMYAGDIPMAQSATGMYMS
TNQLQQQRITDNSFNCKNSLSNDLQFKQQLLKVIQGDRQIPQKPVSIISS
QMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR030127MTSS1/MTSS2
IPR013606I-BAR_dom
Vocabulary: biological process
TermDefinition
GO:0007009plasma membrane organization
GO:0030036actin cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 127..147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 326..372
NoneNo IPR availablePANTHERPTHR15708:SF14METASTASIS SUPPRESSOR 1coord: 15..316
IPR013606IMD/I-BAR domainPFAMPF08397IMDcoord: 16..234
e-value: 2.0E-23
score: 82.9
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 7..251
e-value: 6.7E-42
score: 145.2
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 5..246
IPR030127I-BAR domain containing protein MTSS1/MTSS2PANTHERPTHR15708ACTIN BUNDLING/MISSING IN METASTASIS-RELATEDcoord: 15..316