Phospholipid-transporting ATPase

Overview
NamePhospholipid-transporting ATPase
Smed IDSMED30009405
Length (bp)3658
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipid-transporting ATPase (SMED30009405) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipid-transporting ATPase (SMED30009405) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid-transporting ATPase (SMED30009405) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid-transporting ATPase (SMED30009405) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009405

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009405SMESG000047015.1 Contig5468GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009405SMESG000000504.1 Contig5468GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30009405SMESG000000504.1 dd_Smed_v4_1372_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009405SMESG000000504.1 dd_Smed_v4_1372_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30009405SMESG000000504.1 dd_Smed_v4_1372_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:HGNC Symbol;Acc:HGNC:13531])

HSP 1 Score: 1240.71 bits (3209), Expect = 0.000e+0
Identity = 616/1158 (53.20%), Postives = 812/1158 (70.12%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK---------GPDETFSAQ-------KDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG  VK+ NG+ +PADL+ L+SSEP  M YIETSNLDGETNLK+RQGLP T DI  +  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL  +    S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG           PDE  ++Q        D +LLE L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSVIV+TP  K+ L+ KGAD VIY+RL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++++W+  +  AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+LL +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  +TLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL++HGAWNYNR++K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  + ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVAVGEIVKVTNGEHLPADLISLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDVDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGHVPEPEDYGCSPDEWQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVIVRTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYQRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLKKNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTAFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAIPMAPDMSGEAAMLFSSGVFWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1162          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:HGNC Symbol;Acc:HGNC:13531])

HSP 1 Score: 1240.33 bits (3208), Expect = 0.000e+0
Identity = 615/1146 (53.66%), Postives = 811/1146 (70.77%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK----GPDETFSAQKDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG+ V +   + IPAD VLL+SSEP  M YIETSNLDGETNLK+RQGLP T DI  +  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL  +    S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG+    G ++TFS   D +LLE L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSVIV+TP  K+ L+ KGAD VIY+RL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++++W+  +  AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+LL +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  +TLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL++HGAWNYNR++K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  + ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVNVGDIVIIKGKEYIPADTVLLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDVDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGQNSQFGDEKTFS---DSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVIVRTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYQRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLKKNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTAFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAIPMAPDMSGEAAMLFSSGVFWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1147          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP8A2 (ATPase phospholipid transporting 8A2 [Source:HGNC Symbol;Acc:HGNC:13533])

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 629/1136 (55.37%), Postives = 807/1136 (71.04%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERF-FNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYGDSE---VDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            R + +N P   K+  N+ISTAKY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL IILTI+ IKEIVED+KRHKAD++ N  K ++L+N  W  I WK++ VG+ VK++NGQ +PAD+VLL+SSEP  M Y+ET+NLDGETNLK+RQGL  T D+ T   LMK+ G I CE PNRHLY+F GNL LDG+  ++LG DQ+LLRG  L+NT+WVFGIVVY+GH+TK+M NST  PLKRS+VE++TN  IL L G+LL + L +S   + W  ++ +  WY+   +K  +  + F +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD +MY    +TPA ARTSNLNEELGQV+Y+FSDKTGTLT N+M FK+CSI G+ YG  P+       + F              DP LL+ ++        +  F   LAVCHTVVPEK+ + IIYQASSPDE+ALVK AK++G++F  RTP  + I    +   + +LNVLEF+S RKRMSVIV+TP  ++ L+ KGADNVI+ERLS  SK  + TL +LE FA  GLRTLC+AYA++  NEYE+W   + EAS  +++R  +L    E IEKNL+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETA+NIGYSC+L++QNM+L +L  DSLD TR  + +     G  +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK  +K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+F+RSC+ E+ L++PQLY+  Q    F+ KVF    +N+L HSLILFW  + A  HD    +G     LF+GN +YTYVVVTV +KAGLE  AWT  SHLA+WGS++ W V+F IYS ++  + ++  M      V SS  FWLGL L+P+A L  D+AW+A K T  ++L E V ++E +++  GK +  D   K  N       +LG  T PT+   ++     P    GYAFSQEEHG VSQ ++IR Y++T KK
Sbjct:   56 RTIYLNQPHLNKFRDNQISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLIIILTIAGIKEIVEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVVNGQYLPADVVLLSSSEPQAMCYVETANLDGETNLKIRQGLSHTADMQTREVLMKLSGTIECEGPNRHLYDFTGNLNLDGKSLVALGPDQILLRGTQLRNTQWVFGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSAGALYWNRSHGEKNWYI---KKMDTTSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDTDMYYIGNDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDNIIYQASSPDEAALVKGAKKLGFVFTARTPFSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRTPSGRLRLYCKGADNVIFERLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASTILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGNLLGKENDVALIIDGHTLKYALSFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKKRVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYKITQNGEGFNTKVFWGHCINALVHSLILFWFPMKALEHDTVLTSGHATDYLFVGNIVYTYVVVTVCLKAGLETTAWTKFSHLAVWGSMLTWLVFFGIYSTIWPTIPIAPDMRGQATMVLSSAHFWLGLFLVPTACLIEDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPH---GYAFSQEEHGAVSQEEVIRAYDTTKKK 1184          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP8B4 (ATPase phospholipid transporting 8B4 (putative) [Source:HGNC Symbol;Acc:HGNC:13536])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 454/1114 (40.75%), Postives = 700/1114 (62.84%), Query Frame = 1
Query:  112 SVEELKETTSQRIVNIN---HPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDI-LTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGF--DRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDE-----TFSAQKDP------------------NLLEKLKYGDSEVDMFFKALAVCHTVVPEKED-NEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNG-KLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMS-LCILDSDSLDKTRTQLIEVRQG-FGENIGKEN-----------------------DIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQ-TGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFV---------YFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEK 3255
            S ++L+E   +RIV  N   + +  +Y  N+I T+KYN LTF+P  LFEQF+R AN +FL + ILQ  P +S    +TT VPL +++T++A+K+  +DY RHK+D+  NN +  +L NS+     W  ++VG+ +KL N Q + ADL+LL+SSEPHG+ Y+ET+ LDGETNLK+R  L  T ++   I+ L    G + CEVPN  L +F G L+    K  SL N++++LRG  L+NT W FG+V+++G +TK+M NS     KR+S++R+ N  +L + G L+ L +  +I N +W +   D      F  + +  S +  F  F +++I+ NT++PISL V++EV+R   ++FINWD +MY      PA ART+ LNEELGQ+ YIFSDKTGTLT+N+M FK+CSI G IYG+  D+       + +K+P                  +L+E +K GD +V  F + LA+CHTV+ E+    E+IYQ  SPDE ALV AA+  G+IF +RTP+ I I        Y++L  L+F + RKRMSVIV+ P+ +I L++KGAD +++E+L  +++    LT D+L EFA  GLRTL IAY ++D   +++W     +A+ + E R+ ++A + E+IE++L+L+GA+A+EDKLQ+ V ET+++L+ A IKIWVLTGDKQETA+NIGY+C +LT +M+ + ++  ++  + R +L + +Q  FG+N    N                       D  L+++G +L  AL+   ++D L++A  CK VICCRV+P QKA+VV LVK   ++A+TLAIGDGANDV MI++AH+G+GISG EG QA   SDY+ AQFR+L RLLLVHG W+Y R+ K + Y FYKN  F ++ FWF    GFS Q ++++W I  +N+++T+ P LA+G+FD+  S +NS+  PQLY+  Q +  F+ + F   +L+ +Y SL+LF++   A  +++   +GQ           + T +V+ VSV+  L+   WT+++H+ IWGS+  +F           F I+ + F  VG +A  +L  + +      WL ++L   A++   +A++ +K  L+ +L +++ + +K
Sbjct:    4 SEKKLREV--ERIVKANDREYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYFLCLLILQLIPEISSLTWFTTIVPLVLVITMTAVKDATDDYFRHKSDNQVNNRQSEVLINSKLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRHALSVTSELGADISRLAGFDGIVVCEVPNNKLDKFMGILSWKDSKH-SLNNEKIILRGCILRNTSWCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLICLGIILAIGNSIWESQTGDQFRTFLFWNEGEKSSVFSGFLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDRKMYYSRKAIPAVARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELIYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNTRKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEVLLSLTSDHLSEFAGEGLRTLAIAYRDLDDKYFKEWHKMLEDANAATEERDERIAGLYEEIERDLMLLGATAVEDKLQEGVIETVTSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFVIAGNNAVEVREELRKAKQNLFGQNRNFSNGHVVCEKKQQLELDSIVEETITGDYALIINGHSLAHALESDVKNDLLELACMCKTVICCRVTPLQKAQVVELVKK-YRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQAVLASDYSFAQFRYLQRLLLVHGRWSYFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGIFDQDVSDQNSVDCPQLYKPGQLNLLFNKRKFFICVLHGIYTSLVLFFIPYGA-FYNVAGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTFINHVFIWGSIAIYFSILFTMHSNGIFGIFPNQFPFVG-NARHSLTQKCI------WLVILLTTVASVMPVVAFRFLKVDLYPTLSDQIRRWQK 1105          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP8B4 (ATPase phospholipid transporting 8B4 (putative) [Source:HGNC Symbol;Acc:HGNC:13536])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 454/1114 (40.75%), Postives = 700/1114 (62.84%), Query Frame = 1
Query:  112 SVEELKETTSQRIVNIN---HPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDI-LTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGF--DRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDE-----TFSAQKDP------------------NLLEKLKYGDSEVDMFFKALAVCHTVVPEKED-NEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNG-KLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMS-LCILDSDSLDKTRTQLIEVRQG-FGENIGKEN-----------------------DIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQ-TGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFV---------YFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEK 3255
            S ++L+E   +RIV  N   + +  +Y  N+I T+KYN LTF+P  LFEQF+R AN +FL + ILQ  P +S    +TT VPL +++T++A+K+  +DY RHK+D+  NN +  +L NS+     W  ++VG+ +KL N Q + ADL+LL+SSEPHG+ Y+ET+ LDGETNLK+R  L  T ++   I+ L    G + CEVPN  L +F G L+    K  SL N++++LRG  L+NT W FG+V+++G +TK+M NS     KR+S++R+ N  +L + G L+ L +  +I N +W +   D      F  + +  S +  F  F +++I+ NT++PISL V++EV+R   ++FINWD +MY      PA ART+ LNEELGQ+ YIFSDKTGTLT+N+M FK+CSI G IYG+  D+       + +K+P                  +L+E +K GD +V  F + LA+CHTV+ E+    E+IYQ  SPDE ALV AA+  G+IF +RTP+ I I        Y++L  L+F + RKRMSVIV+ P+ +I L++KGAD +++E+L  +++    LT D+L EFA  GLRTL IAY ++D   +++W     +A+ + E R+ ++A + E+IE++L+L+GA+A+EDKLQ+ V ET+++L+ A IKIWVLTGDKQETA+NIGY+C +LT +M+ + ++  ++  + R +L + +Q  FG+N    N                       D  L+++G +L  AL+   ++D L++A  CK VICCRV+P QKA+VV LVK   ++A+TLAIGDGANDV MI++AH+G+GISG EG QA   SDY+ AQFR+L RLLLVHG W+Y R+ K + Y FYKN  F ++ FWF    GFS Q ++++W I  +N+++T+ P LA+G+FD+  S +NS+  PQLY+  Q +  F+ + F   +L+ +Y SL+LF++   A  +++   +GQ           + T +V+ VSV+  L+   WT+++H+ IWGS+  +F           F I+ + F  VG +A  +L  + +      WL ++L   A++   +A++ +K  L+ +L +++ + +K
Sbjct:    4 SEKKLREV--ERIVKANDREYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYFLCLLILQLIPEISSLTWFTTIVPLVLVITMTAVKDATDDYFRHKSDNQVNNRQSEVLINSKLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRHALSVTSELGADISRLAGFDGIVVCEVPNNKLDKFMGILSWKDSKH-SLNNEKIILRGCILRNTSWCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLICLGIILAIGNSIWESQTGDQFRTFLFWNEGEKSSVFSGFLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDRKMYYSRKAIPAVARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELIYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNTRKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEVLLSLTSDHLSEFAGEGLRTLAIAYRDLDDKYFKEWHKMLEDANAATEERDERIAGLYEEIERDLMLLGATAVEDKLQEGVIETVTSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFVIAGNNAVEVREELRKAKQNLFGQNRNFSNGHVVCEKKQQLELDSIVEETITGDYALIINGHSLAHALESDVKNDLLELACMCKTVICCRVTPLQKAQVVELVKK-YRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQAVLASDYSFAQFRYLQRLLLVHGRWSYFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGIFDQDVSDQNSVDCPQLYKPGQLNLLFNKRKFFICVLHGIYTSLVLFFIPYGA-FYNVAGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTFINHVFIWGSIAIYFSILFTMHSNGIFGIFPNQFPFVG-NARHSLTQKCI------WLVILLTTVASVMPVVAFRFLKVDLYPTLSDQIRRWQK 1105          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-1 (Phospholipid-transporting ATPase tat-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U280])

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 540/1140 (47.37%), Postives = 731/1140 (64.12%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGF-DRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGD---SEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKT-PDSKIVLFTKGADNVIYERLSTASKNGKLT---LDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLF-QLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPI-DIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSS------------GYAFSQEEHGVVSQSQLIREYNSTIKKPEG 3498
            ++ + +H    ++C N+IST KYN  +F+P+FL+EQFRRY NIFFL IA+LQQ P+VSPTGRYTTAVP  IIL++SA+KEI ED KR ++D+  N   + IL +  W+E  WK + VG+F+++ N    PADL+LLASSE  GM+YIETSNLDGETNLK++Q L  T  + +   L +    I CE P+RH+ EF GN+ ++G  +   G DQLLLRGA LKNT W+FG V+Y+GH++K+++NS   PLK  +++  TN  I+ L  +L+ L L ++  + +W   N   AWYL F +  P   +   +  LTF ILYN +IPISL VT+EVVR FQ  +IN DIEMYD ++++ A ARTSNLNEELGQV++I SDKTGTLTRNVM+FK+ SIG   YG   D+ F+   D +L+E  + GD   + +    K +AVCHTVVPE +D ++IYQ+SSPDE+ALV+ A      FHTR P  +  ++  E+   ++L+V++FTS RKRMSVIV+      I L+TKGAD VI+ERL    +  +      ++LE++A  G RTLC +   +   EY +W  E+ +A ++I+NR   LA  AEK+E+N+IL+GA+AIEDKLQ+ VPETI  L  A I++W+LTGDK+ETA+NI +SC L   N  L I+D  + ++T  +L +      E   +E    +V+ G +L  AL  + R  F  +AL C AV+CCR+SP QKAEVV +V+   K  + LAIGDGANDV MIQAA+VG+GISG EG QAA  SDYAI +F FL RLLLVHGAWN++R  K+ILYSFYKN+C ++I+ WFA+ S +SGQ IFERW+IG +NVIFTA PP+ LGLFD    AE  +KYP LY   Q  + F +  F  WI  ++ HSL LF+LT     H + + NG TG  L LGNC YT+VV TV  KA LE  +WTW   +A  GS+  W V+ I+YS +F  + G+ A MA M   + SS TFWL L+ IP A L  D+  K++      + RE  +   KR         +           R   + L G TT +          R R +S            G+AFSQ+E   V+Q++LIR  +ST +KP G
Sbjct:   16 KVRDPHHQHAQRFCSNRISTCKYNGFSFLPRFLYEQFRRYNNIFFLAIALLQQIPDVSPTGRYTTAVPFLIILSVSALKEIFEDVKRRRSDNKVNAFSVEILVDGHWIEKQWKDVSVGDFIRIDNDSLFPADLLLLASSEQQGMAYIETSNLDGETNLKIKQALDITSTMTSPEKLSQFESEITCEPPSRHVNEFNGNIEINGVAR-HFGIDQLLLRGARLKNTAWIFGAVIYTGHDSKLLMNSKRAPLKSGTIDVQTNYRIIFLFFVLVALALISATGSEIWRGNNIPQAWYLSFLEHDPKGSF--LWGVLTFFILYNNLIPISLQVTLEVVRFFQAIYINNDIEMYDVNSDSCAIARTSNLNEELGQVKFIMSDKTGTLTRNVMKFKRLSIGSRNYGNNEDDEFA---DASLIEDYRQGDEHSTSILEVLKMMAVCHTVVPENKDGQLIYQSSSPDEAALVRGAASQSVSFHTRQPQKVICNVFGEDETIEILDVIDFTSDRKRMSVIVRDGAGGDIKLYTKGADTVIFERLEHGKEQEEAVEYCTEHLEDYASFGYRTLCFSMRHLTEQEYSQWAPEYKKAILAIDNRAKLLADAAEKLERNMILVGATAIEDKLQEWVPETIQALMAADIRVWMLTGDKRETAINIAHSCALCHTNTELLIVDKTTYEETYQKLEQFVARAIELEKQEKGFAMVIDGKSLLHALTGEARKHFGDLALRCHAVVCCRMSPMQKAEVVEMVRKLAKH-VVLAIGDGANDVAMIQAANVGVGISGEEGLQAASASDYAIPRFHFLRRLLLVHGAWNHDRSVKVILYSFYKNICLYIIELWFAMFSAWSGQTIFERWTIGMFNVIFTAWPPVVLGLFDHPVPAEQIMKYPALYASFQNRA-FSIGNFSLWIGLAIVHSLSLFFLTYATMEHQVVWDNGLTGGWLMLGNCAYTFVVATVCFKALLECDSWTWPVVVACIGSIGLWIVFVIVYSLVFPHIGGIGADMAGMAAIMMSSYTFWLALLFIPLATLLWDLVIKSLFTIAMPTPRELAVMYNKRTTSFNGFERLASYSSNVLENMRLLTSSLRGSTTGST---------RSRTASEASLALAEQTRYGFAFSQDESSAVAQTELIRNVDSTREKPTG 1138          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-1 (Phospholipid-transporting ATPase tat-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U280])

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 540/1140 (47.37%), Postives = 731/1140 (64.12%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGF-DRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGD---SEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKT-PDSKIVLFTKGADNVIYERLSTASKNGKLT---LDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLF-QLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPI-DIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSS------------GYAFSQEEHGVVSQSQLIREYNSTIKKPEG 3498
            ++ + +H    ++C N+IST KYN  +F+P+FL+EQFRRY NIFFL IA+LQQ P+VSPTGRYTTAVP  IIL++SA+KEI ED KR ++D+  N   + IL +  W+E  WK + VG+F+++ N    PADL+LLASSE  GM+YIETSNLDGETNLK++Q L  T  + +   L +    I CE P+RH+ EF GN+ ++G  +   G DQLLLRGA LKNT W+FG V+Y+GH++K+++NS   PLK  +++  TN  I+ L  +L+ L L ++  + +W   N   AWYL F +  P   +   +  LTF ILYN +IPISL VT+EVVR FQ  +IN DIEMYD ++++ A ARTSNLNEELGQV++I SDKTGTLTRNVM+FK+ SIG   YG   D+ F+   D +L+E  + GD   + +    K +AVCHTVVPE +D ++IYQ+SSPDE+ALV+ A      FHTR P  +  ++  E+   ++L+V++FTS RKRMSVIV+      I L+TKGAD VI+ERL    +  +      ++LE++A  G RTLC +   +   EY +W  E+ +A ++I+NR   LA  AEK+E+N+IL+GA+AIEDKLQ+ VPETI  L  A I++W+LTGDK+ETA+NI +SC L   N  L I+D  + ++T  +L +      E   +E    +V+ G +L  AL  + R  F  +AL C AV+CCR+SP QKAEVV +V+   K  + LAIGDGANDV MIQAA+VG+GISG EG QAA  SDYAI +F FL RLLLVHGAWN++R  K+ILYSFYKN+C ++I+ WFA+ S +SGQ IFERW+IG +NVIFTA PP+ LGLFD    AE  +KYP LY   Q  + F +  F  WI  ++ HSL LF+LT     H + + NG TG  L LGNC YT+VV TV  KA LE  +WTW   +A  GS+  W V+ I+YS +F  + G+ A MA M   + SS TFWL L+ IP A L  D+  K++      + RE  +   KR         +           R   + L G TT +          R R +S            G+AFSQ+E   V+Q++LIR  +ST +KP G
Sbjct:   16 KVRDPHHQHAQRFCSNRISTCKYNGFSFLPRFLYEQFRRYNNIFFLAIALLQQIPDVSPTGRYTTAVPFLIILSVSALKEIFEDVKRRRSDNKVNAFSVEILVDGHWIEKQWKDVSVGDFIRIDNDSLFPADLLLLASSEQQGMAYIETSNLDGETNLKIKQALDITSTMTSPEKLSQFESEITCEPPSRHVNEFNGNIEINGVAR-HFGIDQLLLRGARLKNTAWIFGAVIYTGHDSKLLMNSKRAPLKSGTIDVQTNYRIIFLFFVLVALALISATGSEIWRGNNIPQAWYLSFLEHDPKGSF--LWGVLTFFILYNNLIPISLQVTLEVVRFFQAIYINNDIEMYDVNSDSCAIARTSNLNEELGQVKFIMSDKTGTLTRNVMKFKRLSIGSRNYGNNEDDEFA---DASLIEDYRQGDEHSTSILEVLKMMAVCHTVVPENKDGQLIYQSSSPDEAALVRGAASQSVSFHTRQPQKVICNVFGEDETIEILDVIDFTSDRKRMSVIVRDGAGGDIKLYTKGADTVIFERLEHGKEQEEAVEYCTEHLEDYASFGYRTLCFSMRHLTEQEYSQWAPEYKKAILAIDNRAKLLADAAEKLERNMILVGATAIEDKLQEWVPETIQALMAADIRVWMLTGDKRETAINIAHSCALCHTNTELLIVDKTTYEETYQKLEQFVARAIELEKQEKGFAMVIDGKSLLHALTGEARKHFGDLALRCHAVVCCRMSPMQKAEVVEMVRKLAKH-VVLAIGDGANDVAMIQAANVGVGISGEEGLQAASASDYAIPRFHFLRRLLLVHGAWNHDRSVKVILYSFYKNICLYIIELWFAMFSAWSGQTIFERWTIGMFNVIFTAWPPVVLGLFDHPVPAEQIMKYPALYASFQNRA-FSIGNFSLWIGLAIVHSLSLFFLTYATMEHQVVWDNGLTGGWLMLGNCAYTFVVATVCFKALLECDSWTWPVVVACIGSIGLWIVFVIVYSLVFPHIGGIGADMAGMAAIMMSSYTFWLALLFIPLATLLWDLVIKSLFTIAMPTPRELAVMYNKRTTSFNGFERLASYSSNVLENMRLLTSSLRGSTTGST---------RSRTASEASLALAEQTRYGFAFSQDESSAVAQTELIRNVDSTREKPTG 1138          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-1 (Phospholipid-transporting ATPase tat-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U280])

HSP 1 Score: 996.112 bits (2574), Expect = 0.000e+0
Identity = 536/1125 (47.64%), Postives = 720/1125 (64.00%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGF-DRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGD---SEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKT-PDSKIVLFTKGADNVIYERLSTASKNGKLT---LDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLF-QLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFR---SRDAKLGGPTTPTIVDDNNRFNHRPRV--------SSGYAFSQEEHGVVSQSQL 3459
            ++ + +H    ++C N+IST KYN  +F+P+FL+EQFRRY NIFFL IA+LQQ P+VSPTGRYTTAVP  IIL++SA+KEI ED KR ++D+  N   + IL +  W+E  WK + VG+F+++ N    PADL+LLASSE  GM+YIETSNLDGETNLK++Q L  T  + +   L +    I CE P+RH+ EF GN+ ++G  +   G DQLLLRGA LKNT W+FG V+Y+GH++K+++NS   PLK  +++  TN  I+ L  +L+ L L ++  + +W   N   AWYL F +  P   +   +  LTF ILYN +IPISL VT+EVVR FQ  +IN DIEMYD ++++ A ARTSNLNEELGQV++I SDKTGTLTRNVM+FK+ SIG   YG   D+ F+   D +L+E  + GD   + +    K +AVCHTVVPE +D ++IYQ+SSPDE+ALV+ A      FHTR P  +  ++  E+   ++L+V++FTS RKRMSVIV+      I L+TKGAD VI+ERL    +  +      ++LE++A  G RTLC +   +   EY +W  E+ +A ++I+NR   LA  AEK+E+N+IL+GA+AIEDKLQ+ VPETI  L  A I++W+LTGDK+ETA+NI +SC L   N  L I+D  + ++T  +L +      E   +E    +V+ G +L  AL  + R  F  +AL C AV+CCR+SP QKAEVV +V+   K  + LAIGDGANDV MIQAA+VG+GISG EG QAA  SDYAI +F FL RLLLVHGAWN++R  K+ILYSFYKN+C ++I+ WFA+ S +SGQ IFERW+IG +NVIFTA PP+ LGLFD    AE  +KYP LY   Q  + F +  F  WI  ++ HSL LF+LT     H + + NG TG  L LGNC YT+VV TV  KA LE  +WTW   +A  GS+  W V+ I+YS +F  + G+ A MA M   + SS TFWL L+ IP A L  D+  K++      + RE  +   KR                 N F    S  A   GPT        NRF+ R R+        S   A S   +G V +SQL
Sbjct:   16 KVRDPHHQHAQRFCSNRISTCKYNGFSFLPRFLYEQFRRYNNIFFLAIALLQQIPDVSPTGRYTTAVPFLIILSVSALKEIFEDVKRRRSDNKVNAFSVEILVDGHWIEKQWKDVSVGDFIRIDNDSLFPADLLLLASSEQQGMAYIETSNLDGETNLKIKQALDITSTMTSPEKLSQFESEITCEPPSRHVNEFNGNIEINGVAR-HFGIDQLLLRGARLKNTAWIFGAVIYTGHDSKLLMNSKRAPLKSGTIDVQTNYRIIFLFFVLVALALISATGSEIWRGNNIPQAWYLSFLEHDPKGSF--LWGVLTFFILYNNLIPISLQVTLEVVRFFQAIYINNDIEMYDVNSDSCAIARTSNLNEELGQVKFIMSDKTGTLTRNVMKFKRLSIGSRNYGNNEDDEFA---DASLIEDYRQGDEHSTSILEVLKMMAVCHTVVPENKDGQLIYQSSSPDEAALVRGAASQSVSFHTRQPQKVICNVFGEDETIEILDVIDFTSDRKRMSVIVRDGAGGDIKLYTKGADTVIFERLEHGKEQEEAVEYCTEHLEDYASFGYRTLCFSMRHLTEQEYSQWAPEYKKAILAIDNRAKLLADAAEKLERNMILVGATAIEDKLQEWVPETIQALMAADIRVWMLTGDKRETAINIAHSCALCHTNTELLIVDKTTYEETYQKLEQFVARAIELEKQEKGFAMVIDGKSLLHALTGEARKHFGDLALRCHAVVCCRMSPMQKAEVVEMVRKLAKH-VVLAIGDGANDVAMIQAANVGVGISGEEGLQAASASDYAIPRFHFLRRLLLVHGAWNHDRSVKVILYSFYKNICLYIIELWFAMFSAWSGQTIFERWTIGMFNVIFTAWPPVVLGLFDHPVPAEQIMKYPALYASFQNRA-FSIGNFSLWIGLAIVHSLSLFFLTYATMEHQVVWDNGLTGGWLMLGNCAYTFVVATVCFKALLECDSWTWPVVVACIGSIGLWIVFVIVYSLVFPHIGGIGADMAGMAAIMMSSYTFWLALLFIPLATLLWDLVIKSLFTIAMPTPRELAVMYNKRTTS-------------FNGFERLASSWAAYQGPTKDGAHVFANRFSLRKRIQPTSTTAASHPSATSPPPNGYVEKSQL 1119          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-1 (Phospholipid-transporting ATPase tat-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U280])

HSP 1 Score: 996.112 bits (2574), Expect = 0.000e+0
Identity = 536/1125 (47.64%), Postives = 720/1125 (64.00%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGF-DRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGD---SEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKT-PDSKIVLFTKGADNVIYERLSTASKNGKLT---LDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLF-QLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFR---SRDAKLGGPTTPTIVDDNNRFNHRPRV--------SSGYAFSQEEHGVVSQSQL 3459
            ++ + +H    ++C N+IST KYN  +F+P+FL+EQFRRY NIFFL IA+LQQ P+VSPTGRYTTAVP  IIL++SA+KEI ED KR ++D+  N   + IL +  W+E  WK + VG+F+++ N    PADL+LLASSE  GM+YIETSNLDGETNLK++Q L  T  + +   L +    I CE P+RH+ EF GN+ ++G  +   G DQLLLRGA LKNT W+FG V+Y+GH++K+++NS   PLK  +++  TN  I+ L  +L+ L L ++  + +W   N   AWYL F +  P   +   +  LTF ILYN +IPISL VT+EVVR FQ  +IN DIEMYD ++++ A ARTSNLNEELGQV++I SDKTGTLTRNVM+FK+ SIG   YG   D+ F+   D +L+E  + GD   + +    K +AVCHTVVPE +D ++IYQ+SSPDE+ALV+ A      FHTR P  +  ++  E+   ++L+V++FTS RKRMSVIV+      I L+TKGAD VI+ERL    +  +      ++LE++A  G RTLC +   +   EY +W  E+ +A ++I+NR   LA  AEK+E+N+IL+GA+AIEDKLQ+ VPETI  L  A I++W+LTGDK+ETA+NI +SC L   N  L I+D  + ++T  +L +      E   +E    +V+ G +L  AL  + R  F  +AL C AV+CCR+SP QKAEVV +V+   K  + LAIGDGANDV MIQAA+VG+GISG EG QAA  SDYAI +F FL RLLLVHGAWN++R  K+ILYSFYKN+C ++I+ WFA+ S +SGQ IFERW+IG +NVIFTA PP+ LGLFD    AE  +KYP LY   Q  + F +  F  WI  ++ HSL LF+LT     H + + NG TG  L LGNC YT+VV TV  KA LE  +WTW   +A  GS+  W V+ I+YS +F  + G+ A MA M   + SS TFWL L+ IP A L  D+  K++      + RE  +   KR                 N F    S  A   GPT        NRF+ R R+        S   A S   +G V +SQL
Sbjct:   16 KVRDPHHQHAQRFCSNRISTCKYNGFSFLPRFLYEQFRRYNNIFFLAIALLQQIPDVSPTGRYTTAVPFLIILSVSALKEIFEDVKRRRSDNKVNAFSVEILVDGHWIEKQWKDVSVGDFIRIDNDSLFPADLLLLASSEQQGMAYIETSNLDGETNLKIKQALDITSTMTSPEKLSQFESEITCEPPSRHVNEFNGNIEINGVAR-HFGIDQLLLRGARLKNTAWIFGAVIYTGHDSKLLMNSKRAPLKSGTIDVQTNYRIIFLFFVLVALALISATGSEIWRGNNIPQAWYLSFLEHDPKGSF--LWGVLTFFILYNNLIPISLQVTLEVVRFFQAIYINNDIEMYDVNSDSCAIARTSNLNEELGQVKFIMSDKTGTLTRNVMKFKRLSIGSRNYGNNEDDEFA---DASLIEDYRQGDEHSTSILEVLKMMAVCHTVVPENKDGQLIYQSSSPDEAALVRGAASQSVSFHTRQPQKVICNVFGEDETIEILDVIDFTSDRKRMSVIVRDGAGGDIKLYTKGADTVIFERLEHGKEQEEAVEYCTEHLEDYASFGYRTLCFSMRHLTEQEYSQWAPEYKKAILAIDNRAKLLADAAEKLERNMILVGATAIEDKLQEWVPETIQALMAADIRVWMLTGDKRETAINIAHSCALCHTNTELLIVDKTTYEETYQKLEQFVARAIELEKQEKGFAMVIDGKSLLHALTGEARKHFGDLALRCHAVVCCRMSPMQKAEVVEMVRKLAKH-VVLAIGDGANDVAMIQAANVGVGISGEEGLQAASASDYAIPRFHFLRRLLLVHGAWNHDRSVKVILYSFYKNICLYIIELWFAMFSAWSGQTIFERWTIGMFNVIFTAWPPVVLGLFDHPVPAEQIMKYPALYASFQNRA-FSIGNFSLWIGLAIVHSLSLFFLTYATMEHQVVWDNGLTGGWLMLGNCAYTFVVATVCFKALLECDSWTWPVVVACIGSIGLWIVFVIVYSLVFPHIGGIGADMAGMAAIMMSSYTFWLALLFIPLATLLWDLVIKSLFTIAMPTPRELAVMYNKRTTS-------------FNGFERLASSWAAYQGPTKDGAHVFANRFSLRKRIQPTSTTAASHPSATSPPPNGYVEKSQL 1119          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-1 (Phospholipid-transporting ATPase tat-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U280])

HSP 1 Score: 991.875 bits (2563), Expect = 0.000e+0
Identity = 516/1047 (49.28%), Postives = 696/1047 (66.48%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGF-DRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGD---SEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKT-PDSKIVLFTKGADNVIYERLSTASKNGKLT---LDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLF-QLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKR 3258
            ++ + +H    ++C N+IST KYN  +F+P+FL+EQFRRY NIFFL IA+LQQ P+VSPTGRYTTAVP  IIL++SA+KEI ED KR ++D+  N   + IL +  W+E  WK + VG+F+++ N    PADL+LLASSE  GM+YIETSNLDGETNLK++Q L  T  + +   L +    I CE P+RH+ EF GN+ ++G  +   G DQLLLRGA LKNT W+FG V+Y+GH++K+++NS   PLK  +++  TN  I+ L  +L+ L L ++  + +W   N   AWYL F +  P   +   +  LTF ILYN +IPISL VT+EVVR FQ  +IN DIEMYD ++++ A ARTSNLNEELGQV++I SDKTGTLTRNVM+FK+ SIG   YG   D+ F+   D +L+E  + GD   + +    K +AVCHTVVPE +D ++IYQ+SSPDE+ALV+ A      FHTR P  +  ++  E+   ++L+V++FTS RKRMSVIV+      I L+TKGAD VI+ERL    +  +      ++LE++A  G RTLC +   +   EY +W  E+ +A ++I+NR   LA  AEK+E+N+IL+GA+AIEDKLQ+ VPETI  L  A I++W+LTGDK+ETA+NI +SC L   N  L I+D  + ++T  +L +      E   +E    +V+ G +L  AL  + R  F  +AL C AV+CCR+SP QKAEVV +V+   K  + LAIGDGANDV MIQAA+VG+GISG EG QAA  SDYAI +F FL RLLLVHGAWN++R  K+ILYSFYKN+C ++I+ WFA+ S +SGQ IFERW+IG +NVIFTA PP+ LGLFD    AE  +KYP LY   Q  + F +  F  WI  ++ HSL LF+LT     H + + NG TG  L LGNC YT+VV TV  KA LE  +WTW   +A  GS+  W V+ I+YS +F  + G+ A MA M   + SS TFWL L+ IP A L  D+  K++      + RE  +   KR
Sbjct:   16 KVRDPHHQHAQRFCSNRISTCKYNGFSFLPRFLYEQFRRYNNIFFLAIALLQQIPDVSPTGRYTTAVPFLIILSVSALKEIFEDVKRRRSDNKVNAFSVEILVDGHWIEKQWKDVSVGDFIRIDNDSLFPADLLLLASSEQQGMAYIETSNLDGETNLKIKQALDITSTMTSPEKLSQFESEITCEPPSRHVNEFNGNIEINGVAR-HFGIDQLLLRGARLKNTAWIFGAVIYTGHDSKLLMNSKRAPLKSGTIDVQTNYRIIFLFFVLVALALISATGSEIWRGNNIPQAWYLSFLEHDPKGSF--LWGVLTFFILYNNLIPISLQVTLEVVRFFQAIYINNDIEMYDVNSDSCAIARTSNLNEELGQVKFIMSDKTGTLTRNVMKFKRLSIGSRNYGNNEDDEFA---DASLIEDYRQGDEHSTSILEVLKMMAVCHTVVPENKDGQLIYQSSSPDEAALVRGAASQSVSFHTRQPQKVICNVFGEDETIEILDVIDFTSDRKRMSVIVRDGAGGDIKLYTKGADTVIFERLEHGKEQEEAVEYCTEHLEDYASFGYRTLCFSMRHLTEQEYSQWAPEYKKAILAIDNRAKLLADAAEKLERNMILVGATAIEDKLQEWVPETIQALMAADIRVWMLTGDKRETAINIAHSCALCHTNTELLIVDKTTYEETYQKLEQFVARAIELEKQEKGFAMVIDGKSLLHALTGEARKHFGDLALRCHAVVCCRMSPMQKAEVVEMVRKLAKH-VVLAIGDGANDVAMIQAANVGVGISGEEGLQAASASDYAIPRFHFLRRLLLVHGAWNHDRSVKVILYSFYKNICLYIIELWFAMFSAWSGQTIFERWTIGMFNVIFTAWPPVVLGLFDHPVPAEQIMKYPALYASFQNRA-FSIGNFSLWIGLAIVHSLSLFFLTYATMEHQVVWDNGLTGGWLMLGNCAYTFVVATVCFKALLECDSWTWPVVVACIGSIGLWIVFVIVYSLVFPHIGGIGADMAGMAAIMMSSYTFWLALLFIPLATLLWDLVIKSLFTIAMPTPRELAVMYNKR 1054          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: ATP8A (gene:FBgn0259221 transcript:FBtr0299755)

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 607/1133 (53.57%), Postives = 802/1133 (70.79%), Query Frame = 1
Query:  142 QRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLG---FDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYG--KGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPE-KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGK-LTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIP------IDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGN 3501
            +RI+N+N PQP KY  N+I+TAKY+F++F+P FLFEQFRRY+N FFLLIAILQQ P VSPTGRYTT VPL  IL++SAIKEI+ED KRH+AD+  N+  I  L +  W  + W +L VG+ +K+      PADL+LL+SSEP  M +IET+NLDGETNLK+RQ LP T ++L   DL ++ G I CE+PNRHLYEF G L   G+   +LGNDQ+L RGA L+NT WVFGIVVYSG ETK+M NST+ PLKRS+V+++TN  IL L  +L+ L + + + N+ WT  + +T WYLG   F  K +      +N LTF ILYN +IPISL VT+E+VR  Q  FIN+DIEMY  ++NTPA ARTSNLNEELG V+YIFSDKTGTLT+NVMEFK+CSI G +Y   + P+E+   Q   N+L + +   + ++ F + L+VCHTV+PE KE+  +IY A+SPDE ALV+ A++ GYIF TRTP  ++I+       Y+VLNVLEFTS RKRMS+IV+TP++KI LF KGAD VIYERL+   +  +  TL +LEEFA  GLRTLC+A A+I  + Y++W   F +ASV+++NRE+KL   A  IE NL L+GA+AIED+LQD VPETI++L  AGI IWVLTGDKQETA+NIGYSC+L++ +M + IL+ +SLD TR  +      F  +  K+ ++ LV+ G TLK+AL    R+DF  + + C+ VICCRVSP QKAEVV +V  +  +A+TLAIGDGANDV MIQ A+VGIGISG+EG QAAC SDY+IAQFR+L RLLLVHGAWNY R++KLILYSFYKNVC +VI+ WFA+ SG+SGQI+FERW+IG YNV+FTA PP A+GLF++ C+AE  ++YP LY+  Q +  F++KVF  WI N+L HS+ LFWL + A   ++ + +G+T   L +GN +YTYV+VTV +KAGL   +WTWL+HLAIWGS+V WF + +IYSH++ +   +++   M   + S+  F+  L+L+P   L  D+  K V  T+F++L E V + E R  D  +++        +  R   N F  R               N R      +S GYAFSQEE G V QS +IR Y++ + KPEGN
Sbjct:  216 RRIINLNGPQPTKYGNNRITTAKYSFISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDSGSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIECELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILMLFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLG-----YNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEMYHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQ---NILGRHE-TSAVIEEFLELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIVRTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESKLEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDATREVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQS-TNAVTLAIGDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVYSGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLPLAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFRGMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSFTETARLLRNVFTRR--------------ANTRVETDLELSHGYAFSQEEGGAVPQSIIIRAYDTNLPKPEGN 1324          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: ATP8A (gene:FBgn0259221 transcript:FBtr0299761)

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 607/1133 (53.57%), Postives = 802/1133 (70.79%), Query Frame = 1
Query:  142 QRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLG---FDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYG--KGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPE-KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGK-LTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIP------IDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGN 3501
            +RI+N+N PQP KY  N+I+TAKY+F++F+P FLFEQFRRY+N FFLLIAILQQ P VSPTGRYTT VPL  IL++SAIKEI+ED KRH+AD+  N+  I  L +  W  + W +L VG+ +K+      PADL+LL+SSEP  M +IET+NLDGETNLK+RQ LP T ++L   DL ++ G I CE+PNRHLYEF G L   G+   +LGNDQ+L RGA L+NT WVFGIVVYSG ETK+M NST+ PLKRS+V+++TN  IL L  +L+ L + + + N+ WT  + +T WYLG   F  K +      +N LTF ILYN +IPISL VT+E+VR  Q  FIN+DIEMY  ++NTPA ARTSNLNEELG V+YIFSDKTGTLT+NVMEFK+CSI G +Y   + P+E+   Q   N+L + +   + ++ F + L+VCHTV+PE KE+  +IY A+SPDE ALV+ A++ GYIF TRTP  ++I+       Y+VLNVLEFTS RKRMS+IV+TP++KI LF KGAD VIYERL+   +  +  TL +LEEFA  GLRTLC+A A+I  + Y++W   F +ASV+++NRE+KL   A  IE NL L+GA+AIED+LQD VPETI++L  AGI IWVLTGDKQETA+NIGYSC+L++ +M + IL+ +SLD TR  +      F  +  K+ ++ LV+ G TLK+AL    R+DF  + + C+ VICCRVSP QKAEVV +V  +  +A+TLAIGDGANDV MIQ A+VGIGISG+EG QAAC SDY+IAQFR+L RLLLVHGAWNY R++KLILYSFYKNVC +VI+ WFA+ SG+SGQI+FERW+IG YNV+FTA PP A+GLF++ C+AE  ++YP LY+  Q +  F++KVF  WI N+L HS+ LFWL + A   ++ + +G+T   L +GN +YTYV+VTV +KAGL   +WTWL+HLAIWGS+V WF + +IYSH++ +   +++   M   + S+  F+  L+L+P   L  D+  K V  T+F++L E V + E R  D  +++        +  R   N F  R               N R      +S GYAFSQEE G V QS +IR Y++ + KPEGN
Sbjct:   42 RRIINLNGPQPTKYGNNRITTAKYSFISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDSGSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIECELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILMLFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLG-----YNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEMYHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQ---NILGRHE-TSAVIEEFLELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIVRTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESKLEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDATREVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQS-TNAVTLAIGDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVYSGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLPLAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFRGMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSFTETARLLRNVFTRR--------------ANTRVETDLELSHGYAFSQEEGGAVPQSIIIRAYDTNLPKPEGN 1150          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: ATP8A (gene:FBgn0259221 transcript:FBtr0299754)

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 607/1133 (53.57%), Postives = 802/1133 (70.79%), Query Frame = 1
Query:  142 QRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLG---FDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYG--KGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPE-KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGK-LTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIP------IDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGN 3501
            +RI+N+N PQP KY  N+I+TAKY+F++F+P FLFEQFRRY+N FFLLIAILQQ P VSPTGRYTT VPL  IL++SAIKEI+ED KRH+AD+  N+  I  L +  W  + W +L VG+ +K+      PADL+LL+SSEP  M +IET+NLDGETNLK+RQ LP T ++L   DL ++ G I CE+PNRHLYEF G L   G+   +LGNDQ+L RGA L+NT WVFGIVVYSG ETK+M NST+ PLKRS+V+++TN  IL L  +L+ L + + + N+ WT  + +T WYLG   F  K +      +N LTF ILYN +IPISL VT+E+VR  Q  FIN+DIEMY  ++NTPA ARTSNLNEELG V+YIFSDKTGTLT+NVMEFK+CSI G +Y   + P+E+   Q   N+L + +   + ++ F + L+VCHTV+PE KE+  +IY A+SPDE ALV+ A++ GYIF TRTP  ++I+       Y+VLNVLEFTS RKRMS+IV+TP++KI LF KGAD VIYERL+   +  +  TL +LEEFA  GLRTLC+A A+I  + Y++W   F +ASV+++NRE+KL   A  IE NL L+GA+AIED+LQD VPETI++L  AGI IWVLTGDKQETA+NIGYSC+L++ +M + IL+ +SLD TR  +      F  +  K+ ++ LV+ G TLK+AL    R+DF  + + C+ VICCRVSP QKAEVV +V  +  +A+TLAIGDGANDV MIQ A+VGIGISG+EG QAAC SDY+IAQFR+L RLLLVHGAWNY R++KLILYSFYKNVC +VI+ WFA+ SG+SGQI+FERW+IG YNV+FTA PP A+GLF++ C+AE  ++YP LY+  Q +  F++KVF  WI N+L HS+ LFWL + A   ++ + +G+T   L +GN +YTYV+VTV +KAGL   +WTWL+HLAIWGS+V WF + +IYSH++ +   +++   M   + S+  F+  L+L+P   L  D+  K V  T+F++L E V + E R  D  +++        +  R   N F  R               N R      +S GYAFSQEE G V QS +IR Y++ + KPEGN
Sbjct:   42 RRIINLNGPQPTKYGNNRITTAKYSFISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDSGSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIECELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILMLFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLG-----YNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEMYHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQ---NILGRHE-TSAVIEEFLELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIVRTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESKLEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDATREVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQS-TNAVTLAIGDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVYSGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLPLAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFRGMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSFTETARLLRNVFTRR--------------ANTRVETDLELSHGYAFSQEEGGAVPQSIIIRAYDTNLPKPEGN 1150          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: ATP8A (gene:FBgn0259221 transcript:FBtr0299763)

HSP 1 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 607/1133 (53.57%), Postives = 802/1133 (70.79%), Query Frame = 1
Query:  142 QRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLG---FDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYG--KGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPE-KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGK-LTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIP------IDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGN 3501
            +RI+N+N PQP KY  N+I+TAKY+F++F+P FLFEQFRRY+N FFLLIAILQQ P VSPTGRYTT VPL  IL++SAIKEI+ED KRH+AD+  N+  I  L +  W  + W +L VG+ +K+      PADL+LL+SSEP  M +IET+NLDGETNLK+RQ LP T ++L   DL ++ G I CE+PNRHLYEF G L   G+   +LGNDQ+L RGA L+NT WVFGIVVYSG ETK+M NST+ PLKRS+V+++TN  IL L  +L+ L + + + N+ WT  + +T WYLG   F  K +      +N LTF ILYN +IPISL VT+E+VR  Q  FIN+DIEMY  ++NTPA ARTSNLNEELG V+YIFSDKTGTLT+NVMEFK+CSI G +Y   + P+E+   Q   N+L + +   + ++ F + L+VCHTV+PE KE+  +IY A+SPDE ALV+ A++ GYIF TRTP  ++I+       Y+VLNVLEFTS RKRMS+IV+TP++KI LF KGAD VIYERL+   +  +  TL +LEEFA  GLRTLC+A A+I  + Y++W   F +ASV+++NRE+KL   A  IE NL L+GA+AIED+LQD VPETI++L  AGI IWVLTGDKQETA+NIGYSC+L++ +M + IL+ +SLD TR  +      F  +  K+ ++ LV+ G TLK+AL    R+DF  + + C+ VICCRVSP QKAEVV +V  +  +A+TLAIGDGANDV MIQ A+VGIGISG+EG QAAC SDY+IAQFR+L RLLLVHGAWNY R++KLILYSFYKNVC +VI+ WFA+ SG+SGQI+FERW+IG YNV+FTA PP A+GLF++ C+AE  ++YP LY+  Q +  F++KVF  WI N+L HS+ LFWL + A   ++ + +G+T   L +GN +YTYV+VTV +KAGL   +WTWL+HLAIWGS+V WF + +IYSH++ +   +++   M   + S+  F+  L+L+P   L  D+  K V  T+F++L E V + E R  D  +++        +  R   N F  R               N R      +S GYAFSQEE G V QS +IR Y++ + KPEGN
Sbjct:  167 RRIINLNGPQPTKYGNNRITTAKYSFISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDSGSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIECELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILMLFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLG-----YNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEMYHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQ---NILGRHE-TSAVIEEFLELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIVRTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESKLEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDATREVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQS-TNAVTLAIGDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVYSGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLPLAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFRGMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSFTETARLLRNVFTRR--------------ANTRVETDLELSHGYAFSQEEGGAVPQSIIIRAYDTNLPKPEGN 1275          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: ATP8A (gene:FBgn0259221 transcript:FBtr0299762)

HSP 1 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 607/1133 (53.57%), Postives = 802/1133 (70.79%), Query Frame = 1
Query:  142 QRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLG---FDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYG--KGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPE-KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGK-LTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIP------IDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGN 3501
            +RI+N+N PQP KY  N+I+TAKY+F++F+P FLFEQFRRY+N FFLLIAILQQ P VSPTGRYTT VPL  IL++SAIKEI+ED KRH+AD+  N+  I  L +  W  + W +L VG+ +K+      PADL+LL+SSEP  M +IET+NLDGETNLK+RQ LP T ++L   DL ++ G I CE+PNRHLYEF G L   G+   +LGNDQ+L RGA L+NT WVFGIVVYSG ETK+M NST+ PLKRS+V+++TN  IL L  +L+ L + + + N+ WT  + +T WYLG   F  K +      +N LTF ILYN +IPISL VT+E+VR  Q  FIN+DIEMY  ++NTPA ARTSNLNEELG V+YIFSDKTGTLT+NVMEFK+CSI G +Y   + P+E+   Q   N+L + +   + ++ F + L+VCHTV+PE KE+  +IY A+SPDE ALV+ A++ GYIF TRTP  ++I+       Y+VLNVLEFTS RKRMS+IV+TP++KI LF KGAD VIYERL+   +  +  TL +LEEFA  GLRTLC+A A+I  + Y++W   F +ASV+++NRE+KL   A  IE NL L+GA+AIED+LQD VPETI++L  AGI IWVLTGDKQETA+NIGYSC+L++ +M + IL+ +SLD TR  +      F  +  K+ ++ LV+ G TLK+AL    R+DF  + + C+ VICCRVSP QKAEVV +V  +  +A+TLAIGDGANDV MIQ A+VGIGISG+EG QAAC SDY+IAQFR+L RLLLVHGAWNY R++KLILYSFYKNVC +VI+ WFA+ SG+SGQI+FERW+IG YNV+FTA PP A+GLF++ C+AE  ++YP LY+  Q +  F++KVF  WI N+L HS+ LFWL + A   ++ + +G+T   L +GN +YTYV+VTV +KAGL   +WTWL+HLAIWGS+V WF + +IYSH++ +   +++   M   + S+  F+  L+L+P   L  D+  K V  T+F++L E V + E R  D  +++        +  R   N F  R               N R      +S GYAFSQEE G V QS +IR Y++ + KPEGN
Sbjct:  167 RRIINLNGPQPTKYGNNRITTAKYSFISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDSGSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIECELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILMLFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLG-----YNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEMYHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQ---NILGRHE-TSAVIEEFLELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIVRTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESKLEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDATREVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQS-TNAVTLAIGDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVYSGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLPLAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFRGMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSFTETARLLRNVFTRR--------------ANTRVETDLELSHGYAFSQEEGGAVPQSIIIRAYDTNLPKPEGN 1275          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:ZFIN;Acc:ZDB-GENE-100209-2])

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 631/1166 (54.12%), Postives = 814/1166 (69.81%), Query Frame = 1
Query:   82 APGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTA-WYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            A GY+     + +E+  TTSQ        R V +N  Q  KYC N +STAKY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L+N  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD      LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +SI   +W   + D A WYL   R         +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I    +   Y++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERL+  S+  +LT+ +LE+FA  GLRTLC AY +++   Y +W  E++  S  +++R  KL    E IEKNL+L+GA+AIED+LQ  VPETI+ L +A IKIWVLTGDKQETA+NIGYSC+L++  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N +++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  + A  HD PF NG +   LF+GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+V W ++F +YS ++  + ++  M      V    +FWLGLIL+P+A L +D+ W A +RT+ ++L E V ++E R  DPG  +  D   +  N  R+         TP+ V  +N       VS GYAFSQEEHGVVSQSQ++R Y++T ++P
Sbjct:   54 ATGYR----KAEDEMSGTTSQADPVDATARTVLLNRAQTTKYCDNHVSTAKYGILTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRNGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTASFQSLEDLIALSGRLECEGPNRHLYDFTGTLRLDNHNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSIGAAIWNKQHTDEACWYLS--RAGDISLNFAYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDVEMYYAETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCTIAGITYGHFPDLDCDRSMEDFSHLPSTSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKSLGFVFTARTPHSVIIEARGKEQTYELLNVLEFSSNRKRMSVIVRTPTGNLRLYCKGADNVIFERLNVTSQYKELTVAHLEQFATEGLRTLCFAYVDLEEGAYLEWLKEYNRISTVLKDRAQKLEECYELIEKNLLLLGATAIEDRLQAGVPETIATLMRADIKIWVLTGDKQETAINIGYSCRLVSHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFEVRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMIRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKALEHDTPFDNGNSVDYLFVGNIVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSMVLWMLFFAVYSAIWPTIPIAPDMLGQAGRVMQCWSFWLGLILVPTACLLKDVVWNAGRRTVRKTLLEEVQELEARAVDPGAAVLRDASGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVSHGYAFSQEEHGVVSQSQVVRSYDTTRQRP 1209          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:ZFIN;Acc:ZDB-GENE-100209-2])

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 634/1197 (52.97%), Postives = 817/1197 (68.25%), Query Frame = 1
Query:   82 APGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTA-WYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKIS----------INNEN---------------------YEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            A GY+     + +E+  TTSQ        R V +N  Q  KYC N +STAKY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L+N  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD      LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +SI   +W   + D A WYL   R         +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I           I N+N                       Y++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERL+  S+  +LT+ +LE+FA  GLRTLC AY +++   Y +W  E++  S  +++R  KL    E IEKNL+L+GA+AIED+LQ  VPETI+ L +A IKIWVLTGDKQETA+NIGYSC+L++  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N +++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  + A  HD PF NG +   LF+GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+V W ++F +YS ++  + ++  M      V    +FWLGLIL+P+A L +D+ W A +RT+ ++L E V ++E R  DPG  +  D   +  N  R+         TP+ V  +N       VS GYAFSQEEHGVVSQSQ++R Y++T ++P
Sbjct:   17 ATGYR----KAEDEMSGTTSQADPVDATARTVLLNRAQTTKYCDNHVSTAKYGILTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRNGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTASFQSLEDLIALSGRLECEGPNRHLYDFTGTLRLDNHNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSIGAAIWNKQHTDEACWYLS--RAGDISLNFAYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDVEMYYAETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCTIAGITYGHFPDLDCDRSMEDFSHLPSTSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKSLGFVFTARTPHSVIIEAVSVCVFSPLIKNQNSLYVSHAMSKLLVFIFQRGKEQTYELLNVLEFSSNRKRMSVIVRTPTGNLRLYCKGADNVIFERLNVTSQYKELTVAHLEQFATEGLRTLCFAYVDLEEGAYLEWLKEYNRISTVLKDRAQKLEECYELIEKNLLLLGATAIEDRLQAGVPETIATLMRADIKIWVLTGDKQETAINIGYSCRLVSHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFEVRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMIRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKALEHDTPFDNGNSVDYLFVGNIVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSMVLWMLFFAVYSAIWPTIPIAPDMLGQAGRVMQCWSFWLGLILVPTACLLKDVVWNAGRRTVRKTLLEEVQELEARAVDPGAAVLRDASGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVSHGYAFSQEEHGVVSQSQVVRSYDTTRQRP 1203          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:ZFIN;Acc:ZDB-GENE-100209-2])

HSP 1 Score: 1224.54 bits (3167), Expect = 0.000e+0
Identity = 634/1197 (52.97%), Postives = 817/1197 (68.25%), Query Frame = 1
Query:   82 APGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTA-WYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKIS----------INNEN---------------------YEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            A GY+     + +E+  TTSQ        R V +N  Q  KYC N +STAKY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L+N  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD      LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +SI   +W   + D A WYL   R         +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I           I N+N                       Y++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERL+  S+  +LT+ +LE+FA  GLRTLC AY +++   Y +W  E++  S  +++R  KL    E IEKNL+L+GA+AIED+LQ  VPETI+ L +A IKIWVLTGDKQETA+NIGYSC+L++  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N +++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  + A  HD PF NG +   LF+GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+V W ++F +YS ++  + ++  M      V    +FWLGLIL+P+A L +D+ W A +RT+ ++L E V ++E R  DPG  +  D   +  N  R+         TP+ V  +N       VS GYAFSQEEHGVVSQSQ++R Y++T ++P
Sbjct:   20 ATGYR----KAEDEMSGTTSQADPVDATARTVLLNRAQTTKYCDNHVSTAKYGILTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRNGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTASFQSLEDLIALSGRLECEGPNRHLYDFTGTLRLDNHNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSIGAAIWNKQHTDEACWYLS--RAGDISLNFAYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDVEMYYAETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCTIAGITYGHFPDLDCDRSMEDFSHLPSTSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKSLGFVFTARTPHSVIIEAVSVCVFSPLIKNQNSLYVSHAMSKLLVFIFQRGKEQTYELLNVLEFSSNRKRMSVIVRTPTGNLRLYCKGADNVIFERLNVTSQYKELTVAHLEQFATEGLRTLCFAYVDLEEGAYLEWLKEYNRISTVLKDRAQKLEECYELIEKNLLLLGATAIEDRLQAGVPETIATLMRADIKIWVLTGDKQETAINIGYSCRLVSHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFEVRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMIRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKALEHDTPFDNGNSVDYLFVGNIVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSMVLWMLFFAVYSAIWPTIPIAPDMLGQAGRVMQCWSFWLGLILVPTACLLKDVVWNAGRRTVRKTLLEEVQELEARAVDPGAAVLRDASGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVSHGYAFSQEEHGVVSQSQVVRSYDTTRQRP 1206          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:ZFIN;Acc:ZDB-GENE-100209-2])

HSP 1 Score: 1224.54 bits (3167), Expect = 0.000e+0
Identity = 634/1197 (52.97%), Postives = 817/1197 (68.25%), Query Frame = 1
Query:   82 APGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTA-WYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKIS----------INNEN---------------------YEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            A GY+     + +E+  TTSQ        R V +N  Q  KYC N +STAKY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L+N  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD      LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +SI   +W   + D A WYL   R         +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I           I N+N                       Y++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERL+  S+  +LT+ +LE+FA  GLRTLC AY +++   Y +W  E++  S  +++R  KL    E IEKNL+L+GA+AIED+LQ  VPETI+ L +A IKIWVLTGDKQETA+NIGYSC+L++  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N +++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  + A  HD PF NG +   LF+GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+V W ++F +YS ++  + ++  M      V    +FWLGLIL+P+A L +D+ W A +RT+ ++L E V ++E R  DPG  +  D   +  N  R+         TP+ V  +N       VS GYAFSQEEHGVVSQSQ++R Y++T ++P
Sbjct:   10 ATGYR----KAEDEMSGTTSQADPVDATARTVLLNRAQTTKYCDNHVSTAKYGILTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRNGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTASFQSLEDLIALSGRLECEGPNRHLYDFTGTLRLDNHNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSIGAAIWNKQHTDEACWYLS--RAGDISLNFAYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDVEMYYAETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCTIAGITYGHFPDLDCDRSMEDFSHLPSTSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKSLGFVFTARTPHSVIIEAVSVCVFSPLIKNQNSLYVSHAMSKLLVFIFQRGKEQTYELLNVLEFSSNRKRMSVIVRTPTGNLRLYCKGADNVIFERLNVTSQYKELTVAHLEQFATEGLRTLCFAYVDLEEGAYLEWLKEYNRISTVLKDRAQKLEECYELIEKNLLLLGATAIEDRLQAGVPETIATLMRADIKIWVLTGDKQETAINIGYSCRLVSHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFEVRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMIRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKALEHDTPFDNGNSVDYLFVGNIVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSMVLWMLFFAVYSAIWPTIPIAPDMLGQAGRVMQCWSFWLGLILVPTACLLKDVVWNAGRRTVRKTLLEEVQELEARAVDPGAAVLRDASGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVSHGYAFSQEEHGVVSQSQVVRSYDTTRQRP 1196          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:ZFIN;Acc:ZDB-GENE-100209-2])

HSP 1 Score: 1224.15 bits (3166), Expect = 0.000e+0
Identity = 634/1197 (52.97%), Postives = 817/1197 (68.25%), Query Frame = 1
Query:   82 APGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTA-WYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKIS----------INNEN---------------------YEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            A GY+     + +E+  TTSQ        R V +N  Q  KYC N +STAKY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L+N  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD      LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +SI   +W   + D A WYL   R         +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I           I N+N                       Y++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERL+  S+  +LT+ +LE+FA  GLRTLC AY +++   Y +W  E++  S  +++R  KL    E IEKNL+L+GA+AIED+LQ  VPETI+ L +A IKIWVLTGDKQETA+NIGYSC+L++  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N +++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  + A  HD PF NG +   LF+GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+V W ++F +YS ++  + ++  M      V    +FWLGLIL+P+A L +D+ W A +RT+ ++L E V ++E R  DPG  +  D   +  N  R+         TP+ V  +N       VS GYAFSQEEHGVVSQSQ++R Y++T ++P
Sbjct:   20 ATGYR----KAEDEMSGTTSQADPVDATARTVLLNRAQTTKYCDNHVSTAKYGILTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRNGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTASFQSLEDLIALSGRLECEGPNRHLYDFTGTLRLDNHNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSIGAAIWNKQHTDEACWYLS--RAGDISLNFAYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDVEMYYAETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCTIAGITYGHFPDLDCDRSMEDFSHLPSTSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKSLGFVFTARTPHSVIIEAVSVCVFSPLIKNQNSLYVSHAMSKLLVFIFQRGKEQTYELLNVLEFSSNRKRMSVIVRTPTGNLRLYCKGADNVIFERLNVTSQYKELTVAHLEQFATEGLRTLCFAYVDLEEGAYLEWLKEYNRISTVLKDRAQKLEECYELIEKNLLLLGATAIEDRLQAGVPETIATLMRADIKIWVLTGDKQETAINIGYSCRLVSHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFEVRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMIRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKALEHDTPFDNGNSVDYLFVGNIVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSMVLWMLFFAVYSAIWPTIPIAPDMLGQAGRVMQCWSFWLGLILVPTACLLKDVVWNAGRRTVRKTLLEEVQELEARAVDPGAAVLRDASGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVSHGYAFSQEEHGVVSQSQVVRSYDTTRQRP 1206          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP8A2 (ATPase, aminophospholipid transporter, class I, type 8A, member 2 [Source:NCBI gene;Acc:101730757])

HSP 1 Score: 1233.39 bits (3190), Expect = 0.000e+0
Identity = 617/1123 (54.94%), Postives = 805/1123 (71.68%), Query Frame = 1
Query:  136 TSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLK----YGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            +S R + IN PQ  K+  N +STAKY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL  ILT++ IKEI+EDY     D         +L+   W  + W+++ VG+ VK+ NGQ +PAD+++L+SSEP  M YIETSNLDGETNLK+RQGLP T ++L+  DL+KM G I CE PNRHLY+F GNL L     + +G +Q+LLRGA ++NT+WV GIVVY+GH+TK+M NST  PLKRS+VE++TN  IL L G+LL + L +S+  ++W    + T WYLG     I      +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD +MY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+CSIGGI YG+ P  + S    DP L + ++     GD+ +  F   LAVCHTVVPEK+++ IIYQASSPDE ALVK A+++GY F  RTPD + I    +   +++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERLS  SK  + TL++LE+FA  GLRTLC+AY ++  +EY++W     EASV I++R  KL    E IEK+L+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETAVNIGYSC+L++Q MSL +++ DSLD TR+ L       G+ +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++ +AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA+V+GFSGQ++FERW IG YNVIFTA PP  LG+ +RSCS ++ L++PQLY+  Q +  F+ +VF    +N+L HS+ILFW  +    HD  F NGQ    LF+GN +Y YV+VTV +K GLE  AWT  SHLA+WGS++ W V+F  YS ++  + ++  M      V +SG FWLGL+L+P+A L RD+ W+A K T  ++L E+V ++E R ++  K    D   K  N       +LG  T P++   N+    +  VS GYAFSQEEHGVVSQSQ++R Y++T ++
Sbjct:   13 SSGRCILINQPQSCKFRDNTVSTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYVSAHLDTQ-------MLKGGTWQNMVWREVAVGDIVKVTNGQHLPADMIILSSSEPQAMCYIETSNLDGETNLKIRQGLPATSNLLSEEDLVKMTGRIECEGPNRHLYDFIGNLRLGTNNPVPVGPEQILLRGAQIRNTQWVIGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALLWNWKYEGTNWYLG----DIVSTNFGYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDRDMYYSETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCSIGGITYGQLPTTSESCDFDDPKLFQNIESDSPTGDT-IKEFLTLLAVCHTVVPEKDEDTIIYQASSPDEGALVKGARKLGYTFTGRTPDSVIIDAMGKEQSFELLNVLEFSSNRKRMSVIVRTPSGNLRLYCKGADNVIFERLSRESKYMEQTLNHLEQFASEGLRTLCLAYCDLQDSEYQEWLNVHSEASVVIKDRAQKLEECYEIIEKDLMLLGATAIEDRLQGGVPETIATLMKAEIKIWVLTGDKQETAVNIGYSCRLVSQTMSLIVVNEDSLDATRSTLTNHCTNLGDGLGKENDLALIIDGQTLKYALSFEVRQSFLDLALSCKAVICCRVSPLQKSEIVDMVKKHV-NAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFCYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAVVNGFSGQVLFERWCIGLYNVIFTALPPFTLGICERSCSQDSMLRFPQLYKITQNADGFNTRVFWGHCINALIHSIILFWFPLKMLEHDAVFTNGQVTDYLFVGNIVYPYVLVTVCLKVGLETPAWTKFSHLAVWGSMLMWLVFFGAYSAIWPTIPIAPDMLGQAGMVLTSGYFWLGLLLVPTACLLRDVTWRAAKHTYHKTLLEQVQEIETRAKEMSKAAMRDSNGKSLNERDHLLRRLGRKTPPSLFRANSV---QQSVSYGYAFSQEEHGVVSQSQVVRSYDTTKQR 1119          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP8A2 (ATPase, aminophospholipid transporter, class I, type 8A, member 2 [Source:NCBI gene;Acc:101730757])

HSP 1 Score: 1231.85 bits (3186), Expect = 0.000e+0
Identity = 617/1123 (54.94%), Postives = 805/1123 (71.68%), Query Frame = 1
Query:  136 TSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLK----YGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            +S R + IN PQ  K+  N +STAKY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL  ILT++ IKEI+EDY     D         +L+   W  + W+++ VG+ VK+ NGQ +PAD+++L+SSEP  M YIETSNLDGETNLK+RQGLP T ++L+  DL+KM G I CE PNRHLY+F GNL L     + +G +Q+LLRGA ++NT+WV GIVVY+GH+TK+M NST  PLKRS+VE++TN  IL L G+LL + L +S+  ++W    + T WYLG     I      +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD +MY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+CSIGGI YG+ P  + S    DP L + ++     GD+ +  F   LAVCHTVVPEK+++ IIYQASSPDE ALVK A+++GY F  RTPD + I    +   +++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERLS  SK  + TL++LE+FA  GLRTLC+AY ++  +EY++W     EASV I++R  KL    E IEK+L+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETAVNIGYSC+L++Q MSL +++ DSLD TR+ L       G+ +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++ +AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA+V+GFSGQ++FERW IG YNVIFTA PP  LG+ +RSCS ++ L++PQLY+  Q +  F+ +VF    +N+L HS+ILFW  +    HD  F NGQ    LF+GN +Y YV+VTV +K GLE  AWT  SHLA+WGS++ W V+F  YS ++  + ++  M      V +SG FWLGL+L+P+A L RD+ W+A K T  ++L E+V ++E R ++  K    D   K  N       +LG  T P++   N+    +  VS GYAFSQEEHGVVSQSQ++R Y++T ++
Sbjct:   49 SSGRCILINQPQSCKFRDNTVSTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYVSAHLDTQ-------MLKGGTWQNMVWREVAVGDIVKVTNGQHLPADMIILSSSEPQAMCYIETSNLDGETNLKIRQGLPATSNLLSEEDLVKMTGRIECEGPNRHLYDFIGNLRLGTNNPVPVGPEQILLRGAQIRNTQWVIGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALLWNWKYEGTNWYLG----DIVSTNFGYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDRDMYYSETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCSIGGITYGQLPTTSESCDFDDPKLFQNIESDSPTGDT-IKEFLTLLAVCHTVVPEKDEDTIIYQASSPDEGALVKGARKLGYTFTGRTPDSVIIDAMGKEQSFELLNVLEFSSNRKRMSVIVRTPSGNLRLYCKGADNVIFERLSRESKYMEQTLNHLEQFASEGLRTLCLAYCDLQDSEYQEWLNVHSEASVVIKDRAQKLEECYEIIEKDLMLLGATAIEDRLQGGVPETIATLMKAEIKIWVLTGDKQETAVNIGYSCRLVSQTMSLIVVNEDSLDATRSTLTNHCTNLGDGLGKENDLALIIDGQTLKYALSFEVRQSFLDLALSCKAVICCRVSPLQKSEIVDMVKKHV-NAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFCYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAVVNGFSGQVLFERWCIGLYNVIFTALPPFTLGICERSCSQDSMLRFPQLYKITQNADGFNTRVFWGHCINALIHSIILFWFPLKMLEHDAVFTNGQVTDYLFVGNIVYPYVLVTVCLKVGLETPAWTKFSHLAVWGSMLMWLVFFGAYSAIWPTIPIAPDMLGQAGMVLTSGYFWLGLLLVPTACLLRDVTWRAAKHTYHKTLLEQVQEIETRAKEMSKAAMRDSNGKSLNERDHLLRRLGRKTPPSLFRANSV---QQSVSYGYAFSQEEHGVVSQSQVVRSYDTTKQR 1155          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP8A1 (ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 [Source:NCBI gene;Acc:733571])

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 616/1140 (54.04%), Postives = 799/1140 (70.09%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD----------------ETFSAQKDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIP----IDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            RI+ IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  ILT++AIKEI+ED KRHKAD+  N  K  +L+N  W  + W++ +VG+ VK+I  + IPAD++LL+SSEP  M YIETSNLDGETNLK+RQGL  T ++  I  LM + G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST PPLK S+VER+TN  IL L G L+ ++L  SI   +W + + D  WYL  +    S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M    T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G  YG  P+                E     +DP+L+E L+       +   F   +A+CHT VPE++ ++IIYQASSPDE ALV+AAK++ ++F  RTP+ + I    +   +++L+VLEFTS RKRMSVIV+    K+ L+ KGAD VIY+RL+  SK  ++TL +LE+FA  GLRTLC A A I  + YE+W   +H AS S++NR  KL    E IEKNL L+GA+AIEDKLQD VPETI  L KA I+IW+LTGDKQETA+NIG+SC+LLT+NM L +++ DSLD TR  L       G+ + KEND  L++ G +LK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LLLVHGAWNYNR+ K ILY FYKN+  ++I+ WFA ++GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q++  F+ KVF    LN L HS+ILFW  + A  HD  F NG+T   L LGN +YT+VV+TV +KAGLE   WT  SH+AIWGS++ W V+F IYS L+  + L+  M+     +FSSG FW+GL  IP  +L  D+ +KAV+RT F++L + V ++E + QDPG ++      +  +   N FR   A L    +   V  N        +  GYAFSQ+E+G+VSQS +IR Y++T ++ E
Sbjct:    2 RIIFINQPQLTKFCNNHVSTAKYNPITFLPRFLYSQFRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLLFILTVAAIKEIIEDIKRHKADNFVNKKKTQVLRNGAWEIVHWEKTEVGDVVKIIGTEYIPADIILLSSSEPQAMCYIETSNLDGETNLKIRQGLSVTAEMKDIDTLMSLSGKIECESPNRHLYDFNGNIRLDGHGLVPLGPDQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTRPPLKLSNVERITNIQILLLFGTLIAISLVCSIGCSIWNSRHGDKDWYLSLNYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFIQAYFINWDVDMLYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGNAYGHCPEPEEDRYSDDGWHYSHSEEGRDFQDPSLMENLENNHPTAPVICEFLTMMAICHTAVPERDGDQIIYQASSPDEGALVRAAKQLRFVFTARTPNSVIIESLGQEERFELLHVLEFTSNRKRMSVIVRNSAGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVASIQDSAYEEWLDVYHRASTSVQNRALKLEECYELIEKNLHLLGATAIEDKLQDNVPETIETLVKADIRIWILTGDKQETAINIGHSCKLLTKNMGLLVINEDSLDTTREVLSHHCSTLGDALRKENDFALIIDGKSLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLLVHGAWNYNRVAKCILYCFYKNIVLYIIEIWFAFMNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCHKENMLKYPELYKTSQKALDFNTKVFWVHCLNGLLHSVILFWFPLKALQHDTIFGNGKTSDYLLLGNIVYTFVVITVCLKAGLETSHWTKFSHIAIWGSILLWIVFFGIYSSLWPAIPLAPDMSGEADMMFSSGVFWMGLFFIPVTSLLLDVLYKAVQRTCFKTLVDEVHELEAKAQDPGAVVHGKSLTERAQLLKNVFRKNTANLYRSES---VQQN--------LLHGYAFSQDENGIVSQSDMIRAYDTTKQRAE 1127          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP8A2 (ATPase, aminophospholipid transporter, class I, type 8A, member 2 [Source:NCBI gene;Acc:101730757])

HSP 1 Score: 1211.82 bits (3134), Expect = 0.000e+0
Identity = 606/1100 (55.09%), Postives = 791/1100 (71.91%), Query Frame = 1
Query:  205 AKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLK----YGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            +KY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL  ILT++ IKEI+EDY     D         +L+   W  + W+++ VG+ VK+ NGQ +PAD+++L+SSEP  M YIETSNLDGETNLK+RQGLP T ++L+  DL+KM G I CE PNRHLY+F GNL L     + +G +Q+LLRGA ++NT+WV GIVVY+GH+TK+M NST  PLKRS+VE++TN  IL L G+LL + L +S+  ++W    + T WYLG     I      +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD +MY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+CSIGGI YG+ P  + S    DP L + ++     GD+ +  F   LAVCHTVVPEK+++ IIYQASSPDE ALVK A+++GY F  RTPD + I    +   +++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERLS  SK  + TL++LE+FA  GLRTLC+AY ++  +EY++W     EASV I++R  KL    E IEK+L+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETAVNIGYSC+L++Q MSL +++ DSLD TR+ L       G+ +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++ +AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA+V+GFSGQ++FERW IG YNVIFTA PP  LG+ +RSCS ++ L++PQLY+  Q +  F+ +VF    +N+L HS+ILFW  +    HD  F NGQ    LF+GN +Y YV+VTV +K GLE  AWT  SHLA+WGS++ W V+F  YS ++  + ++  M      V +SG FWLGL+L+P+A L RD+ W+A K T  ++L E+V ++E R ++  K    D   K  N       +LG  T P++   N+    +  VS GYAFSQEEHGVVSQSQ++R Y++T ++
Sbjct:   19 SKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYVSAHLDTQ-------MLKGGTWQNMVWREVAVGDIVKVTNGQHLPADMIILSSSEPQAMCYIETSNLDGETNLKIRQGLPATSNLLSEEDLVKMTGRIECEGPNRHLYDFIGNLRLGTNNPVPVGPEQILLRGAQIRNTQWVIGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALLWNWKYEGTNWYLG----DIVSTNFGYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDRDMYYSETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCSIGGITYGQLPTTSESCDFDDPKLFQNIESDSPTGDT-IKEFLTLLAVCHTVVPEKDEDTIIYQASSPDEGALVKGARKLGYTFTGRTPDSVIIDAMGKEQSFELLNVLEFSSNRKRMSVIVRTPSGNLRLYCKGADNVIFERLSRESKYMEQTLNHLEQFASEGLRTLCLAYCDLQDSEYQEWLNVHSEASVVIKDRAQKLEECYEIIEKDLMLLGATAIEDRLQGGVPETIATLMKAEIKIWVLTGDKQETAVNIGYSCRLVSQTMSLIVVNEDSLDATRSTLTNHCTNLGDGLGKENDLALIIDGQTLKYALSFEVRQSFLDLALSCKAVICCRVSPLQKSEIVDMVKKHV-NAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFCYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAVVNGFSGQVLFERWCIGLYNVIFTALPPFTLGICERSCSQDSMLRFPQLYKITQNADGFNTRVFWGHCINALIHSIILFWFPLKMLEHDAVFTNGQVTDYLFVGNIVYPYVLVTVCLKVGLETPAWTKFSHLAVWGSMLMWLVFFGAYSAIWPTIPIAPDMLGQAGMVLTSGYFWLGLLLVPTACLLRDVTWRAAKHTYHKTLLEQVQEIETRAKEMSKAAMRDSNGKSLNERDHLLRRLGRKTPPSLFRANSV---QQSVSYGYAFSQEEHGVVSQSQVVRSYDTTKQR 1102          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP8A2 (ATPase, aminophospholipid transporter, class I, type 8A, member 2 [Source:NCBI gene;Acc:101730757])

HSP 1 Score: 1187.17 bits (3070), Expect = 0.000e+0
Identity = 592/1070 (55.33%), Postives = 771/1070 (72.06%), Query Frame = 1
Query:  136 TSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLK----YGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRD 3330
            +S R + IN PQ  K+  N +STAKY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL  ILT++ IKEI+EDY     D         +L+   W  + W+++ VG+ VK+ NGQ +PAD+++L+SSEP  M YIETSNLDGETNLK+RQGLP T ++L+  DL+KM G I CE PNRHLY+F GNL L     + +G +Q+LLRGA ++NT+WV GIVVY+GH+TK+M NST  PLKRS+VE++TN  IL L G+LL + L +S+  ++W    + T WYLG     I      +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD +MY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+CSIGGI YG+ P  + S    DP L + ++     GD+ +  F   LAVCHTVVPEK+++ IIYQASSPDE ALVK A+++GY F  RTPD + I    +   +++LNVLEF+S RKRMSVIV+TP   + L+ KGADNVI+ERLS  SK  + TL++LE+FA  GLRTLC+AY ++  +EY++W     EASV I++R  KL    E IEK+L+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETAVNIGYSC+L++Q MSL +++ DSLD TR+ L       G+ +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++ +AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA+V+GFSGQ++FERW IG YNVIFTA PP  LG+ +RSCS ++ L++PQLY+  Q +  F+ +VF    +N+L HS+ILFW  +    HD  F NGQ    LF+GN +Y YV+VTV +K GLE  AWT  SHLA+WGS++ W V+F  YS ++  + ++  M      V +SG FWLGL+L+P+A L RD+ W+A K T  ++L E+V ++E R ++  K    D   K    +RS +
Sbjct:   63 SSGRCILINQPQSCKFRDNTVSTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYVSAHLDTQ-------MLKGGTWQNMVWREVAVGDIVKVTNGQHLPADMIILSSSEPQAMCYIETSNLDGETNLKIRQGLPATSNLLSEEDLVKMTGRIECEGPNRHLYDFIGNLRLGTNNPVPVGPEQILLRGAQIRNTQWVIGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALLWNWKYEGTNWYLG----DIVSTNFGYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDRDMYYSETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCSIGGITYGQLPTTSESCDFDDPKLFQNIESDSPTGDT-IKEFLTLLAVCHTVVPEKDEDTIIYQASSPDEGALVKGARKLGYTFTGRTPDSVIIDAMGKEQSFELLNVLEFSSNRKRMSVIVRTPSGNLRLYCKGADNVIFERLSRESKYMEQTLNHLEQFASEGLRTLCLAYCDLQDSEYQEWLNVHSEASVVIKDRAQKLEECYEIIEKDLMLLGATAIEDRLQGGVPETIATLMKAEIKIWVLTGDKQETAVNIGYSCRLVSQTMSLIVVNEDSLDATRSTLTNHCTNLGDGLGKENDLALIIDGQTLKYALSFEVRQSFLDLALSCKAVICCRVSPLQKSEIVDMVKKHV-NAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFCYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAVVNGFSGQVLFERWCIGLYNVIFTALPPFTLGICERSCSQDSMLRFPQLYKITQNADGFNTRVFWGHCINALIHSIILFWFPLKMLEHDAVFTNGQVTDYLFVGNIVYPYVLVTVCLKVGLETPAWTKFSHLAVWGSMLMWLVFFGAYSAIWPTIPIAPDMLGQAGMVLTSGYFWLGLLLVPTACLLRDVTWRAAKHTYHKTLLEQVQEIETRAKEMSKAAMRDSNGKRVLKWRSSN 1119          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp8a1 (ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 [Source:MGI Symbol;Acc:MGI:1330848])

HSP 1 Score: 1246.49 bits (3224), Expect = 0.000e+0
Identity = 623/1158 (53.80%), Postives = 813/1158 (70.21%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK---------GPDETFSAQ-------KDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG  VK+ NG+ +PADL+ L+SSEP  M YIETSNLDGETNLK+RQGLP T DI  I  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL       S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG           PDE  S+Q        DP+LL+ L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSV+V+TP  K+ L+ KGAD VIYERL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++E+W+  +H AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+LL +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL+VHGAWNYNR++K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  V ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNVITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVAVGEIVKVTNGEHLPADLLSLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDIDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGHVPEPEDYGCSPDEWQSSQFGDEKTFNDPSLLDNLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVVVRTPSGKLRLYCKGADTVIYERLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCRLLKRNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMVHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTVFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGEAAMLFSSGVFWVGLLSIPVASLLLDVLYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1162          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp8a1 (ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 [Source:MGI Symbol;Acc:MGI:1330848])

HSP 1 Score: 1244.57 bits (3219), Expect = 0.000e+0
Identity = 620/1146 (54.10%), Postives = 812/1146 (70.86%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK----GPDETFSAQKDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG+ V +   + IPAD VLL+SSEP  M YIETSNLDGETNLK+RQGLP T DI  I  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL       S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG+    G ++TF+   DP+LL+ L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSV+V+TP  K+ L+ KGAD VIYERL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++E+W+  +H AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+LL +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL+VHGAWNYNR++K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  V ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNVITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVNVGDIVIIKGKEYIPADTVLLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDIDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGQSSQFGDEKTFN---DPSLLDNLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVVVRTPSGKLRLYCKGADTVIYERLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCRLLKRNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMVHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTVFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGEAAMLFSSGVFWVGLLSIPVASLLLDVLYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1147          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp8a1 (ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 [Source:MGI Symbol;Acc:MGI:1330848])

HSP 1 Score: 1239.94 bits (3207), Expect = 0.000e+0
Identity = 622/1158 (53.71%), Postives = 811/1158 (70.03%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK---------GPDETFSAQ-------KDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG+ V +   + IPAD VLL+SSEP  M YIETSNLDGETNLK+RQGLP T DI  I  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL       S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG           PDE  S+Q        DP+LL+ L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSV+V+TP  K+ L+ KGAD VIYERL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++E+W+  +H AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+LL +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL+VHGAWNYNR++K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  V ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNVITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVNVGDIVIIKGKEYIPADTVLLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDIDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGHVPEPEDYGCSPDEWQSSQFGDEKTFNDPSLLDNLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVVVRTPSGKLRLYCKGADTVIYERLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCRLLKRNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMVHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTVFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGEAAMLFSSGVFWVGLLSIPVASLLLDVLYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1162          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp8a2 (ATPase, aminophospholipid transporter-like, class I, type 8A, member 2 [Source:MGI Symbol;Acc:MGI:1354710])

HSP 1 Score: 1235.71 bits (3196), Expect = 0.000e+0
Identity = 624/1133 (55.08%), Postives = 814/1133 (71.84%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERF-FNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYGDSE---VDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNST 3480
            RI+ +N     K+C N+ISTAKY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL IILTI+ IKEI+ED+KRHKAD++ N  K ++L+N  W  I WK++ VG+ VK++NGQ +PAD+VL +SSEP GM Y+ET+NLDGETNLK+RQGL  T D+ T   LMK+ G I CE PNRHLY+F GNL LDG+  ++LG DQ+LLRG  L+NT+WVFG+VVY+GH++K+M NST  PLKRS+VE++TN  IL L G+LL + L +S+  + W  ++   +WY+   +K  ++ + F +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD++MY  + +TPA ARTSNLNEELGQV+Y+FSDKTGTLT N+M FK+CSI G+ YG  P+       + F              DP LL+ ++        +  F   LAVCHTVVPEK+ +EIIYQASSPDE+ALVK AK++G++F  RTP  + I    +   + +LNVLEF+S RKRMSVIV+ P  ++ L+ KGADNVI+ERLS  SK  + TL +LE FA  GLRTLC+AYA++  NEYE+W   + EAS+ +++R  +L    E IEKNL+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETA+NIGYSC+L++QNM+L +L  DSLD TR  + +     G  +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK  +K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+F+RSC+ E+ L++PQLYR  Q +  F+ KVF    +N+L HSLILFW+ + A  HD P  +G     LF+GN +YTYVVVTV +KAGLE  AWT  SHLA+WGS++ W V+F +YS ++  + ++  M      V SS  FWLGL L+P+A L  D+AW+A K T  ++L E V ++E +++  GK +  D   K  N       +L   T PT+    +    +  VS GYAFSQEEHG V+Q +++R Y++T
Sbjct:   16 RIIYLNQSHLNKFCDNRISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLVIILTIAGIKEIIEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVLNGQYLPADMVLFSSSEPQGMCYVETANLDGETNLKIRQGLSHTTDMQTRDVLMKLSGRIECEGPNRHLYDFTGNLHLDGKSSVALGPDQILLRGTQLRNTQWVFGVVVYTGHDSKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALFWNGSHGGKSWYI---KKMDTNSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDMDMYYIENDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREQSSDDFCRMTSCTNDSCDFNDPRLLKNIEDQHPTAPCIQEFLTLLAVCHTVVPEKDGDEIIYQASSPDEAALVKGAKKLGFVFTGRTPYSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRLPSGQLRLYCKGADNVIFERLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASIILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGNLLGKENDVALIIDGHTLKYALSFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKKRVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYRITQNAEGFNTKVFWGHCINALVHSLILFWVPMKALEHDTPVTSGHATDYLFVGNIVYTYVVVTVCLKAGLETTAWTKFSHLAVWGSMLIWLVFFGVYSTIWPTIPIAPDMKGQATMVLSSAYFWLGLFLVPTACLIEDVAWRAAKHTCKKTLLEEVQELETKSRVMGKAMLRDSNGKRMNERDRLIKRLSRKTPPTLFRTGSI---QQCVSHGYAFSQEEHGAVTQEEIVRAYDTT 1141          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp8b2 (ATPase, class I, type 8B, member 2 [Source:MGI Symbol;Acc:MGI:1859660])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 445/1106 (40.24%), Postives = 670/1106 (60.58%), Query Frame = 1
Query:  127 KETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNN--SKILI---LQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTN-ANKDTAWYLGFDRKPIS-HWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK-----GPDETFSAQKDP------------------NLLEKLKYGDSEVDMFFKALAVCHTVVP-EKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKN-GKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDS--------DSLDKTRTQLIEVRQGFGENIGKENDI----------------GLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWF-VYFIIYSH-LFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRE--RVMQMEKRNQ 3264
            +E    R  +  + +  +Y  N I T+KYN +TF+P  LFEQF+  AN +FL + ILQ  P +S    +TT VPL ++LTI+A+K+  +DY RHK+D+  NN  S++LI   LQ  +W+ +C     VG+ +KL N Q + ADL+LL+SSEPHG+ YIET+ LDGETN+K+RQ +P T ++  ++ L +  G + CE PN  L +F G L    E K  L N  +LLRG  L+NT+W FG+V+++G +TK+M NS     KR+S++R+ N  +L + G L+ + +  +I N +W +        YL +D    S  +  F +F +++I+ NT++PISL V++EV+R   ++FINWD +M+     TPA ART+ LNEELGQV YIFSDKTGTLT+N+M F +CSI G  YG      G       + +P                  +LLE +K GD     FF+ L++CHTV+  EK + E+ Y+A SPDE ALV AA+  G++F +RTP  I +        Y++L +L+F ++RKRMSVIV+ P+ KI L+ KGAD ++ +RL   ++     T D+L E+A  GLRTL +AY ++D   YE+W     +AS++ ++RE++LA++ E++E +++L+GA+AIEDKLQ  VPETI+ L  A IKIWVLTGDKQETAVNIGYSC++LT +M+   + +        + L K R ++++     G     + ++                 LV++G +L  AL+     +FL+ A +CKAVICCRV+P QKA+VV LVK   K A+TLAIGDGANDV MI+ AH+G+GISG EG QA   SDY+ +QF+FL RLLLVHG W+Y R+ K + Y FYKN  F ++ FWF    GFS Q +++++ I  YN+++T+ P LA+G+FD+    + S++YP+LY   Q +  F+ + F   I   +Y S+++F++              Q          + T +V+ VSV+ GL+   WT ++H  IWGS+  +F + F ++S+ LF +           Q   +  T WL + L  +  +   +A++ ++ +L   L +  R  Q+ ++ Q
Sbjct:   11 EEERRARANDREYNEKFQYASNCIKTSKYNIVTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVPLVLVLTITAVKDATDDYFRHKSDNQVNNRHSQVLINGVLQQEQWMNVC-----VGDIIKLENNQFVAADLLLLSSSEPHGLCYIETAELDGETNMKVRQAIPVTSELGDVSQLARFDGEVICEPPNNKLDKFSGTLYWK-ENKFPLSNQNMLLRGCVLRNTEWCFGLVIFAGPDTKLMQNSGRTKFKRTSIDRLMNTLVLWIFGFLVCMGVILAIGNAIWEHEVGTRFQVYLPWDEAVDSAFFSGFLSFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDKKMFCMKKRTPAEARTTTLNEELGQVEYIFSDKTGTLTQNIMVFNKCSINGHSYGDVFDVLGHKAELGERPEPVDFSFNPLADKKFLFWDSSLLEAVKMGDPHTHEFFRLLSLCHTVMSEEKNEGELYYKAQSPDEGALVTAARNFGFVFRSRTPKTITVHELGTAITYQLLAILDFNNIRKRMSVIVRNPEGKIRLYCKGADTILLDRLHPPTQELLSSTTDHLNEYAGDGLRTLVLAYKDLDEEYYEEWARRRLQASLAQDSREDRLASIYEEVESDMMLLGATAIEDKLQQGVPETIALLTLANIKIWVLTGDKQETAVNIGYSCKMLTDDMTEVFVVTGHTVLEVREELRKARKKMVDSSHAVGNGFTYQGNLSSSKLTSVLEAVAGEYALVINGHSLAHALEADMELEFLETACACKAVICCRVTPLQKAQVVELVK-KYKKAVTLAIGDGANDVSMIKTAHIGVGISGQEGIQAVLASDYSFSQFKFLQRLLLVHGRWSYLRMCKFLCYFFYKNFAFTMVHFWFGFFCGFSAQTVYDQYFITLYNIVYTSLPVLAMGVFDQDVPEQRSMEYPKLYEPGQLNLLFNKREFFICIAQGIYTSVLMFFIPYGVFAEATRDDGTQLADYQSFAVTVATSLVIVVSVQIGLDTGYWTAINHFFIWGSLAVYFAILFAMHSNGLFDMFPNQFRFVGNAQNTLAQPTVWLTIALTTAVCIMPVVAFRFLRLSLKPDLSDTVRYTQLVRKKQ 1109          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|P70704|AT8A1_MOUSE (Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2)

HSP 1 Score: 1246.49 bits (3224), Expect = 0.000e+0
Identity = 623/1158 (53.80%), Postives = 813/1158 (70.21%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK---------GPDETFSAQ-------KDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG  VK+ NG+ +PADL+ L+SSEP  M YIETSNLDGETNLK+RQGLP T DI  I  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL       S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG           PDE  S+Q        DP+LL+ L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSV+V+TP  K+ L+ KGAD VIYERL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++E+W+  +H AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+LL +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL+VHGAWNYNR++K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  V ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNVITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVAVGEIVKVTNGEHLPADLLSLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDIDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGHVPEPEDYGCSPDEWQSSQFGDEKTFNDPSLLDNLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVVVRTPSGKLRLYCKGADTVIYERLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCRLLKRNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMVHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTVFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGEAAMLFSSGVFWVGLLSIPVASLLLDVLYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1162          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q9Y2Q0|AT8A1_HUMAN (Phospholipid-transporting ATPase IA OS=Homo sapiens OX=9606 GN=ATP8A1 PE=1 SV=1)

HSP 1 Score: 1240.71 bits (3209), Expect = 0.000e+0
Identity = 616/1158 (53.20%), Postives = 812/1158 (70.12%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK---------GPDETFSAQ-------KDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG  VK+ NG+ +PADL+ L+SSEP  M YIETSNLDGETNLK+RQGLP T DI  +  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL  +    S++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG           PDE  ++Q        D +LLE L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSVIV+TP  K+ L+ KGAD VIY+RL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++++W+  +  AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+LL +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  +TLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL++HGAWNYNR++K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  + ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVAVGEIVKVTNGEHLPADLISLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDVDSLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGHVPEPEDYGCSPDEWQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVIVRTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYQRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLKKNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTAFGNGKTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAIPMAPDMSGEAAMLFSSGVFWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1162          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|P98200|AT8A2_MOUSE (Phospholipid-transporting ATPase IB OS=Mus musculus OX=10090 GN=Atp8a2 PE=1 SV=1)

HSP 1 Score: 1235.71 bits (3196), Expect = 0.000e+0
Identity = 624/1133 (55.08%), Postives = 814/1133 (71.84%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERF-FNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYGDSE---VDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNST 3480
            RI+ +N     K+C N+ISTAKY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL IILTI+ IKEI+ED+KRHKAD++ N  K ++L+N  W  I WK++ VG+ VK++NGQ +PAD+VL +SSEP GM Y+ET+NLDGETNLK+RQGL  T D+ T   LMK+ G I CE PNRHLY+F GNL LDG+  ++LG DQ+LLRG  L+NT+WVFG+VVY+GH++K+M NST  PLKRS+VE++TN  IL L G+LL + L +S+  + W  ++   +WY+   +K  ++ + F +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD++MY  + +TPA ARTSNLNEELGQV+Y+FSDKTGTLT N+M FK+CSI G+ YG  P+       + F              DP LL+ ++        +  F   LAVCHTVVPEK+ +EIIYQASSPDE+ALVK AK++G++F  RTP  + I    +   + +LNVLEF+S RKRMSVIV+ P  ++ L+ KGADNVI+ERLS  SK  + TL +LE FA  GLRTLC+AYA++  NEYE+W   + EAS+ +++R  +L    E IEKNL+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETA+NIGYSC+L++QNM+L +L  DSLD TR  + +     G  +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK  +K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+F+RSC+ E+ L++PQLYR  Q +  F+ KVF    +N+L HSLILFW+ + A  HD P  +G     LF+GN +YTYVVVTV +KAGLE  AWT  SHLA+WGS++ W V+F +YS ++  + ++  M      V SS  FWLGL L+P+A L  D+AW+A K T  ++L E V ++E +++  GK +  D   K  N       +L   T PT+    +    +  VS GYAFSQEEHG V+Q +++R Y++T
Sbjct:   16 RIIYLNQSHLNKFCDNRISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLVIILTIAGIKEIIEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVLNGQYLPADMVLFSSSEPQGMCYVETANLDGETNLKIRQGLSHTTDMQTRDVLMKLSGRIECEGPNRHLYDFTGNLHLDGKSSVALGPDQILLRGTQLRNTQWVFGVVVYTGHDSKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALFWNGSHGGKSWYI---KKMDTNSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDMDMYYIENDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREQSSDDFCRMTSCTNDSCDFNDPRLLKNIEDQHPTAPCIQEFLTLLAVCHTVVPEKDGDEIIYQASSPDEAALVKGAKKLGFVFTGRTPYSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRLPSGQLRLYCKGADNVIFERLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASIILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGNLLGKENDVALIIDGHTLKYALSFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKKRVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYRITQNAEGFNTKVFWGHCINALVHSLILFWVPMKALEHDTPVTSGHATDYLFVGNIVYTYVVVTVCLKAGLETTAWTKFSHLAVWGSMLIWLVFFGVYSTIWPTIPIAPDMKGQATMVLSSAYFWLGLFLVPTACLIEDVAWRAAKHTCKKTLLEEVQELETKSRVMGKAMLRDSNGKRMNERDRLIKRLSRKTPPTLFRTGSI---QQCVSHGYAFSQEEHGAVTQEEIVRAYDTT 1141          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q29449|AT8A1_BOVIN (Probable phospholipid-transporting ATPase IA OS=Bos taurus OX=9913 GN=ATP8A1 PE=1 SV=2)

HSP 1 Score: 1234.17 bits (3192), Expect = 0.000e+0
Identity = 616/1146 (53.75%), Postives = 808/1146 (70.51%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK----GPDETFSAQKDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPE 3495
            A GY KT        L +    R + IN PQ  K+C N +STAKYN +TF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGRYTT VPL  IL ++AIKEI+ED KRHKAD++ N  +  +L+N  W  + W+++ VG+ V +   + IPAD VLL+SSEP  M YIETSNLDGETNLK+RQGLP T DI  I  LM++ G I CE PNRHLY+F GN+ LDG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST+PPLK S+VER+TN  IL L  +L+ ++L  S+ + +W   +    WYL  +    +++    NFLTF+IL+N +IPISL VT+EVV+  Q +FINWD++M+   T+T A ARTSNLN ELGQV+YIFSDKTGTLT NVM+FK+C+I G+ YG+    G ++TFS   D +LLE L+       +   F   +AVCHT VPE+E ++IIYQA+SPDE ALV+AAK++ ++F  RTPD + I    +   Y++LNVLEFTS RKRMSVIV+TP  K+ L+ KGAD VIY+RL+  SK  ++TL +LE+FA  GLRTLC A AEI  +++++W+  +H AS S++NR  KL    E IEKNL L+GA+AIEDKLQDQVPETI  L KA IKIW+LTGDKQETA+NIG+SC+L  +NM + +++  SLD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDV MIQ AHVG+GISG EG QAA +SDY+IAQF++L  LL+VHGAWNYNR +K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNV+FTA PPL LG+F+RSC  E  LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  +   F NG+T   L LGN +YT+VV+TV +KAGLE   WTW SH+AIWGS+  W V+F IYS L+  V ++  M+     +FSSG FW+GL+ IP A+L  D+ +K +KRT F++L + V ++E ++QDPG ++              R   L        V+     + +  +  GYAFSQ+E+G+VSQS++IR Y++T ++P+
Sbjct:   15 AEGYEKTDDVSEKTSLADQEEIRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRNGAWEIVHWEKVNVGDIVIIKGKEYIPADTVLLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDIDSLMRLSGRIECESPNRHLYDFVGNIRLDGRSTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGRDWYLNLNYGGANNFG--LNFLTFIILFNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNVELGQVKYIFSDKTGTLTCNVMQFKKCTIAGVAYGQNSQFGDEKTFS---DSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVIVRTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYHRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCKLRRKNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMVHGAWNYNRGSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSCRKEYMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTVFENGRTSDYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGEAAMLFSSGVFWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPGAVV-------LGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPD 1147          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q9NTI2|AT8A2_HUMAN (Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3)

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 629/1136 (55.37%), Postives = 807/1136 (71.04%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERF-FNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYGDSE---VDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            R + +N P   K+  N+ISTAKY+ LTF+P+FL+EQ RR AN FFL IA+LQQ P+VSPTGRYTT VPL IILTI+ IKEIVED+KRHKAD++ N  K ++L+N  W  I WK++ VG+ VK++NGQ +PAD+VLL+SSEP  M Y+ET+NLDGETNLK+RQGL  T D+ T   LMK+ G I CE PNRHLY+F GNL LDG+  ++LG DQ+LLRG  L+NT+WVFGIVVY+GH+TK+M NST  PLKRS+VE++TN  IL L G+LL + L +S   + W  ++ +  WY+   +K  +  + F +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD +MY    +TPA ARTSNLNEELGQV+Y+FSDKTGTLT N+M FK+CSI G+ YG  P+       + F              DP LL+ ++        +  F   LAVCHTVVPEK+ + IIYQASSPDE+ALVK AK++G++F  RTP  + I    +   + +LNVLEF+S RKRMSVIV+TP  ++ L+ KGADNVI+ERLS  SK  + TL +LE FA  GLRTLC+AYA++  NEYE+W   + EAS  +++R  +L    E IEKNL+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETA+NIGYSC+L++QNM+L +L  DSLD TR  + +     G  +GKEND+ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK  +K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  NSDYAIAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+F+RSC+ E+ L++PQLY+  Q    F+ KVF    +N+L HSLILFW  + A  HD    +G     LF+GN +YTYVVVTV +KAGLE  AWT  SHLA+WGS++ W V+F IYS ++  + ++  M      V SS  FWLGL L+P+A L  D+AW+A K T  ++L E V ++E +++  GK +  D   K  N       +LG  T PT+   ++     P    GYAFSQEEHG VSQ ++IR Y++T KK
Sbjct:   56 RTIYLNQPHLNKFRDNQISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTTLVPLIIILTIAGIKEIVEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVVNGQYLPADVVLLSSSEPQAMCYVETANLDGETNLKIRQGLSHTADMQTREVLMKLSGTIECEGPNRHLYDFTGNLNLDGKSLVALGPDQILLRGTQLRNTQWVFGIVVYTGHDTKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSAGALYWNRSHGEKNWYI---KKMDTTSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDTDMYYIGNDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDNIIYQASSPDEAALVKGAKKLGFVFTARTPFSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRTPSGRLRLYCKGADNVIFERLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASTILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGNLLGKENDVALIIDGHTLKYALSFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKKRVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYKITQNGEGFNTKVFWGHCINALVHSLILFWFPMKALEHDTVLTSGHATDYLFVGNIVYTYVVVTVCLKAGLETTAWTKFSHLAVWGSMLTWLVFFGIYSTIWPTIPIAPDMRGQATMVLSSAHFWLGLFLVPTACLIEDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPH---GYAFSQEEHGAVSQEEVIRAYDTTKKK 1184          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A4S2LX99 (Phospholipid-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_004223 PE=3 SV=1)

HSP 1 Score: 1395.18 bits (3610), Expect = 0.000e+0
Identity = 695/1148 (60.54%), Postives = 864/1148 (75.26%), Query Frame = 1
Query:  100 MTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEK--EDNEI--IYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPF-------RSRDAKLGGPTTPTIVDDNNRFNHRP----RVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEG 3498
            M +  +E   E +  R+V IN  Q   +C N+ISTAKY+  TF+PKFL+EQFRRYANIFFL IA+LQQ P VSPTGR+TT VPL IILT+SAIKE++ED KRH ADD+TN SK  +L+  EW+E  WK L VG+ VK+ N Q IPADLVLLASSEP  M YIETSNLDGETNLK+RQGLP+T D+LT   L    G + CE+PNR L EF G L      +  L  +QLL+RGA+LKNTKWVFG+ VY+G E+KVMLNST+ PLK+S+VER TN YIL L G+LLFLTL T  AN+VWT  N+ T WYL       S      + +T LILYNT+IPISLPV +EVVR  Q  +INWD++MYD DT+TPA ARTSNLNEELGQVRY+FSDKTGTLTRNVMEFK+CSIGG++YG   +++ +A  D  LLE+LK  D     FF  LA+CHTVVP+   ED E+   YQASSPDE+ALVKAA+ +G++F TRTP G+ I ++ E   Y+VL VLEFTS RKRM V+V+ P  +I++  KGAD VI+ERL+   +  + TL++LE FA+ GLRTLCIA AE+ S  +E W  E++ AS +I+ RE +L  VAE IEKNL L+GA+AIEDKLQ+ VPETI+NL +AGI +WVLTGDKQETA+NIGYSC+LL+  + L  ++++SLD+TR +L E+ + FG N+  END+ L+V G TL+FAL  +CR DF+++ALSC++VICCRVSP QKAE+V LV++++KDA+TLAIGDGANDVGMIQAAHVG+GISG+EG+QAAC SDYAIAQFRFLN+LLLVHGAWNYNRLTKLILYSFYKNVC ++IQFWFAI+SGFSGQIIFERW+IG YNV+F+AAPP+ALGLFDRSCS  N L YP+LYR+ Q S++F+LKVFL WILNS++HS ILFW+ + A + +  + +G + SLL LGN +YTYVVVTV +KAGLEH AWTWLSHLAIWGSV  WF + ++YSH +  + L++ M  M  AV+    FW+GLILIPS  LTRD+AWK  KR+   SLRE+VMQME+ + DPG +I   +K K            R+R ++      P    +  R    P    +   GYAFSQEEHGVV QS LIR Y+STI KPEG
Sbjct:    1 MMKRKLESSGEASQSRVVQINDHQLSNFCKNEISTAKYSVWTFIPKFLYEQFRRYANIFFLAIALLQQIPGVSPTGRFTTLVPLLIILTVSAIKEMIEDLKRHYADDATNKSKTQVLREGEWMETMWKDLMVGDLVKVCNNQEIPADLVLLASSEPQAMCYIETSNLDGETNLKLRQGLPQTADLLTAGSLGAYRGWVECELPNRKLEEFVGVLRASDGVRYPLKPNQLLIRGASLKNTKWVFGLAVYTGKESKVMLNSTSRPLKQSTVERQTNTYILFLFGVLLFLTLFTFFANLVWTRWNEPTMWYLESKVTDASALRIVLDLITCLILYNTVIPISLPVMLEVVRFIQALYINWDLDMYDSDTDTPAMARTSNLNEELGQVRYLFSDKTGTLTRNVMEFKRCSIGGVMYGNDTEDS-NAMNDRALLERLKANDPLAKHFFTVLALCHTVVPDAHLEDPELPLTYQASSPDEAALVKAARSLGFVFATRTPSGVSIRVDGEELHYEVLQVLEFTSFRKRMGVVVRDPSGRILVLVKGADTVIFERLAKDCQYQEATLEHLEIFARTGLRTLCIASAEVSSEFHESWSKEYYAASTAIDRREERLEQVAEAIEKNLHLLGATAIEDKLQEGVPETIANLIQAGISVWVLTGDKQETAINIGYSCRLLSPVLDLVTVNTESLDETRMKLRELVELFGPNLRSENDVALIVDGHTLEFALSCECRKDFVEVALSCRSVICCRVSPWQKAELVRLVRTSVKDAVTLAIGDGANDVGMIQAAHVGVGISGMEGRQAACASDYAIAQFRFLNKLLLVHGAWNYNRLTKLILYSFYKNVCLYLIQFWFAILSGFSGQIIFERWTIGLYNVLFSAAPPMALGLFDRSCSVRNCLLYPELYRDTQASASFNLKVFLCWILNSVFHSAILFWIPLAAFSSNTLYSSGHSASLLVLGNSVYTYVVVTVCLKAGLEHTAWTWLSHLAIWGSVATWFFFLLVYSHFYPSLPLASDMVGMDSAVYGCWVFWMGLILIPSFCLTRDVAWKMAKRSFAGSLREQVMQMEQMHVDPGSMIKASLKSKVAKKSGILRAFRRTRGSEALLNLCPGAAIERTRTLSGPQTVGQADHGYAFSQEEHGVVRQSDLIRAYDSTIGKPEG 1147          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A4S2LXA2 (Phospholipid-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_004223 PE=3 SV=1)

HSP 1 Score: 1390.17 bits (3597), Expect = 0.000e+0
Identity = 694/1155 (60.09%), Postives = 863/1155 (74.72%), Query Frame = 1
Query:  100 MTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEK--EDNEI--IYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPF--------------RSRDAKLGGPTTPTIVDDNNRFNHRP----RVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEG 3498
            M +  +E   E +  R+V IN  Q   +C N+ISTAKY+  TF+PKFL+EQFRRYANIFFL IA+LQQ P VSPTGR+TT VPL IILT+SAIKE++ED KRH ADD+TN SK  +L+  EW+E  WK L VG+ VK+ N Q IPADLVLLASSEP  M YIETSNLDGETNLK+RQGLP+T D+LT   L    G + CE+PNR L EF G L      +  L  +QLL+RGA+LKNTKWVFG+ VY+G E+KVMLNST+ PLK+S+VER TN YIL L G+LLFLTL T  AN+VWT  N+ T WYL       S      + +T LILYNT+IPISLPV +EVVR  Q  +INWD++MYD DT+TPA ARTSNLNEELGQVRY+FSDKTGTLTRNVMEFK+CSIGG++YG   +++ +A  D  LLE+LK  D     FF  LA+CHTVVP+   ED E+   YQASSPDE+ALVKAA+ +G++F TRTP G+ I ++ E   Y+VL VLEFTS RKRM V+V+ P  +I++  KGAD VI+ERL+   +  + TL++LE FA+ GLRTLCIA AE+ S  +E W  E++ AS +I+ RE +L  VAE IEKNL L+GA+AIEDKLQ+ VPETI+NL +AGI +WVLTGDKQETA+NIGYSC+LL+  + L  ++++SLD+TR +L E+ + FG N+  END+ L+V G TL+FAL  +CR DF+++ALSC++VICCRVSP QKAE+V LV++++KDA+TLAIGDGANDVGMIQAAHVG+GISG+EG+QAAC SDYAIAQFRFLN+LLLVHGAWNYNRLTKLILYSFYKNVC ++IQFWFAI+SGFSGQIIFERW+IG YNV+F+AAPP+ALGLFDRSCS  N L YP+LYR+ Q S++F+LKVFL WILNS++HS ILFW+ + A + +  + +G + SLL LGN +YTYVVVTV +KAGLEH AWTWLSHLAIWGSV  WF + ++YSH +  + L++ M  M  AV+    FW+GLILIPS  LTRD+AWK  KR+   SLRE+VMQME+ + DPG +I   +K                     R+R ++      P    +  R    P    +   GYAFSQEEHGVV QS LIR Y+STI KPEG
Sbjct:    1 MMKRKLESSGEASQSRVVQINDHQLSNFCKNEISTAKYSVWTFIPKFLYEQFRRYANIFFLAIALLQQIPGVSPTGRFTTLVPLLIILTVSAIKEMIEDLKRHYADDATNKSKTQVLREGEWMETMWKDLMVGDLVKVCNNQEIPADLVLLASSEPQAMCYIETSNLDGETNLKLRQGLPQTADLLTAGSLGAYRGWVECELPNRKLEEFVGVLRASDGVRYPLKPNQLLIRGASLKNTKWVFGLAVYTGKESKVMLNSTSRPLKQSTVERQTNTYILFLFGVLLFLTLFTFFANLVWTRWNEPTMWYLESKVTDASALRIVLDLITCLILYNTVIPISLPVMLEVVRFIQALYINWDLDMYDSDTDTPAMARTSNLNEELGQVRYLFSDKTGTLTRNVMEFKRCSIGGVMYGNDTEDS-NAMNDRALLERLKANDPLAKHFFTVLALCHTVVPDAHLEDPELPLTYQASSPDEAALVKAARSLGFVFATRTPSGVSIRVDGEELHYEVLQVLEFTSFRKRMGVVVRDPSGRILVLVKGADTVIFERLAKDCQYQEATLEHLEIFARTGLRTLCIASAEVSSEFHESWSKEYYAASTAIDRREERLEQVAEAIEKNLHLLGATAIEDKLQEGVPETIANLIQAGISVWVLTGDKQETAINIGYSCRLLSPVLDLVTVNTESLDETRMKLRELVELFGPNLRSENDVALIVDGHTLEFALSCECRKDFVEVALSCRSVICCRVSPWQKAELVRLVRTSVKDAVTLAIGDGANDVGMIQAAHVGVGISGMEGRQAACASDYAIAQFRFLNKLLLVHGAWNYNRLTKLILYSFYKNVCLYLIQFWFAILSGFSGQIIFERWTIGLYNVLFSAAPPMALGLFDRSCSVRNCLLYPELYRDTQASASFNLKVFLCWILNSVFHSAILFWIPLAAFSSNTLYSSGHSASLLVLGNSVYTYVVVTVCLKAGLEHTAWTWLSHLAIWGSVATWFFFLLVYSHFYPSLPLASDMVGMDSAVYGCWVFWMGLILIPSFCLTRDVAWKMAKRSFAGSLREQVMQMEQMHVDPGSMIKASLKSNVLEDILSVAKKSGILRAFRRTRGSEALLNLCPGAAIERTRTLSGPQTVGQADHGYAFSQEEHGVVRQSDLIRAYDSTIGKPEG 1154          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A4S2LXA0 (Phospholipid-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_004223 PE=3 SV=1)

HSP 1 Score: 1389.79 bits (3596), Expect = 0.000e+0
Identity = 693/1148 (60.37%), Postives = 866/1148 (75.44%), Query Frame = 1
Query:  100 MTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEK--EDNEI--IYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPF-------RSRDAKLGGPTTPTIVDDNNRFNHRP----RVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEG 3498
            M +  +E   E +  R+V IN  Q   +C N+ISTAKY+  TF+PKFL+EQFRRYANIFFL IA+LQQ P VSPTGR+TT VPL IILT+SAIKE++ED KRH ADD+TN SK  +L+  EW+E  WK L VG+ VK+ N Q IPADLVLLASSEP  M YIETSNLDGETNLK+RQGLP+T D+LT   L    G + CE+PNR L EF G L      +  L  +QLL+RGA+LKNTKWVFG+ VY+G E+KVMLNST+ PLK+S+VER TN YIL L G+LLFLTL T  AN+VWT  N+ T WYL  + K +S  +     LT  I+Y+TI+PISL V++E+VR  Q  FINWD++MYD DT+TPA ARTSNLNEELGQVRY+FSDKTGTLTRNVMEFK+CSIGG++YG   +++ +A  D  LLE+LK  D     FF  LA+CHTVVP+   ED E+   YQASSPDE+ALVKAA+ +G++F TRTP G+ I ++ E   Y+VL VLEFTS RKRM V+V+ P  +I++  KGAD VI+ERL+   +  + TL++LE FA+ GLRTLCIA AE+ S  +E W  E++ AS +I+ RE +L  VAE IEKNL L+GA+AIEDKLQ+ VPETI+NL +AGI +WVLTGDKQETA+NIGYSC+LL+  + L  ++++SLD+TR +L E+ + FG N+  END+ L+V G TL+FAL  +CR DF+++ALSC++VICCRVSP QKAE+V LV++++KDA+TLAIGDGANDVGMIQAAHVG+GISG+EG+QAAC SDYAIAQFRFLN+LLLVHGAWNYNRLTKLILYSFYKNVC ++IQFWFAI+SGFSGQIIFERW+IG YNV+F+AAPP+ALGLFDRSCS  N L YP+LYR+ Q S++F+LKVFL WILNS++HS ILFW+ + A + +  + +G + SLL LGN +YTYVVVTV +KAGLEH AWTWLSHLAIWGSV  WF + ++YSH +  + L++ M  M  AV+    FW+GLILIPS  LTRD+AWK  KR+   SLRE+VMQME+ + DPG +I   +K K            R+R ++      P    +  R    P    +   GYAFSQEEHGVV QS LIR Y+STI KPEG
Sbjct:    1 MMKRKLESSGEASQSRVVQINDHQLSNFCKNEISTAKYSVWTFIPKFLYEQFRRYANIFFLAIALLQQIPGVSPTGRFTTLVPLLIILTVSAIKEMIEDLKRHYADDATNKSKTQVLREGEWMETMWKDLMVGDLVKVCNNQEIPADLVLLASSEPQAMCYIETSNLDGETNLKLRQGLPQTADLLTAGSLGAYRGWVECELPNRKLEEFVGVLRASDGVRYPLKPNQLLIRGASLKNTKWVFGLAVYTGKESKVMLNSTSRPLKQSTVERQTNTYILFLFGVLLFLTLFTFFANLVWTRWNEPTMWYL--ESKELSARQMAHMLLTAFIMYHTIVPISLQVSLELVRFAQALFINWDLDMYDSDTDTPAMARTSNLNEELGQVRYLFSDKTGTLTRNVMEFKRCSIGGVMYGNDTEDS-NAMNDRALLERLKANDPLAKHFFTVLALCHTVVPDAHLEDPELPLTYQASSPDEAALVKAARSLGFVFATRTPSGVSIRVDGEELHYEVLQVLEFTSFRKRMGVVVRDPSGRILVLVKGADTVIFERLAKDCQYQEATLEHLEIFARTGLRTLCIASAEVSSEFHESWSKEYYAASTAIDRREERLEQVAEAIEKNLHLLGATAIEDKLQEGVPETIANLIQAGISVWVLTGDKQETAINIGYSCRLLSPVLDLVTVNTESLDETRMKLRELVELFGPNLRSENDVALIVDGHTLEFALSCECRKDFVEVALSCRSVICCRVSPWQKAELVRLVRTSVKDAVTLAIGDGANDVGMIQAAHVGVGISGMEGRQAACASDYAIAQFRFLNKLLLVHGAWNYNRLTKLILYSFYKNVCLYLIQFWFAILSGFSGQIIFERWTIGLYNVLFSAAPPMALGLFDRSCSVRNCLLYPELYRDTQASASFNLKVFLCWILNSVFHSAILFWIPLAAFSSNTLYSSGHSASLLVLGNSVYTYVVVTVCLKAGLEHTAWTWLSHLAIWGSVATWFFFLLVYSHFYPSLPLASDMVGMDSAVYGCWVFWMGLILIPSFCLTRDVAWKMAKRSFAGSLREQVMQMEQMHVDPGSMIKASLKSKVAKKSGILRAFRRTRGSEALLNLCPGAAIERTRTLSGPQTVGQADHGYAFSQEEHGVVRQSDLIRAYDSTIGKPEG 1145          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A5K4EJ87 (Phospholipid-transporting ATPase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1381.7 bits (3575), Expect = 0.000e+0
Identity = 699/1145 (61.05%), Postives = 855/1145 (74.67%), Query Frame = 1
Query:  199 STAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEKE-------------------------DNE--IIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRK------FCNPFRSRDAK-------LGGP-----TTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEG 3498
            STAKYNFLTF+PKF+ EQFRRYANIFFL+IA+LQQ P VSPTGR+TT VPL IILT+SAIKE++ED++RH+ADD+TNN + L+L+N  WV+ICWK L+VG+ VK+++ +GIPADLVLLASSEP  M YIETSNLDGETNLK+RQGLP T  +LT  +L      + CE PNR L EF G +         L   QL+LRGA+LKNTKW+FG+ VY+G E+KVMLNST  PLKRS+VER TN YIL L G+LLFLT  T IAN+VWT+ N+   WYL  +    S   R  +F+T LILYNTIIPISLPV +EVVR  Q  +INWD++MYD D++TPA ARTSNLNEELGQVRYIFSDKTGTLTRNVMEFK+CSIGGI+YG G +++ +A +D NL+ KL  GD  VD FF  LAVCHTVVPE+                          +NE  I YQASSPDE+ALVKAA+ MGY+F TRTP  + + I      Y +L+VL+FTS RKRM V+V+ P+ +I +  KGAD VI+ERL++ S   + T+D+LE FAK GLRTLCIA+ E+D   Y KW   F++AS ++ +RE KL  VA +IE+NL L+GA+AIEDKLQ  VP TISNL +AGI IWVLTGDKQETA+NIGYSCQLLTQ++SL  +++ SLD+TR QL+ + + FG+ I  END  L+V G TL+FAL  +CR+ FL +ALSCK+VICCRVSP QKA++V LV+ +IKDA+TLAIGDGANDVGMIQAAHVG+GISG+EG+QAAC SDYAIAQFRFLN+LLLVHGAWNYNRLTKLILYSFYKNVC ++IQFWFAI+SGFSGQI+FERWSIG YNVIFTAAPP+ALGLFDRSCS  N LKYP+LY++ Q S++F+ KVF  WI NS+YHS +LFW+ +LA +    + NGQT SLL LGN +YTYVVVTV +KAGLEH AWTWLSHLAIWGS+  WF++  IY H++  + L++ M  M  AV+  G FW G +LIP  ALTRDIAWK  KR    SLRE+VMQME+   DPG++I   I+ K      F    R            LG        +PT + D+ + +H      GYAFSQEEHG VSQSQLIR Y+ST +KP+G
Sbjct:   12 STAKYNFLTFIPKFVTEQFRRYANIFFLVIALLQQIPGVSPTGRFTTLVPLCIILTVSAIKEVIEDFRRHRADDATNNEETLVLRNHVWVKICWKDLEVGDLVKVLSNEGIPADLVLLASSEPQAMCYIETSNLDGETNLKLRQGLPVTTHLLTAGELSSFDAVVECEPPNRKLDEFVGVIRTADGIAHPLNPTQLILRGASLKNTKWIFGLTVYTGKESKVMLNSTAAPLKRSTVERQTNTYILCLFGVLLFLTFFTFIANLVWTSWNEKKMWYLQENVDTRSDLRRLLDFITCLILYNTIIPISLPVMLEVVRFIQALYINWDLDMYDSDSDTPAMARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKRCSIGGIMYGNGTEDS-NALEDQNLINKLNAGDLLVDQFFTILAVCHTVVPERSVNENNTNNNNDNINNNVAVFCNDNLNNEQLINYQASSPDEAALVKAARTMGYVFTTRTPTEVVVKIRGVEKHYGILHVLDFTSFRKRMGVVVREPNGRISVMVKGADTVIFERLASTSLFAQSTMDHLENFAKTGLRTLCIAWTEVDPAFYNKWVANFYKASTALNDREAKLELVANEIEQNLQLLGATAIEDKLQTGVPHTISNLMRAGISIWVLTGDKQETAINIGYSCQLLTQSISLLTMNTKSLDQTREQLVNLIEDFGDRIRMENDFALIVDGQTLEFALLCECREQFLDVALSCKSVICCRVSPWQKAQLVKLVRQSIKDAVTLAIGDGANDVGMIQAAHVGVGISGMEGRQAACASDYAIAQFRFLNKLLLVHGAWNYNRLTKLILYSFYKNVCLYLIQFWFAILSGFSGQIVFERWSIGLYNVIFTAAPPMALGLFDRSCSVNNCLKYPELYKDTQASASFNPKVFFCWIFNSIYHSSLLFWIPLLAFSVGTVYANGQTSSLLVLGNSVYTYVVVTVCLKAGLEHTAWTWLSHLAIWGSIGCWFLFLTIYPHVYPTLPLASDMVGMDFAVYGCGIFWFGFLLIPMIALTRDIAWKMAKRVTAGSLREQVMQMEQMQVDPGRLIRASIRPKSTDRSAFVRIMRRSMGSQALLNLCLGASVRTNTASPTPITDSRQTDH------GYAFSQEEHGAVSQSQLIRAYDSTRRKPDG 1149          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A210QR00 (Phospholipid-transporting ATPase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12327 PE=3 SV=1)

HSP 1 Score: 1377.07 bits (3563), Expect = 0.000e+0
Identity = 682/1147 (59.46%), Postives = 868/1147 (75.68%), Query Frame = 1
Query:  100 MTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSE--VDMFFKALAVCHTVVPEKEDNE-----IIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFC-------NPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEG 3498
            M   + EE+ E + QR++ IN PQPVKYC NKISTAKY+FL+F+PKFLFEQFR+YANIFFL I++LQQ P VSPTGRYTTAVPL  ILT+SAIKEI+ED+KRH+ DD+ NN ++ +L++  W  + W Q+ VG+ VK+++GQ  PADLVLL+SSEP  M YIETSNLDGETNLK+RQG+P+T  +L   DL+ + G + CE+PN+HLY+F GN+   G   I LG DQLLLRGA L+NTKW+FGIV+Y+G E+K+MLNS+T PLKRS+VE++TN  IL L  +L+ ++L ++IAN +WT  + D  WYL +   P S++   +NFLTF+ILYN +IPISL V++EVV+  Q  FINWD +MY  +++TPA ARTSNLNEELGQ++YIFSDKTGTLTRNVMEF++CS+ GI YG   DE+  A  D  + E L+   +   +  F   L+VCHTVVPE+E  E     ++YQASSPDE+ALVK A+ +G+ F TRTP  + I +N ++ EY+VLNVLEFTS RKRMSV+V+TPD KI ++ KGAD VIYERL        +TL +LEEFA +GLRTLCIA A++  + YE WK  +++AS SI+NRE KL   AE IE+NL L+GA+AIED+LQD VPETI+NLAKA IKIWVLTGDKQETA+NIGYSC+LLTQ M L I++  SLD TR  L      FG+ + KEND+GL++ G TLK+AL   CR DFL IA+SCKAVICCRVSPSQKAE+  LVK ++K AITLAIGDGANDVGMIQAAHVG+GISG+EG QAAC SDYAIAQFRFLN+LLLVHGAW+Y RL KLILYSFYKN+C +VI+FWFAI++GFSGQI+FERWSIGFYNVIFTAAPPLA+GLFDR CSAE+ +K+P LY+  Q +  F++KVF  WILNS+YHS++LFWL  L+   D  F +G+ G  LFLGN +YTYVVVTV +KAGLE  AWTWL+HLAIWGS+V+WF++  +YSH++ +V L+  M  M   VF    FW+GL+LIP  +L RD+AWKA+KRT+ ++L+E V + EK ++DP  ++    K++         N F     ++     PT VD  +          GYAFSQEEHGV++Q++LIR Y+S   KPEG
Sbjct:   21 MGSETTEEV-EPSKQRVIYINAPQPVKYCYNKISTAKYSFLSFLPKFLFEQFRKYANIFFLFISLLQQIPRVSPTGRYTTAVPLLFILTVSAIKEIIEDFKRHRQDDAVNNREVQVLRDGTWQRLLWTQVSVGDLVKVVSGQFFPADLVLLSSSEPQAMCYIETSNLDGETNLKIRQGIPQTAKLLRHEDLLDLDGVVECELPNKHLYDFVGNIRPSGRFAIPLGPDQLLLRGAMLRNTKWIFGIVIYTGPESKLMLNSSTAPLKRSNVEKVTNTQILILFVILIVMSLVSTIANELWTKWHVDKDWYLAYRELPPSNFG--YNFLTFIILYNNLIPISLQVSLEVVKFIQAIFINWDQDMYCAESDTPAMARTSNLNEELGQIKYIFSDKTGTLTRNVMEFRKCSVAGIAYGNN-DESEHAFNDATITENLQNHVTAPVLREFLTLLSVCHTVVPEREIREDGSEPVVYQASSPDEAALVKGARSLGFEFATRTPQAVTIKVNGKSEEYEVLNVLEFTSTRKRMSVVVRTPDDKIKVYCKGADTVIYERLDEKQLYRDITLQHLEEFATLGLRTLCIATADVAEDFYEDWKHTYYKASTSIQNREKKLEEAAELIERNLKLLGATAIEDELQDGVPETIANLAKADIKIWVLTGDKQETAINIGYSCKLLTQGMPLLIVNEHSLDGTRETLRRHVGEFGDLLRKENDVGLIIDGQTLKYALSCDCRQDFLDIAISCKAVICCRVSPSQKAELCNLVKHSVK-AITLAIGDGANDVGMIQAAHVGVGISGVEGLQAACASDYAIAQFRFLNKLLLVHGAWSYARLCKLILYSFYKNICLYVIEFWFAIMNGFSGQILFERWSIGFYNVIFTAAPPLAMGLFDRICSAESMMKFPALYKSSQNAEYFNVKVFWMWILNSIYHSILLFWLPALSLKQDSAFSDGKVGDYLFLGNFVYTYVVVTVCLKAGLETSAWTWLTHLAIWGSIVSWFLFLTVYSHIYMIVDLAPEMYGMDTHVFGCSIFWMGLVLIPLMSLIRDVAWKAIKRTMCKTLKEEVQEKEKLHEDPTPVVLKLTKKRLTETARLLRNVFTRSSGRM-----PTAVDQPH----------GYAFSQEEHGVLTQAELIRVYDSNKDKPEG 1147          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:NCBI gene;Acc:103026348])

HSP 1 Score: 1226.08 bits (3171), Expect = 0.000e+0
Identity = 610/1136 (53.70%), Postives = 799/1136 (70.33%), Query Frame = 1
Query:   94 KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLK--YGDSEVDM-FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            KT        L +    R++ IN PQ  K+C N++STAKYN LTF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGR+TT VPL  IL ++A+KE++ED KRHKAD   N  +  +L+N  W  + W+++ VG  V+  NG  +PADL++L+SSEP GM YIETSNLDGETNLK+RQGL  T +I  I  LM++ G + CE PNRHLYEF GN+ +DG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST PPLK S+VER+TN  IL L G LL ++L  SI   +W     + AWY+  +    +++    NFLTF+IL+N +IPISL VT+EV++  Q +FINWD +M    TNTPA ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C++ G+ YG        A   DP+LLE L+  +  + V M F   +A+CHT VPE+ ++ I YQA+SPDE ALV+AA+ +G++F  RTPD + +    E  +Y++L+VLEFTS RKRMSVI++TP  KI L+ KGAD VIY+RL+  S+   +TL +LE+FA  GLRTLC A A+I  + Y++W    H A  S++NR  KL    E IEKNL L+GA+AIEDKLQD+VPETI  L KA IKIW+LTGDKQETA+NIG+SC+LLT+NM L +++ ++LD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDVGMIQ AHVG+GISG EG QAA +SDY+IAQF++L  LLLVHGAWNYNR+ K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  HD  F NG+T   L LGN +YT+VV+TV +KAGLE  +WT  SH+AIWGS+  W V+F IYS L+ L+ L+  M+     +F+SG FW+GL  IP  +L  D+A+K +K+  F++L + V ++E  ++DPG ++              R   L      + V      + +  +  GYAFSQ+E+GVVSQS++IR Y++T ++
Sbjct:   25 KTEDASEKTSLADQEDARLIFINQPQFTKFCSNRVSTAKYNVLTFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRWTTLVPLLFILVVAAVKEVIEDLKRHKADSVVNKKETQVLRNGAWEIVHWEKVAVGEVVRASNGDHLPADLIILSSSEPQGMCYIETSNLDGETNLKIRQGLQITSEIKDIDSLMRLSGRMECESPNRHLYEFVGNIRMDGHSTVPLGPDQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTRPPLKLSNVERITNFQILVLFGCLLAISLVCSIGQTIWKYQYGNDAWYMDLNYGGAANFG--LNFLTFIILFNNLIPISLLVTLEVIKFIQAYFINWDTDMIYEATNTPAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTVAGVAYGHSSHSMEEAGFNDPSLLENLQSNHPTAPVIMDFMTMMAICHTAVPERSEDTITYQAASPDEGALVRAAQNLGFVFSARTPDSVIVESLGEEEKYELLHVLEFTSARKRMSVIMRTPSGKIRLYCKGADTVIYDRLADNSRYKDITLKHLEQFATEGLRTLCFAVADISESLYQQWLEVHHRACTSLQNRALKLEESYELIEKNLQLLGATAIEDKLQDRVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLTKNMGLLVINEETLDGTRETLSHHCGMLGDALHKENDFALIIDGKTLKYALTFGARQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVGMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLLVHGAWNYNRVAKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVIFTALPPLTLGIFERSCRKENMLKYPELYKTSQNAMGFNTKVFWAHCLNGLFHSVILFWFPLKAFQHDTVFGNGKTPDYLLLGNMVYTFVVITVCLKAGLETSSWTMFSHIAIWGSIGLWVVFFGIYSSLWPLIPLAPDMSGEADMMFNSGVFWMGLFFIPVTSLVFDVAYKVIKKACFKTLVDEVQELEALSKDPGAVV-------HGKSLTERAQLLKNVFKKSTVSLYRSDSMQQNLLHGYAFSQDENGVVSQSEVIRAYDTTKQR 1150          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:NCBI gene;Acc:103026348])

HSP 1 Score: 1222.61 bits (3162), Expect = 0.000e+0
Identity = 611/1151 (53.08%), Postives = 803/1151 (69.77%), Query Frame = 1
Query:   94 KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKG---PDETFSAQ-------------KDPNLLEKLK--YGDSEVDM-FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            KT        L +    R++ IN PQ  K+C N++STAKYN LTF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGR+TT VPL  IL ++A+KE++ED KRHKAD   N  +  +L+N  W  + W+++ VG  V+  NG  +PADL++L+SSEP GM YIETSNLDGETNLK+RQGL  T +I  I  LM++ G + CE PNRHLYEF GN+ +DG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST PPLK S+VER+TN  IL L G LL ++L  SI   +W     + AWY+  +    +++    NFLTF+IL+N +IPISL VT+EV++  Q +FINWD +M    TNTPA ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C++ G+ YG      D +F+ +              DP+LLE L+  +  + V M F   +A+CHT VPE+ ++ I YQA+SPDE ALV+AA+ +G++F  RTPD + +    E  +Y++L+VLEFTS RKRMSVI++TP  KI L+ KGAD VIY+RL+  S+   +TL +LE+FA  GLRTLC A A+I  + Y++W    H A  S++NR  KL    E IEKNL L+GA+AIEDKLQD+VPETI  L KA IKIW+LTGDKQETA+NIG+SC+LLT+NM L +++ ++LD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDVGMIQ AHVG+GISG EG QAA +SDY+IAQF++L  LLLVHGAWNYNR+ K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  HD  F NG+T   L LGN +YT+VV+TV +KAGLE  +WT  SH+AIWGS+  W V+F IYS L+ L+ L+  M+     +F+SG FW+GL  IP  +L  D+A+K +K+  F++L + V ++E  ++DPG ++              R   L      + V      + +  +  GYAFSQ+E+GVVSQS++IR Y++T ++
Sbjct:   25 KTEDASEKTSLADQEDARLIFINQPQFTKFCSNRVSTAKYNVLTFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRWTTLVPLLFILVVAAVKEVIEDLKRHKADSVVNKKETQVLRNGAWEIVHWEKVAVGEVVRASNGDHLPADLIILSSSEPQGMCYIETSNLDGETNLKIRQGLQITSEIKDIDSLMRLSGRMECESPNRHLYEFVGNIRMDGHSTVPLGPDQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTRPPLKLSNVERITNFQILVLFGCLLAISLVCSIGQTIWKYQYGNDAWYMDLNYGGAANFG--LNFLTFIILFNNLIPISLLVTLEVIKFIQAYFINWDTDMIYEATNTPAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTVAGVAYGHTCEVEDGSFAEEDGHSSHSMEEAGFNDPSLLENLQSNHPTAPVIMDFMTMMAICHTAVPERSEDTITYQAASPDEGALVRAAQNLGFVFSARTPDSVIVESLGEEEKYELLHVLEFTSARKRMSVIMRTPSGKIRLYCKGADTVIYDRLADNSRYKDITLKHLEQFATEGLRTLCFAVADISESLYQQWLEVHHRACTSLQNRALKLEESYELIEKNLQLLGATAIEDKLQDRVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLTKNMGLLVINEETLDGTRETLSHHCGMLGDALHKENDFALIIDGKTLKYALTFGARQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVGMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLLVHGAWNYNRVAKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVIFTALPPLTLGIFERSCRKENMLKYPELYKTSQNAMGFNTKVFWAHCLNGLFHSVILFWFPLKAFQHDTVFGNGKTPDYLLLGNMVYTFVVITVCLKAGLETSSWTMFSHIAIWGSIGLWVVFFGIYSSLWPLIPLAPDMSGEADMMFNSGVFWMGLFFIPVTSLVFDVAYKVIKKACFKTLVDEVQELEALSKDPGAVV-------HGKSLTERAQLLKNVFKKSTVSLYRSDSMQQNLLHGYAFSQDENGVVSQSEVIRAYDTTKQR 1165          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:NCBI gene;Acc:103026348])

HSP 1 Score: 1206.05 bits (3119), Expect = 0.000e+0
Identity = 593/1072 (55.32%), Postives = 770/1072 (71.83%), Query Frame = 1
Query:   82 APGY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLK--YGDSEVDM-FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKII 3282
            A GY KT        L +    R++ IN PQ  K+C N++STAKYN LTF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGR+TT VPL  IL ++A+KE++ED KRHKAD   N  +  +L+N  W  + W+++ VG  V+  NG  +PADL++L+SSEP GM YIETSNLDGETNLK+RQGL  T +I  I  LM++ G + CE PNRHLYEF GN+ +DG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST PPLK S+VER+TN  IL L G LL ++L  SI   +W     + AWY+  +    +++    NFLTF+IL+N +IPISL VT+EV++  Q +FINWD +M    TNTPA ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C++ G+ YG        A   DP+LLE L+  +  + V M F   +A+CHT VPE+ ++ I YQA+SPDE ALV+AA+ +G++F  RTPD + +    E  +Y++L+VLEFTS RKRMSVI++TP  KI L+ KGAD VIY+RL+  S+   +TL +LE+FA  GLRTLC A A+I  + Y++W    H A  S++NR  KL    E IEKNL L+GA+AIEDKLQD+VPETI  L KA IKIW+LTGDKQETA+NIG+SC+LLT+NM L +++ ++LD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDVGMIQ AHVG+GISG EG QAA +SDY+IAQF++L  LLLVHGAWNYNR+ K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  HD  F NG+T   L LGN +YT+VV+TV +KAGLE  +WT  SH+AIWGS+  W V+F IYS L+ L+ L+  M+     +F+SG FW+GL  IP  +L  D+A+K +K+  F++L + V ++E  ++DPG ++
Sbjct:   15 AEGYEKTEDASEKTSLADQEDARLIFINQPQFTKFCSNRVSTAKYNVLTFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRWTTLVPLLFILVVAAVKEVIEDLKRHKADSVVNKKETQVLRNGAWEIVHWEKVAVGEVVRASNGDHLPADLIILSSSEPQGMCYIETSNLDGETNLKIRQGLQITSEIKDIDSLMRLSGRMECESPNRHLYEFVGNIRMDGHSTVPLGPDQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTRPPLKLSNVERITNFQILVLFGCLLAISLVCSIGQTIWKYQYGNDAWYMDLNYGGAANFG--LNFLTFIILFNNLIPISLLVTLEVIKFIQAYFINWDTDMIYEATNTPAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTVAGVAYGHSSHSMEEAGFNDPSLLENLQSNHPTAPVIMDFMTMMAICHTAVPERSEDTITYQAASPDEGALVRAAQNLGFVFSARTPDSVIVESLGEEEKYELLHVLEFTSARKRMSVIMRTPSGKIRLYCKGADTVIYDRLADNSRYKDITLKHLEQFATEGLRTLCFAVADISESLYQQWLEVHHRACTSLQNRALKLEESYELIEKNLQLLGATAIEDKLQDRVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLTKNMGLLVINEETLDGTRETLSHHCGMLGDALHKENDFALIIDGKTLKYALTFGARQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVGMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLLVHGAWNYNRVAKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVIFTALPPLTLGIFERSCRKENMLKYPELYKTSQNAMGFNTKVFWAHCLNGLFHSVILFWFPLKAFQHDTVFGNGKTPDYLLLGNMVYTFVVITVCLKAGLETSSWTMFSHIAIWGSIGLWVVFFGIYSSLWPLIPLAPDMSGEADMMFNSGVFWMGLFFIPVTSLVFDVAYKVIKKACFKTLVDEVQELEALSKDPGAVV 1083          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:ZFIN;Acc:ZDB-GENE-100209-2])

HSP 1 Score: 1195.26 bits (3091), Expect = 0.000e+0
Identity = 614/1154 (53.21%), Postives = 801/1154 (69.41%), Query Frame = 1
Query:  118 EELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTA-WYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            +E+  TTSQ        R V +N PQ  K+C N +ST KY   TF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L+N  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQG   T  + ++ +LM + G + CE PNRHLY+F G L LD    + LG DQ+LLRGA ++NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L  +LL + L +SI   +W   + D A WYL   R        ++N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+TPA ARTSNLNEELGQV+Y+FSDKTGTLT NVM FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+E+++IIYQASSP   ALV     + +         +      +   Y++LNVLEF+S RKRMSV+V+TP  K+ L+ KGADNVI+ERL+  S+   LT+ +LE+FA  GLRTLC AY +++   Y++W  +++  S  +++R  KL    E IEK+L+L+GA+AIED+LQ  VPETIS L +A IKIWVLTGDKQETA+NIGYSC+L+T  MSL I++ DSLD TR  LI      G+++GKEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N L++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  +    HD PF+NG +   LF+GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+V W ++F +YS ++  + ++  M      V    +FWLGLIL+P+A L +D+AW A +RT+ +SL E V ++E R  DPG  +  D   +  N  R+         TP+ V  +N       VS GYAFSQEEHGVVSQSQ++R Y++T ++P
Sbjct:   49 DEMSGTTSQTEPIDATARTVLLNRPQNTKFCDNHVSTTKYGIFTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRNGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGHSLTASVQSVEELMGLAGRLECEGPNRHLYDFTGTLRLDNHNPVPLGPDQVLLRGAQIRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFCILLVMALVSSIGAAIWNKQHTDEACWYLS--RAGDISLNFWYNLLTFIILYNNLIPISLLVTLEVVKFTQALFINWDMEMYYSETDTPAMARTSNLNEELGQVKYLFSDKTGTLTCNVMHFKKCTIAGITYGHFPDLECDRSMEDFSNLPSSSNNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREEDQIIYQASSP---ALVIHFSSLLFCVCVCVLKQL-----GKEMSYELLNVLEFSSNRKRMSVVVRTPTGKLRLYCKGADNVIFERLNETSQYKDLTIVHLEQFATEGLRTLCFAYVDLEEGAYQEWLKKYNSVSTVLKDRAQKLEECYELIEKDLLLLGATAIEDRLQSGVPETISTLMRADIKIWVLTGDKQETAINIGYSCKLVTHGMSLIIVNEDSLDATRATLIAHCSSLGDSLGKENELALIIDGQTLKYALSFEVRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMLRFPQLYRITQNADGFNTKVFWGHCINALIHSIILFWFPLKVLEHDTPFQNGNSVDYLFVGNIVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSMVLWMLFFAVYSVIWPHIPIAPDMLGQAGRVMQCWSFWLGLILVPAACLLKDVAWNAGRRTVRKSLLEEVQELEARAVDPGAAVLRDASGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVSHGYAFSQEEHGVVSQSQVVRSYDTTRQRP 1188          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:NCBI gene;Acc:103026348])

HSP 1 Score: 1056.59 bits (2731), Expect = 0.000e+0
Identity = 531/980 (54.18%), Postives = 691/980 (70.51%), Query Frame = 1
Query:  562 EPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLK--YGDSEVDM-FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            EP GM YIETSNLDGETNLK+RQGL  T +I  I  LM++ G + CE PNRHLYEF GN+ +DG   + LG DQ+LLRGA L+NT+WV GIVVY+GH+TK+M NST PPLK S+VER+TN  IL L G LL ++L  SI   +W     + AWY+  +    +++    NFLTF+IL+N +IPISL VT+EV++  Q +FINWD +M    TNTPA ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C++ G+ YG        A   DP+LLE L+  +  + V M F   +A+CHT VPE+ ++ I YQA+SPDE ALV+AA+ +G++F  RTPD + +    E  +Y++L+VLEFTS RKRMSVI++TP  KI L+ KGAD VIY+RL+  S+   +TL +LE+FA  GLRTLC A A+I  + Y++W    H A  S++NR  KL    E IEKNL L+GA+AIEDKLQD+VPETI  L KA IKIW+LTGDKQETA+NIG+SC+LLT+NM L +++ ++LD TR  L       G+ + KEND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDVGMIQ AHVG+GISG EG QAA +SDY+IAQF++L  LLLVHGAWNYNR+ K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  HD  F NG+T   L LGN +YT+VV+TV +KAGLE  +WT  SH+AIWGS+  W V+F IYS L+ L+ L+  M+     +F+SG FW+GL  IP  +L  D+A+K +K+  F++L + V ++E  ++DPG ++              R   L      + V      + +  +  GYAFSQ+E+GVVSQS++IR Y++T ++
Sbjct:    3 EPQGMCYIETSNLDGETNLKIRQGLQITSEIKDIDSLMRLSGRMECESPNRHLYEFVGNIRMDGHSTVPLGPDQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTRPPLKLSNVERITNFQILVLFGCLLAISLVCSIGQTIWKYQYGNDAWYMDLNYGGAANFG--LNFLTFIILFNNLIPISLLVTLEVIKFIQAYFINWDTDMIYEATNTPAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTVAGVAYGHSSHSMEEAGFNDPSLLENLQSNHPTAPVIMDFMTMMAICHTAVPERSEDTITYQAASPDEGALVRAAQNLGFVFSARTPDSVIVESLGEEEKYELLHVLEFTSARKRMSVIMRTPSGKIRLYCKGADTVIYDRLADNSRYKDITLKHLEQFATEGLRTLCFAVADISESLYQQWLEVHHRACTSLQNRALKLEESYELIEKNLQLLGATAIEDKLQDRVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLTKNMGLLVINEETLDGTRETLSHHCGMLGDALHKENDFALIIDGKTLKYALTFGARQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVGMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLLVHGAWNYNRVAKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVIFTALPPLTLGIFERSCRKENMLKYPELYKTSQNAMGFNTKVFWAHCLNGLFHSVILFWFPLKAFQHDTVFGNGKTPDYLLLGNMVYTFVVITVCLKAGLETSSWTMFSHIAIWGSIGLWVVFFGIYSSLWPLIPLAPDMSGEADMMFNSGVFWMGLFFIPVTSLVFDVAYKVIKKACFKTLVDEVQELEALSKDPGAVV-------HGKSLTERAQLLKNVFKKSTVSLYRSDSMQQNLLHGYAFSQDENGVVSQSEVIRAYDTTKQR 972          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp8b1 (ATPase phospholipid transporting 8B1 [Source:ZFIN;Acc:ZDB-GENE-091116-14])

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 447/1124 (39.77%), Postives = 641/1124 (57.03%), Query Frame = 1
Query:  118 EELKETTSQRIVNINHPQPVKYCL-------NKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTI-TDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVW--TNANKDTAWYLGFDRKPI----------SHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDE--------------TFSAQKDPNL---------LEKLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSL---DKTRTQLI-------EVRQGFGENIGKENDIGLVVSGDTLKFAL--DFQCRDD-------------------------------FLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFI---------IYSHLFQLVGLSAS-----------MALMYQAVFSSGTFWLGLILIPSA 3171
            EE K   + R  N     P  +C+       N I TAKYN +TF+P  L EQF+R AN++FL + ILQ  P +S    YTT VPL I+L+I+AIK+ V+D  RH++D   NN K  I+QN  + E  W  +QVG+ ++L     +PAD++LL+++EP+ + Y+ET+ LDGE+NLK +Q L  T + LT    L +    I  E PN  L ++ G +    +K  SL ND+LLLRG  ++NT+   G+V+++G +TK+M NS     KR+ +++  N+ +  + G+LL +    +I N +W   +      +  G    P           + W  F NF  ++IL NT++PISL V++EV+R  Q+FFINWD+ MY    +TP+NART+ LNEELGQ+ YIF+DKTGTLT+N+M FK+CSI G+ +G   D               +++ + D N          L +LK  D     FFK LA+CHTV+ E+++ ++IYQA SPDE ALV AA+  GY+F  RT + + I        Y++LN+L+F S RKRMSVIV++P+ K+ L+ KGAD VI ERL     N + T  +L  FA   LRTLC++Y ++   EY  W  ++ +AS+S+ +RE K   V EKIE NL L+GA+AIEDKLQD VPE I+ LA A IKIWVLTGDKQETA NIGY+C LLT++M +C  D  S    D    Q I       E    F +   K     ++++G  L   L  + Q R D                               F+ +A +C+AVICCRVSP QKA VV +V  + K A+TLAIGDGANDV MI+ AH+G+GISG EG QA  +SDY+ AQFRFL RLLLVHG W+Y R+ K + Y FYKN  F ++ FWF+  +GFS Q +++ W I  YN++++A P L +GLFD+  S   S K+P+LY   Q++  F+ K+F   ++  +  SLI+F++   A    +                  T + + V+++ GL+   WT+L+  +I+GS+  +F             I+   F+  G +++           +A M   +        GLI IP A
Sbjct:   17 EEWKVKANDREFNGQFTVPKYHCMKQKRYKGNYIKTAKYNIVTFLPMNLLEQFQRVANVYFLFLLILQAIPIISSLAWYTTFVPLVIVLSITAIKDAVDDISRHRSDKQINNRKCEIMQNGSFKEDKWMNIQVGDLLRLKKNDFVPADMLLLSTTEPNSLCYLETAELDGESNLKFKQALTVTHNNLTDEKQLAEFDAIIMSEAPNNRLDKYLGTMQWK-DKMYSLDNDKLLLRGCRIRNTETCHGLVIFAGFDTKIMKNSGETKFKRTQIDKQMNKIVFMIFGMLLVMATGLAIGNTIWEVVHGQGFGKYCSGITGDPAVPSPDTVSEWAVWTGFLNFWGYIILLNTVVPISLYVSVEVIRLGQSFFINWDLRMYFKVNDTPSNARTTTLNEELGQIEYIFTDKTGTLTQNIMTFKKCSISGMAFGGCEDTWRSGHNVIDNPVDWSWNERADKNFEFHDHSLVNLVRLK-KDPTACEFFKLLALCHTVMAEEKEGDLIYQAQSPDEGALVTAARNFGYVFLDRTLESVTIVELGTERVYELLNILDFNSDRKRMSVIVRSPEGKLRLYCKGADTVILERLQKDDPNRESTEKDLNTFAAESLRTLCLSYKDLSEEEYLDWSKKYEQASMSLTDREKKQGLVYEKIETNLKLLGATAIEDKLQDGVPEAIAKLAAAKIKIWVLTGDKQETAENIGYACHLLTEDMQICYGDEVSTMLSDVQECQTIKRDAKGNEEEVDFAKQFLKGKKNAIIITGGCLNGILTDNKQKRLDRLKLPRRRKPREQREEEKQREILKRERIEKRFVSLACACEAVICCRVSPRQKARVVRMVMKH-KQAVTLAIGDGANDVNMIKTAHIGVGISGQEGMQAVLSSDYSFAQFRFLERLLLVHGRWSYLRMCKFLQYFFYKNFAFTLVHFWFSFFNGFSAQAVYDDWYITLYNMLYSALPVLVMGLFDQDVSDSKSFKFPELYETGQKNLNFNYKIFGRCLIQGIITSLIIFFIPYGAFLETMRSDGLAPDDYQSFAVVTATSLTLIVNLQIGLDTAFWTYLNTFSIFGSIALYFAIMFDLHSDGLHYIFPSNFKFTGTASNSLKQPYIFMLCIAHMVITILFLQVMHFGLITIPRA 1137          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp8b4 (ATPase phospholipid transporting 8B4 [Source:ZFIN;Acc:ZDB-GENE-121116-7])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 424/1095 (38.72%), Postives = 635/1095 (57.99%), Query Frame = 1
Query:  190 NKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDIL-TITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXAT-SIANVVWTNANKDTAWYLGFDRKPISHWER---------FFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDET--------------FSAQ---------KDPNLLEKLKYGDSEVDMFFKALAVCHTVVP-EKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKN-GKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLT---QNMSLCILDS-----DSLDKTRTQLIEVRQG--FGENIGKENDI--------------GLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTG--SLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWF-VYFIIYSH-LFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKR----TLFESLRERVMQMEKRNQDP 3270
            N+I T+KYN +TF+P  LFEQF+R AN +FL + ILQ  P +S    +TT VPL ++LTI+A+K+  E+Y RH++D+  NN +  +  N +     W  ++VG+ +K+ N Q + ADL+LL+SSEPH + YIET+ LDGETNLK+RQ LP T  I   I  L    G + CE PN  L  F G L   G    SL ND++LLRG  L+NT+W +G+VV++G +TK+M NS    LKR+S++R+ N  +L      L    +   + N +W +A       +G+  +P   WE          F  F +++I+ NT++PISL V++EV+R   ++FINWD +MY    +TPA  RT+ LNEELGQ+ YIFSDKTGTLT+N+M F +CSI G +YG   D T              FS            D  +LE ++ G+  V  FF+ LA+CHTV+P EK + E+ YQA SPDE ALV AA+   ++F +RTP+ I +    E   Y++L +L+F + RKRMSVIV+  + ++ L+ KGAD+VI+ERL   ++    +T D+L  FA  GLRTLC+AY ++D   +E+W+   HEA+ S++ RE  LAAV ++IE+N++L+GA+AIEDKLQ+ VPETI+ LA A IKIWVLTGDKQ       Y   L++   +N+ L ++ S       +     + +E   G      +G+ + +              G V +G  L   L    +DDFL    S  + +  R++ + ++E    V    K  I L  G  +++  +I+ AH+G+GISG EG QA  +SDY+ AQFRFL RLLLVHG W+Y R+ K + Y FYKN  F ++ FWF    GFS Q ++++W I  +N+++T+ P LA+G+FD+  + + S+  P+LY   Q +  F+ + F   I   +Y S++LF++   A    +  R+  TG      L   + T +++ VS++ GL+   WT ++H  IWGSV  +F + F +YS  L+ +           +   +  + WL + L     +    A++ +K     TL +  +ER MQ ++R Q P
Sbjct:    2 NRIKTSKYNVVTFLPVNLFEQFQRVANAYFLFLLILQLIPQISSLSWFTTIVPLVLVLTITAVKDASEEYFRHRSDNQVNNRQSQVHINGKLQNEKWMNVRVGDIIKMENNQFVAADLLLLSSSEPHSLCYIETAELDGETNLKVRQALPVTSQIADDIDKLAHFDGEVICEPPNNKLDRFTGTLYWRG-NTYSLDNDKMLLRGCVLRNTEWCYGLVVFAGPDTKLMQNSGRTKLKRTSIDRLMNTLVLWWIFGFLVCMGSILGLGNTIWESA-------IGYYFQPYLPWESAVDSAIFSGFLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDRKMYYGKRDTPAEVRTTTLNEELGQIEYIFSDKTGTLTQNIMTFNKCSINGRVYGGAYDVTGHKVEINERSVPVDFSRNLLADRRFLFYDQTMLEAIRLGEWGVHEFFRLLALCHTVMPEEKTEGELAYQAQSPDEGALVTAARNFDFVFRSRTPETITLHELGEPRTYQLLAILDFNNFRKRMSVIVRNAEGRLKLYCKGADSVIFERLHPCNQQLVNITADHLSAFAGEGLRTLCLAYRDLDEASFEEWQERHHEANTSLQGREELLAAVYDEIEQNMMLLGATAIEDKLQEGVPETIAKLALANIKIWVLTGDKQAATRAAFYRSSLISIVRKNVHLILMSSLLTVLCFIHPINERSVEPLHGVFISSTLGRLHKMAVVVMVVVIVADCAGRVCNGVNLAVRLGAVLKDDFLAAVASNHSSVALRLTANSESENTRFVA---KQWIGLNDGRPSHNCIVIETAHIGVGISGQEGMQAVLSSDYSFAQFRFLQRLLLVHGRWSYLRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGVFDQDINDQWSIDCPKLYEPGQLNLLFNKREFFICIGQGIYTSVVLFFVPYAAFVEAV--RDDGTGLSDHQSLAVAVSTSLIIVVSLQMGLDTAYWTAINHFFIWGSVAVYFAIMFAMYSAGLYSIFPSQFRFIGTARNTLNQPSVWLVIALTTIVCIMPIAAFRFLKTDLRPTLSDKTQERYMQRQRRKQKP 1083          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:HGNC Symbol;Acc:HGNC:13531])

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 302/536 (56.34%), Postives = 390/536 (72.76%), Query Frame = 1
Query:  199 STAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKIL-ILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIG 1794
            STAKYN LTF+P+FL+EQF R AN+FFL IA+LQQ P VSPTGRYTT +PL  IL ++A+KEI+EDYKRH+AD   N  K   +LQN +W  + W+++ VG+ +++ NGQ +PADLV+L+SSEP  M YIET+NLDGETNLK+RQGLP T  + T   L+ + G I CE PNRHLY+F GN+ L G   + LG DQ+LLRGA L+NT+WVFG+VVY+GH+TK+M NST  PLKRS+V+R+TN  IL L   LL + LA++I + +WT+A+    WYLGF     S++   FNFLTF+ILYN +IPISL VT+EVV+  Q FFINWD EMY  ++NT A ARTSNLNEELGQV+YIFSDKTGTLT NVMEFK+ ++ GI YG   + +    +DP LL+ L        +   F   ++VCHT VPE ED  I+YQASSPDE ALV+AA+ +G+ F  RTP+ + I    +   +++L+VLEFTS+R+RMSVIV+TP  K+ L+ KGADN IYERL+  S   + TL +LE FA  G
Sbjct:    1 STAKYNALTFLPRFLYEQFSRAANLFFLFIALLQQIPEVSPTGRYTTLMPLIFILVVAALKEIIEDYKRHRADREVNKKKTTQVLQNGDWHTVSWEKVGVGDVLRITNGQNLPADLVMLSSSEPQAMCYIETANLDGETNLKIRQGLPLTAGLQTSDSLLSIDGRIECEAPNRHLYDFTGNIQLQGHGTVPLGPDQILLRGAQLRNTQWVFGVVVYTGHDTKLMQNSTRAPLKRSNVDRVTNLQILLLVVTLLLMALASAIGSSIWTSAHWKGDWYLGFRDNAPSNFG--FNFLTFIILYNNLIPISLLVTLEVVKFIQAFFINWDSEMYHEESNTNAMARTSNLNEELGQVKYIFSDKTGTLTCNVMEFKKATVAGIAYGHNEEPSEVGFQDPALLQNLHSNHPSAGVIYEFLVMMSVCHTAVPEAEDGSIVYQASSPDEGALVRAARSLGFTFTVRTPNMVVIDALGQEQNFELLHVLEFTSVRRRMSVIVRTPSGKLRLYCKGADNAIYERLANNSLYKEDTLQHLELFASEG 534          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:HGNC Symbol;Acc:HGNC:13531])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 347/825 (42.06%), Postives = 498/825 (60.36%), Query Frame = 1
Query:  325 GRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILIL--QNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHW-ERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYG-KGPDETFSAQKDPNLLE-----KLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDG-IKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCR--DDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQ 2763
            G+ T  +PL  ++T+SA+K+I ED KRHK+D+  N  K+L L  +   +V   WK L+VG  +++   Q  PADL LL S+  +G++Y+ET NLDGETNLK +  +       T        G + CE PN    +F G +        SL ++ +LLRG +L+NT+WV+GIV+Y+GH++K+M NS+    K S     TN+ I+    LL+  ++ + ++ +V    +  T       R  ++   +    F T+L+L+   +PISL VT+EVV+        WD E+YD       +  T NLNE+LGQV Y+FSDKTGTLT N+ME+K+ S+G   YG  G   T   +KD  + E     K       +  F   LA+CHTVV E +D +I+Y ASSPDE ALV   K  GY F  R  D  I++ +N ++  Y++L V+EF+S RKRM++IV+TP++KI++  KGAD+++  RLS +   G  T+ +LE +A  GLRTL +A  E+   EY+ +K E+  A+ S+  R+ K+  VA+++E    ++G +AIEDKLQD V + I  + KAGIK+WVLTGDK ETA+NIG+SCQLL   M L ++D  S +  RT                   G VVSG++L     F+ R    FL++A S   +I CR+SP QKA++V L+ +N    ITLAIGDGANDV MI AAH+G+GISG+EGQQA   SDYAI QF+FL  LL VHG  +Y + + L+ Y+FYKNV F + QFWF   S FSGQ+ +E+W    +N+IFTA P +   LFD+  S  + ++ P+
Sbjct:    1 GQPTILLPLMFVITVSAVKDIFEDMKRHKSDNVENTRKVLRLDKKTKTFVLDSWKNLRVGQIIQVRQDQYFPADLALLRSANNNGIAYVETKNLDGETNLKHKAAVVDASACTT------FRGTLTCEAPN----DFEGTVKTADNVTYSLDHNSILLRGTSLRNTEWVYGIVIYTGHDSKIMKNSSKSRTKFSK----TNKQIILSFSLLVLHSMNSGLSELVKLTTHTSTLLV----RMTLTRISDSVTRFGTWLLLFANFVPISLIVTLEVVKFL------WDAEIYD----VAKDLNTKNLNEQLGQVDYVFSDKTGTLTCNLMEYKKHSVGKYSYGVDGAQITDGVEKDDEIFEAHMNDKNHPNYKNIQNFLTHLAICHTVVAEAKDGKILYNASSPDELALVNCGKYFGYFFKGRDDDNNIEVEVNGKSVIYQLLGVIEFSSDRKRMTIIVRTPENKIMVLCKGADSIVQARLSDSKVLGA-TVQHLESYASGGLRTLLLAEKELSEAEYQNFKEEYRVAASSMIKRDEKMEEVADRLE----IVGTTAIEDKLQDDVDKAIFAMKKAGIKVWVLTGDKIETAINIGFSCQLLNDKMELYVIDGASKEGLRTS------------------GTVVSGESL-----FKIRITKQFLKLACSSSVLIACRMSPKQKADIVRLIIANNPSLITLAIGDGANDVNMINAAHIGVGISGVEGQQAVSASDYAIGQFKFLKNLLFVHGRESYRKNSYLVCYTFYKNVLFVMPQFWFGFYSAFSGQVFYEKWIYQIFNIIFTAFPIIIFALFDQQKSRHHFMQNPK 769          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp10a (ATPase phospholipid transporting 10A [Source:ZFIN;Acc:ZDB-GENE-101102-1])

HSP 1 Score: 414.846 bits (1065), Expect = 1.399e-124
Identity = 233/637 (36.58%), Postives = 365/637 (57.30%), Query Frame = 1
Query: 1477 EIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINN-ENYEYKVLNVLEFTSLRKRMSVIVKTP-DSKIVLFTKGADNVIYERLSTASKNGK----------LTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDK------TRTQLIE---VRQGFGENIGKENDI-----------------------GLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEK 3255
            E+ Y+A SPDE+ALV AA+   +   +++PD + I + +     + +L+V+ F S RKRMSV+V+ P   ++V++TKGADNVI + L   + N             T  +L ++A  GLRTLCIA  E+  +EY  W     EA  +I+ RE  L   A ++E+++ L+GA+ IED+LQD VPETI+ L  AG++IWVLTGDKQETA+NI +SC+LL  +  +  L+++SL +      T   L     VRQ   E +  E ++                       GLV+ G TL FAL+    ++FL++   C++V+CCR +P QK+ VV LV+  +K  +TLAIGDGANDV MIQ A VG+GISG EG QA  +SDYA+ +FR L++LLLVHG W Y+RL  ++LY FYKN  F  + FW+    GFSG    ++W +  +N++F + PPL  G+ D+  SAE  L  P LY+  Q S  +   +F   ++++LY S++ F+L  LA      +R G    +   G  I T  + ++ +   +E   WTW+   +I  S++ +F++ + Y+ +       ++  ++ + + +   F+L  ++ P  AL   + ++ ++ + F S   R  Q++K
Sbjct:  675 ELRYEAESPDEAALVYAARAYNFTLVSKSPDQVIIDVPHVGRLTFDLLHVMAFDSTRKRMSVVVRHPLTDEMVVYTKGADNVIMDILKPCTGNSDKDKAKAKMHARTQADLNQYAMDGLRTLCIAKRELTDDEYATWAKSHLEAEAAIDCREEMLFESALRLERDMQLLGATGIEDRLQDGVPETIAALRDAGLQIWVLTGDKQETAINIAFSCKLLDASDEIITLNTESLSRGQHRHRTLCSLASTGGVRQA-AEAVAPEQELERGGRGAVICDGRYRGTVVTTRRGLVIDGKTLSFALNKDLEENFLKLTRDCRSVLCCRSTPLQKSMVVKLVREKLK-VMTLAIGDGANDVSMIQVADVGVGISGQEGMQAVMSSDYAMPRFRHLHKLLLVHGHWCYDRLANMVLYFFYKNAAFVTLLFWYQFFCGFSGSSQIDQWYLMLFNLLFCSLPPLVTGVLDKDVSAETLLARPHLYQNGQNSLAYRPILFWVTMMDALYQSMVCFFLPYLA------YR-GSDVDIFTWGTPITTVSLFSILLHLAIETKTWTWIHWGSIALSLLLYFLFVLAYNAICINCAAPSNPYMIMEILMTQPLFYLVCVVTPLVALLPRLVYRTLEGSCFPSENLRGRQLDK 1302          

HSP 2 Score: 308.531 bits (789), Expect = 3.218e-87
Identity = 166/390 (42.56%), Postives = 246/390 (63.08%), Query Frame = 1
Query:  190 NKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSE--WVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWT-----NANKDTAWYLGFDRKPISHWERFFNFLTF-LILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIY 1335
            N I T KY   +F+PK LFEQF R+AN++F+ I +L   P V+        +P+  IL ++A+K++ EDY+R+ +D   NN+  L+   ++  ++E CWK ++VG+F+KL   + IPAD++L+ASS+P G+ ++ET+NLDGETNLK+RQ +    D+    D MK    + CE PN  L +F G +    E+K+ L  D LLLRG T++NT++V GIVVY GHETK MLN+  P  KRS +ER  N  I+    +L+ + L  +IA+ +W      N   D A   G    P+     F+ F T  +IL   +IPISL V++E+V+  Q + I+ D E+YDP+++TP   R  N+ E+LGQ++YIFSDKTGTLT N M F++C++ G  Y
Sbjct:   50 NAIKTTKYTVWSFLPKNLFEQFHRFANVYFVFIVLLNFVPVVNAFQPGLAVLPVAFILAVTAVKDLWEDYRRYHSDREINNAPCLVYCRAQQGFIERCWKDVRVGDFLKLRCNEIIPADVLLMASSDPDGLCHLETANLDGETNLKLRQLVKGFADLDCDFDPMKYTSIVECERPNNDLNKFKGFMLHSNERKVGLSKDNLLLRGCTVRNTEYVVGIVVYGGHETKAMLNNNGPRYKRSKLERNMNMDIIWCVIILIVMCLFIAIAHGLWMAGYEENPPFDVASKDGSHISPV--LSGFYMFWTMIIILQQVLIPISLYVSIEIVKIGQIYLIHQDEELYDPESDTPLQCRALNITEDLGQIKYIFSDKTGTLTENKMVFRRCTVAGKEY 437          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DRS2 (Trans-golgi network aminophospholipid translocase (flippase); maintains membrane lipid asymmetry in post-Golgi secretory vesicles; contributes to clathrin-coated vesicle formation, endocytosis, protein trafficking between the Golgi and endosomal system and the cellular response to mating pheromone; autoinhibited by its C-terminal tail; localizes to the trans-Golgi network; mutations in human homolog ATP8B1 result in liver disease [Source:SGD;Acc:S000000024])

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 502/1145 (43.84%), Postives = 716/1145 (62.53%), Query Frame = 1
Query:  145 RIVNINHP---QPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNS--EWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYL---GFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIY-GKGPDETFSAQKD---------PNLLEKLKYGDSE----VDMFFKALAVCHTVVPE-KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISIN--NENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLST-ASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGEN---IGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFR-NGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            R+++IN         Y  N IST KYNF TF+PKFLF++F +YAN+FFL  + +QQ P+VSPT RYTT   L ++L +SA+KE +ED KR  +D   NNS   I   +  ++VE  W  ++VG+ +++ + + IPAD ++L+SSEP G+ YIET+NLDGETNLK++Q    T   + +  L  M+G +  E PN  LY + G + L+ +++I L  DQ++LRGATL+NT W+FG+V+++GHETK++ N+T  P+KR++VE++ NR I+ L  +L+ L L +SI NV+ + A+     YL   G ++  +     F +FLTF IL++ ++PISL VT+E+++ +Q F I  D+++Y   T+TP   RTS+L EELGQ+ YIFSDKTGTLTRN+MEFK CSI G  Y  K P++  +  +D          +L +KL     E    ++ F   LA CHTV+PE + D  I YQA+SPDE ALV+   ++GY F  R P+ + + +    E  EY++LN+ EF S RKRMS I + PD  I LF KGAD VI ERL   A++  + T+ +LE++A  GLRTLC+A  +I   EYE+W   ++EA+ +++NR  KL   A  IEKNLILIGA+AIEDKLQD VPETI  L +AGIKIWVLTGD+QETA+NIG SC+LL+++M+L I++ ++ D T   L+E      E+       N + LV+ G +L FAL+ +  D  L +A  CKAVICCRVSP QKA VV +VK     ++ LAIGDGANDV MIQAAHVG+GISG+EG QAA ++D A+ QF+FL +LLLVHG+W+Y R++  ILYSFYKN   ++ QFW+   + FSGQ I E W++ FYN+ FT  PP  +G+FD+  S+    +YPQLY+  Q+   F + +F  WI+N  +HS I+F  T+L   +      +G+       G  +YT  V+ V  KA L    WT  + +AI GS++ W ++F IY+ +F    +S     + +  + SG FWL LI++P  AL RD  WK  KR         + +M+K N        I   R     F++   K+             R   R +   G+AFSQ E G   Q +++R Y++T K+
Sbjct:  183 RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLN-DRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIALFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGTNKAGLF----FKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKPNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMNTLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRK-SSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYN--------ISDSRPHVQQFQNAIRKV-------------RQVQRMKKQRGFAFSQAEEG--GQEKIVRMYDTTQKR 1298          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DNF1 (Aminophospholipid translocase (flippase); type 4 P-type ATPase; involved in phospholipid translocation, contributing to endocytosis, protein transport, and cellular polarization; localizes primarily to the plasma membrane; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone; DNF1 has a paralog, DNF2, that arose from the whole genome duplication [Source:SGD;Acc:S000000968])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 394/1041 (37.85%), Postives = 577/1041 (55.43%), Query Frame = 1
Query:  478 WKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLA----LDGE---KKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWER-FFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK--------------------GPDETFSAQKDPN--------------------------LLEKLKYGDSEV-----DMFFKALAVCHTVVPEKE-DN--EIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTP------DSKIVLFTKGADNVIYERLSTAS-KNGKLTLD----NLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDS--DSLDKTRTQLIEVRQGFGEN--------IGKENDI--------------GLVVSGDTLKFALDFQ-CRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTG--SLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKR 3300
            WK ++VG+ V++ N   IPAD++LL++S+  G  Y+ET NLDGETNLK+RQ L  T  I T  D+ +    I  E P+ +LY + GN+      DGE   + I++ N  +LLRG TL+NTKW  G+V+++G +TK+MLNS   P K+S + R  N  ++    LL  L   + IAN V+ +    + +   F     S     F +F   +ILY +++PISL +++E+++T Q  FI  D+ +Y+   + P   ++ N++++LGQV YIFSDKTGTLT+NVMEFK+C+I G+ YG+                    G  E     KD +                           +  LK    EV     + F  ALA+CH+V+ E   DN  ++  +A SPDE+ALV  A+++G+ F  +T  G+ I +     E+++LN+LEF S RKRMS IVK P      + + +L  KGAD++IY RLS  S  N +  L+    +LE++A  GLRTLCIA  E+  +EYEKW  ++  A+ S+ NRE++L  VA+ IE+ LIL+G +AIED+LQD VP+ I  LA+AGIK+WVLTGDK ETA+NIG+SC LL   M L ++ +  D + +  ++  E+                G E +I               +V+ GD LK AL  +  R  FL +  +C+AV+CCRVSPSQKA VV LVK ++ D +TLAIGDG+NDV MIQ+A VGIGI+G EG+QA   SDYAI QFR+L RL+LVHG W+Y RL ++I   FYKN+ F +  FW+ I + F G  ++E   + FYN+ FT+ P + LG+ D+  +   SL  PQLYR       ++ + FL ++L+ LY S+I F+   L  + ++   +   G     F+G  + T  V++ +    L    W W S L I  S +  F +  I+S          + A +Y A      F++ ++       T D   K    T  E +RE + Q    +  P    P D  R
Sbjct:  398 WKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINN--VLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSL-DVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVRE-MWQHGHFDHYPPGYDPTDPNR 1434          

HSP 2 Score: 77.7962 bits (190), Expect = 8.505e-15
Identity = 46/117 (39.32%), Postives = 64/117 (54.70%), Query Frame = 1
Query:  145 RIVNINHPQP-----------VKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSE 462
            R V  N P P           ++Y  NKI T KY  LTF+PK +  QF  +AN++FL++ IL  F     T    +AVPL +I+ I+AIK+ +ED +R   D   NN+K  IL+  E
Sbjct:  168 RTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVE 284          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DNF2 (Aminophospholipid translocase (flippase); type 4 P-type ATPase; involved in phospholipid translocation, contributing to endocytosis, protein transport, and cellular polarization; localizes primarily to the plasma membrane; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone; DNF2 has a paralog, DNF1, that arose from the whole genome duplication [Source:SGD;Acc:S000002500])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 378/1050 (36.00%), Postives = 571/1050 (54.38%), Query Frame = 1
Query:  478 WKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGND-----QLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDR-KPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFS---------------------AQKDPNLLEKLKY---------------------------GDSE---VDMFFKALAVCHTVV--PEKED-NEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDS------KIVLFTKGADNVIYERLSTASKNGKL---TLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCIL-----DSDSLDKTRTQLIE------VRQGFGENIGKE-------------NDIGLVVSGDTLKFALDFQ-CRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTG--SLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQA---VFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQ---DPGKIIPIDIKRKFCNPFR 3321
            WK ++VG+ V++ N   IPAD++LL++S+  G  Y+ET NLDGETNLK+RQ L  +  I +  D+ +    +  E P+ +LY + GN      +  ++ N+      LLLRG TL+NTKW  G+V+++G +TK+M+N+   P K+S + R  N  ++    LL  L     I N V+      +  Y  F      +    F +F   +ILY +++PISL +++E+++T Q  FI  D+ +Y+   + P   ++ N++++LGQ+ YIFSDKTGTLT+NVMEFK+C+I G+ YG+   E  +                     A+    ++++L+                            GD +    + F  ALA+CH+V+  P K+D  ++  +A SPDESALV  A+++GY F   +  G+ + I     E++VLNVLEF S RKRMS I+K P S      K +L  KGAD+VIY RL     +  L   T  +LEE+A  GLRTLC+A  E+  +EYE+W   +  A+ S+ NRE +L  V + IE+ LIL+G +AIED+LQD VP++I+ LA+AGIK+WVLTGDK ETA+NIG+SC +L  +M L ++     D +       Q++       +R+ FG +  +E              +  +++ GD LK AL+ +  R  FL +  +CKAV+CCRVSP+QKA VV LVK  + D +TLAIGDG+NDV MIQ+A VG+GI+G EG+QA   SDYAI QFR++ RL+LVHG W Y RL ++I   FYKNV F +  FW+ I + F G  +FE   + FYN+ FT+ P + L + D+  S   S+  PQLYR       ++   FL ++L+ +Y S+I F+   LA + ++       G     F+G  +    V + +    +E   W W   L I  S+  ++ +  I++        S+S    Y+    VF+   +W  L +     L        +++  +    E V +M  R      P    P D  R   N  R
Sbjct:  443 WKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTL-DVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTS-------SSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484          

HSP 2 Score: 71.2478 bits (173), Expect = 7.818e-13
Identity = 45/118 (38.14%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  181 YCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQN--SEWVEI----CWKQLQVGNFVKLI 516
            Y  NKI T KY  LTF PK +  QF  +ANI+FL++ IL  F     T     +VPL +I+ I+AIK+ +ED +R   D   NN++  IL    +E V +     W++ +  N   LI
Sbjct:  229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRALI 346          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: NEO1 (Phospholipid translocase (flippase), role in phospholipid asymmetry of plasma membrane; involved in endocytosis, vacuolar biogenesis and Golgi to ER vesicle-mediated transport; localizes to endosomes and the Golgi apparatus [Source:SGD;Acc:S000001310])

HSP 1 Score: 432.565 bits (1111), Expect = 1.815e-132
Identity = 307/940 (32.66%), Postives = 486/940 (51.70%), Query Frame = 1
Query:  130 ETTSQRIVNINHPQ--PV----KYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGP--------DETFSAQKDPNLLEKLKYGDSEVDMFFK------ALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNEN----YEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFT-KGADNVIYERLSTASKNGKLTLDNLEE----FAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEK-IEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFG--ENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLIL 2853
            E + Q I    HP   PV    +Y  N++S AKYN +TF+P  L+EQF+ + N++FL++A+ Q  P +      +  VPL  +LT++  KE ++D +R + D  +NN    ++  +    I  K L+VG+ +K+  G  IPADLVLL SSEP G S+I+T  LDGET+ K+R   P T + L+  DL+     I    P + +++F G +         L  D  L     L ++ +    VVY+G +T+  +N+TT  +K   +E   N     +  +L     A SI  V +   + D  WY+              + L +LIL++TIIP+SL V +++ ++     I  D  +  P+T      RTS + E+LG++ Y+ SDKTGTLT+N M+ K+  +G + Y                S++ D     K+    +  DM F+       LA+CH V P  ED+E+ YQA+SPDE A+VK  + +G     R  D   IS+ +E+      Y++L V  F S  KRM +IV+        F  KGAD V+ + + +         D LEE     A+ GLRTL I   +++   YE+++ E+++AS+S+ NR+ +++ V  K +E +L L+G + +EDKLQ  V  +I  L  AGIKIW+LTGDK ETA  +  S +L+++   +          T T++      F   E +    +  L++ G++L   L      +F  + +    VI CR +P QKA+V  +++      +   IGDG NDV MIQ A VG+GI G EG+QA+  +D++I QF  L  LLL HG  +Y R  KL  +  ++ +   + Q  ++I S F    +++ W +  Y   +T AP  +L L D       +  YP+LY+E+ +  +   K F  W+L SL+   ++
Sbjct:  147 ELSDQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEAIDDIQRRRRDRESNNELYHVITRNR--SIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQN-LSENDLINRIS-ITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEIN----SISKILCACVFALSILLVAFAGFHNDD-WYI--------------DILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI--PETI----VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR--DRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESN--------DWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYV---------HTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLK-HYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVI 1035          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DNF3 (Trans-golgi network aminophospholipid translocase (flippase); type 4 P-type ATPase; involved in phospholipid translocation, contributing to the maintenance of membrane lipid asymmetry in post-Golgi secretory vesicles; role in protein trafficking between the Golgi and endosomal system; localizes to the trans-Golgi network; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone [Source:SGD;Acc:S000004772])

HSP 1 Score: 306.605 bits (784), Expect = 4.000e-86
Identity = 185/528 (35.04%), Postives = 289/528 (54.73%), Query Frame = 1
Query: 1759 TLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCIL---DSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLK-FALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTV-------LANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAG-LEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKF 3306
            TL  ++EF+  GLRTL  AY  ID  +YE W   +H+A  S+ +R+ K+     +IE  L L+G +AIEDKLQD V E I  + +AGIK+W+LTGDK+ETA+NIGYSC L+    ++ IL   D + + K      EV  G   NI       +V+ G T+  F  +      F+++     +VICCR SPSQKA +V+ +++   + +TLAIGDGAND+ MIQ+A +G+GI+G EG QA+  SDY+I QFRFL +LL VHG +NY R +K +L +FYK + F+  Q  +   + FSG  ++E WS+  +N +FT+ P L +G+F++       L  P+LY   + S  F+  +F+ W++ +  +SLI+ +L V       L++N   P           LG   +T +V  ++VK+  +E     WL+  ++  S   W V+      L     +       Y       TFW   +++    +T DI +K  K  ++ S  +   ++E+++         DI++K 
Sbjct: 1021 TLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVILTTTDENIISKMNAVSQEVDSG---NIAH---CVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSLSDNTMYP-----------LGLINFTAIVALINVKSQFVEMHNRNWLAFTSVVLSCGGWLVWCCALPILNNTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQKS---------DIRKKL 1522          

HSP 2 Score: 195.667 bits (496), Expect = 5.382e-51
Identity = 112/292 (38.36%), Postives = 175/292 (59.93%), Query Frame = 1
Query:  478 WKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDIL-TITDLMKMHGHIACEVPNRHLYEFCGNLALDGEK-----KISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNS-TTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNA--NKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGG 1326
            W++L+VG+FV L     +PADL+LL     +   ++ET  LDGETNLK +Q  P    +    + L  ++  +  E PN  LY F GNL L   +     K  LG D ++ RG+ L+NT+ V G+V++SG ETK+ +N+   P  K   ++R  N  I+ +  ++  ++L + + +V+      +++ AWYL      ++        ++F+I+YNT+IP+SL VTME+++  Q+  + WDI+MY  +TNTP  +RT+ + EELGQV YIFSDKTGTLT N M F++ S+ G
Sbjct:  299 WEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQADAGVAP-----TIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCG 585          

HSP 3 Score: 99.7525 bits (247), Expect = 1.818e-21
Identity = 67/161 (41.61%), Postives = 89/161 (55.28%), Query Frame = 1
Query: 1342 GPDETFSA------------QKDPNLL--EKLKYGDSEVDMFFKALAVCHTVVPEKEDNEII------YQASSPDESALVKAAKEMGYIFHTRT---------PDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPD--SKIVLFTKGADNVIYERL 1731
             P ETFS             Q+ P  L  +K K+       FF +LA+CH+ +P+K  NE I      YQ+SSPDE ALV AA+++GYI   R          PDG       ENYE  +LN ++F S RKRMSV+V+ P+  ++++L  KGADNVI ERL
Sbjct:  697 SPSETFSENIKSSFDLIQFIQRYPTALFSQKAKF-------FFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIKTFPDGFDGEAKLENYE--ILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIMERL 848          

HSP 4 Score: 92.4337 bits (228), Expect = 3.176e-19
Identity = 41/117 (35.04%), Postives = 73/117 (62.39%), Query Frame = 1
Query:  109 HSVEELKETTSQR---IVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILIL 450
            H+  E K+  ++R   +++    +P  YC N+I++++Y F +F+P+ L+ QF + AN +F ++A+LQ  P  S TG YTT +PL + + IS  +E  +D++RH+ D   NN  + +L
Sbjct:  113 HNAIEYKQAATKRDGHLIDERFNKP--YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVL 227          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO36012 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW8])

HSP 1 Score: 1130.55 bits (2923), Expect = 0.000e+0
Identity = 570/1065 (53.52%), Postives = 754/1065 (70.80%), Query Frame = 1
Query:  145 RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQ---GLPRTCDILT-ITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIY-------------------GKGPDETFSAQKDPNLLEKLKYGD---SEVDMFFKALAVCHTVVPEKED---NEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQME 3252
            R++ IN PQ  +YC NKISTAKYNFLTF+PKFL EQF RY+N+FFL IA+LQQ   VSPTGRYTTAVPL ++L+ SAIKEI+EDYKRH AD   NN ++ +L+++    + W ++QVG+ VK++NG   PADL+LL+SSEP GM Y+ETSNLDGETNLK+RQ    L    D ++ I+    + G + CE PN  LY+F GN+AL G+K + L  DQ+LLRGA L+NT+WVFG+V Y+GH++K+M NST  P+KRS+V+  TN  IL L GLL+ L L ++I   VW   ++   WYLG++  P  ++     FLTF+ILYN +IPISL VT+EVV+  Q  FIN DI+MY   ++TPA ARTSNLNEELGQV+YIFSDKTGTLTRNVMEF++ +IGGI Y                     G  ++FS   DP LL+ L+      S +  F   L+VCHTVVPE++    ++IIYQA+SPDE ALVK AK++G+ F+ RTP  + I+   +   Y++LNVLEF S RKRMSVIV+TP+ KI L+ KGAD V++ER+       + T+ +LEEFAK GLRTLCIA +E+D  EY +W   +++AS S+ENR +K+   AE IE+NL L+GA+AIEDKLQ+ VPE+I+ LA A IKIWVLTGDKQETA+NIGY+C+LLT  M L + + ++LD  R  L E  +  G N  K   +        L  AL  + + +FL +AL CKAVICCRVSP QK++VV LVK ++KD+ITLAIGDGANDVGMIQAAHVG+GISG EG QAA  SDYAIAQFR+LN+LL VHGAW+Y RL KLILYSFYKNVC +VI+ WFA+ +GFSGQI+F++W IG YNVIFT+ PPLA+GLFDR+ S+E+ LKYP+LY+  Q +  ++ KVF  WI+ S+YHSL+LF+L      H++P+ NG       LGN +YT VV+TV +KAG+E  AW W+ HL+IWGS+ +WF++ +IY        ++  M      ++SSG FW+ + ++P   L  D  ++ +KRT F++L E + ++E
Sbjct:    1 RVIIINKPQVRQYCNNKISTAKYNFLTFLPKFLLEQFSRYSNVFFLFIALLQQIDGVSPTGRYTTAVPLLLVLSCSAIKEIIEDYKRHAADGLVNNRRVKVLRDNTLQSLLWIEVQVGDIVKVVNGHFFPADLILLSSSEPMGMCYVETSNLDGETNLKIRQMFNSLSLFIDCISKISGHCYLQGRVECEGPNNRLYDFVGNIALTGKKPVPLSADQVLLRGAQLRNTQWVFGLVAYTGHDSKLMQNSTAAPIKRSNVDHTTNIQILFLFGLLMALALCSTIGFYVWAGEHEHAHWYLGYEELPPQNYG--LTFLTFIILYNNLIPISLTVTLEVVKFIQAIFINLDIDMYYAPSDTPAMARTSNLNEELGQVKYIFSDKTGTLTRNVMEFRKVTIGGISYRLSVRPFFVLQNNDHLKNNSCGEGQSFS---DPALLDNLREHHPTASVIREFLTLLSVCHTVVPERDTQNPDKIIYQAASPDEGALVKGAKKLGFSFNVRTPTSVIINAMGKEEVYEILNVLEFNSTRKRMSVIVRTPEGKIKLYCKGADTVVFERMRENQLYLETTVKHLEEFAKEGLRTLCIAMSELDPEEYSEWSKIYYQASTSLENRADKVDEAAELIERNLFLLGATAIEDKLQEGVPESIAALADADIKIWVLTGDKQETAINIGYACRLLTGEMKLLMCNDETLDGIREWLNEHLRMIGRNGIKCERMCCFFVDQVLLQALTDELKLNFLDLALCCKAVICCRVSPLQKSQVVRLVKHHVKDSITLAIGDGANDVGMIQAAHVGVGISGQEGLQAASASDYAIAQFRYLNKLLFVHGAWSYQRLAKLILYSFYKNVCLYVIELWFAMENGFSGQILFDKWCIGIYNVIFTSVPPLAIGLFDRTVSSESMLKYPKLYKTSQNAEIYNTKVFWLWIMTSVYHSLLLFYLPFGMLKHEVPYSNGLVVGQWHLGNVVYTLVVITVCLKAGMELDAWNWVCHLSIWGSIASWFIFLLIYCLPGMAFIIAPDMIGQDTQLYSSGVFWMSVFIVPVITLMADYLYRLIKRTFFKTLTEEIQEVE 1060          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO42274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W4])

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 466/1122 (41.53%), Postives = 671/1122 (59.80%), Query Frame = 1
Query:  133 TTSQRIVNIN---HPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLM-KMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFF----------NFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYG-----------KGPDETFSAQ---------KDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERL--STASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMS-LCILDSDSLDKTRTQL--------------------IEVRQGF---------GENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRF----LNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANN----HDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGS-VVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLIL------IPSAALTRDIAWKAVKRTLFESLRERVMQMEK 3255
            T + R++ +N   +     Y  N I T+KY  +TF+PK LFEQF+R AN++FLL  I+   P ++     +TAVPL  ++  +AIK+  +D +RH++D   NN K   L  +   EI W +++ G+ +K+ N + IPAD ++L++SE +G+ YIET+ LDGETNLK RQ LP T ++     L+ K  G + CE PN  L +F G +A D ++  SL ND L+LRG  L+NT WV+G VVY+G ++K+M+NS     KR++++R+ N+ I+G+  LL  + +  SI   +W          +G + +    W  F+          ++ +F+++ NT+IPISL +++EV+R  Q+ +INWD  MY    +TPA ART+ L EELGQ+ YIFSDKTGTLT+NVM FK+CSI G +YG           + P   FS+           D  L++ +           + LA+CHTV+ +  +  ++YQA SPDE+ALV AA+  G++F  R+P  + I    +  ++++L +L+F + RKRMSVIV+  D KI L+ KGAD++IYERL  S  S   K T D L +FA  GLRTL +AY +I   +Y+ WK ++ +A V+++NRE ++ AV E+IEKNLILIGA+AIEDKLQD VP+ I+ LA A IKIWVLTGDK ETAVNIGYSCQLLT +M+ + +++ DS+D  R  +                    +  R+G          G+  G     GLV++G +L FAL+ Q   +FL++A  CKAVICCRV+P QKA VV LVK N K A+TLAIGDGANDV MI+AAH+G+GISG EG QA   SDY+ AQFR+    + RLLLVHG W+Y R+ K + Y FYKN  F +IQ W+A  +G+S Q +++ W I FYNV+FT+ P + L +FD+  + EN ++YP+LY   QQ+  F+ +VF     +  Y SL   WL  LA        I      T +L F G  +   +VV V+V+  L+   WTW++H   WGS +  +  YFI YS  F   G       +   VF +  FWL L++      IPS  +   +     K TL +++R +    E+
Sbjct:    4 TEADRVIEVNDRDNEAHHHYKDNFIRTSKYTIITFLPKNLFEQFQRVANMYFLLQVIIMSIPEITALKPESTAVPLVFVIGFTAIKDAYDDIRRHQSDRDVNNRKSKALIGNSREEIKWMKIKCGDVLKIDNNEQIPADFLILSTSEENGLCYIETAELDGETNLKCRQPLPDTNEMGDDEALLAKFKGTVHCEPPNNILDKFNGKIAFDNQE-YSLDNDNLILRGCVLRNTDWVYGTVVYAGQDSKLMMNSGVSTFKRTNLDRLLNKLIIGIAVLLACICIVLSIGTTIWEE-------LVGQNFQVFLQWPNFYMNNVVFIGTCHWPSFIMVLNTLIPISLYISVEVIRMGQSIWINWDQYMYYEKKDTPARARTTTLTEELGQIEYIFSDKTGTLTQNVMTFKKCSIHGKMYGEHAPLLYCIVLQSPLVDFSSNPYYDGKFRFHDKALIDDIANNSQGCHEMMRLLALCHTVMIDNAEEGLVYQAQSPDEAALVTAARNFGFVFKERSPTTLTIVAMGQEEQHELLAILDFNNDRKRMSVIVRQND-KIKLYCKGADSIIYERLHPSCTSLMDKTTED-LNKFAAEGLRTLVLAYKDITPQDYQAWKSKYDKACVAMDNREEQVQAVYEEIEKNLILIGATAIEDKLQDGVPDAIATLAAANIKIWVLTGDKPETAVNIGYSCQLLTDDMTEVFMINGDSMDAVRESINMYKSKVQAGLDDKAAHNNSVSFRKGSRETAKSDSGGKTDGGNAGFGLVITGKSLVFALNKQLELEFLELACMCKAVICCRVTPLQKALVVQLVKDN-KKAVTLAIGDGANDVSMIKAAHIGVGISGQEGMQATLASDYSFAQFRYPLHSIVRLLLVHGRWSYMRMCKFLNYFFYKNFAFTLIQLWYAFFTGYSAQTLYDAWFISFYNVLFTSGPVVFLAIFDQDVNHENCIRYPKLYVPGQQNIMFNKRVF---AYSLFYGSLTSLWLYFLAYGVLGFVTIDSVGRDTSNLKFFGTAVAATLVVVVNVEISLKTQYWTWINHFFTWGSIIFYFIFYFIYYSQFFFNRGPQEHYFGVQFQVFGNPVFWLYLLIAAFVTNIPS--ICEKLIRSEYKPTLSDAVRRKQQGRER 1109          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO37903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEC6])

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 408/1064 (38.35%), Postives = 598/1064 (56.20%), Query Frame = 1
Query:  178 KYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALD--GEKKI-SLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGK--------GPDETFSA------------------QKDP--NLLEKLKYGDSEVDMFFKALAVCHTVVPEKEDN-----EIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLC-ILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDI-----PFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVG--LSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRER 3237
            +Y  N I T+KY    F+PK LFEQFRR AN +FL I  +Q    V       + V          + +  EDY RHK D   N+    ++ +    +I  K ++VG+ V++ + +  P DL++LAS +P G  +I T+NLDGETNLK+R  + RT  + +   L  +   I C+ P+  LY + G +  +  GE +I SLG   LLLRGA LKN+  VFG+ VY+G ETK+ LN    P K S+VE+  N   L +  L+L L  A       W  +          D    S      +FL FLILYN +IPISL VT+E+ +     F  WD++MY+PDT+ PA A TS+LNEELGQV Y+F+DKTGTLT N M+FK+CSI G  Y +        GP +  S                   Q  P    +  L     +V  F+ ALA+CHTV   K  +     E  YQASSPDE ALV+AA   G ++  +  + +++ +   ++ Y +L+VLEF S RKRMSVIVKT + + ++ TKGA+  I +RL +  K+  +T D+++ +A+ GLRTL +A       EY     +  +A  +I +RE +LA V E++E NL L+GA+A+EDKLQ  VPETI  + +AGIK+WVLTGDK++TAVNI +SC      M L  +    S  +   +L++ +Q       K    GL+V G +L    +   ++ F+++   C AV+CCR+SP QKA+VV LVK + +  +TLAIGDGAND GMIQ AHVGIG+ G EG+QA   SDYAI++FRFL R+LLVHG W Y R   L+ Y FYKNVCF   QF +A  + FSGQ ++  + +  YN+ FT+ P L  G+F++    +     P LY+++ ++S      F+ W+ +  +H+L+ F+   L    D+     P    Q   +   G  ++   V+  ++K  L    WTWL+H+  WGS++ +F++ I+++      G  +S  M  ++  +F+ G  WLGL+L+   +L  D+    + R LF +  ++
Sbjct:   27 RYADNMIVTSKYTIWNFIPKNLFEQFRRIANFYFLCIGTIQ----VRGGSLIKSVVAGTDFYHTKCVAKGYEDYLRHKVDKEVNSRPCGVVFDGIVKDIQSKDIKVGDIVRVKDNEEFPCDLIVLASDDPEGKCHITTANLDGETNLKVRSAVSRTAFLHSPEKLSSLQATIECQHPHVDLYGYSGRIIFNANGENEITSLGPQNLLLRGARLKNSDHVFGVAVYTGKETKMALNQAEAPHKFSTVEKTMNT-FLIVFLLVLVLQGAICTGLKYWKESTVPGKAPYANDSGIASFKGVIEDFLVFLILYNYVIPISLYVTVELQKFIGALFFAWDVKMYNPDTDEPAIANTSDLNEELGQVEYVFTDKTGTLTENDMQFKECSINGKKYKENEMELCVDGPGQPASILMPSASVSLGQFNHVGHLQSTPFKTKMSILYNYIQDVLDFYLALALCHTVQASKSSDQESIYEFHYQASSPDEKALVEAAVRFGIVYRGKVGEDMEVQMQGTSHRYTLLHVLEFDSTRKRMSVIVKTAEGQYLMLTKGAETAILDRLESGPKD--VTADHVDGYAEQGLRTLAVAQRVFTPEEYRDVDAKLTKAGQAINDREQQLAEVFEEVECNLHLLGATAVEDKLQAGVPETIEAMREAGIKVWVLTGDKEQTAVNISHSCGHFKHGMDLMFVTRRSSPSECEQELLQFKQKVQSQPDKL--FGLIVDGMSLVHIFNGH-KELFIEVCKFCMAVLCCRMSPLQKAQVVQLVKVSKEKPVTLAIGDGANDCGMIQEAHVGIGVMGKEGRQAVMTSDYAISRFRFLARVLLVHGHWYYIRSAILVQYFFYKNVCFITPQFIYAFFNAFSGQPLYHGFLLTCYNIFFTSLPILIFGIFNQHIGGDILQGRPSLYQDVAKNSRLSWVQFIYWVASGYWHALVFFFGGYLMFQGDLFDLLKPISILQNVGIWSFGTFVFAVCVIVSNLKLALVTHYWTWLTHVVTWGSILTFFLFAIVFNSFQTTFGDQVSIDMYQVFFTLFNEGVVWLGLLLLILISLLPDVFGMIIGRHLFPTETQK 1080          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO40789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S635])

HSP 1 Score: 443.351 bits (1139), Expect = 4.624e-135
Identity = 249/600 (41.50%), Postives = 354/600 (59.00%), Query Frame = 1
Query: 1480 IIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENY-EYKVLNVLEFTSLRKRMSVIVKTP-DSKIVLFTKGADNVIYERLSTAS------KNG-KLTLDN-----LEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQL--------IE------------VRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAAL 3177
            I Y+A SPDE+ALVK A   GY   +R+P+ + I I  E   ++KVL+VL F S RKRMSV+V+ P D  ++++ KGAD+ +  RL+ AS      + G K TL N     L  +A+ GLRTLC+A  E+  +EY  W  E   A  ++++RE  L   A+K+E N+ L+GA+ IED+LQD VPETI+ L + G+K+WVLTGDKQETA+N+GY+ +LL  +M    L++ + D+   Q+        IE                F   I  +  +GL++ G TL +AL+    + FL +A  C+ V+CCR +P QKA VV LV+  +K  +TLAIGDGANDV MIQ A VGIGI+G EG QA   SD+AIA+FRFL +LLLVHG W Y+R+TK+ILY FYKN  F ++ FW+ + +GFSG    +  S+ F+N+IFTAAPP+  G+ D+   A      PQLY+  Q+   +  K+F   IL++LY S+ILF+   L          G       +G  ++   VV  SV  GL    WTW+ H  +WGSV   F++ I+    F +V  +  +  +     ++  FW   ++I  AAL
Sbjct:  667 ISYEAESPDEAALVKMACSYGYRLLSRSPNSVTIFIPGEGVVKFKVLHVLSFDSTRKRMSVVVRRPSDGAVLMYCKGADSAVLTRLTHASYADEAVEGGVKSTLVNQIDRHLTMYARDGLRTLCMAKRELSDSEYHDWLTEHKRAETALQHRERLLQESAQKLESNMELLGATGIEDRLQDGVPETIAKLREGGLKVWVLTGDKQETAINVGYASKLLDASMQKITLNAKNKDECSCQIYSWLNHLKIEPTVSSISGSTSYTTVSFDSRITADQPLGLIIDGPTLIYALEKPLNEKFLHLASRCQVVLCCRATPMQKASVVELVRDGLK-VMTLAIGDGANDVSMIQMADVGIGITGQEGMQAVMASDFAIARFRFLAQLLLVHGHWCYDRITKMILYFFYKNAMFVLVLFWYQLYNGFSGSNAIDDLSLIFFNLIFTAAPPIVCGILDKDLPATLLKDNPQLYKAGQEGQLYSRKLFWATILDALYQSVILFFACFL-------LFEGMPADDRMVGITMHQAAVVLASVHLGLMTAQWTWIHHFFLWGSVFLSFIWAIV----FGVVQPTHKIHYVSLVTMATKEFWALCVMITVAAL 1254          

HSP 2 Score: 292.738 bits (748), Expect = 7.007e-82
Identity = 159/402 (39.55%), Postives = 244/402 (60.70%), Query Frame = 1
Query:  190 NKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNS--KILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQ---GLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPN 1380
            NKI T KY   +F+PK LFEQF R+ANI+FL I  L   P ++  G+    +PL  +L ++A+K++ ED +R+ +D   NN+  ++    ++ ++   WK + VG+ +KL + + IPAD++LL SS+ + + Y+ET+NLDGETNLK R+   GL +  +  +  +    +  + CE PN H+Y F G + LD    +++G + LLLRG  ++NTK V G+VVY+GH+TK MLN++ P  K S VER  N  ++    +L  L     +   +WT  N     +     +  +  E F  F TF+I+   +IP SL V+ E+V+  Q F I+ D+++Y  +T+ P   R  N+NE+LGQ++Y+FSDKTGTLT N M FK+C+IGG+ Y   P E  SAQ  P+
Sbjct:   39 NKIKTTKYTIWSFIPKNLFEQFHRFANIYFLFIVGLNWVPAINAFGKEIAMLPLIFVLAVTAVKDLFEDRRRYNSDKKVNNTICQVYSSASASYIATKWKDVVVGDIIKLSSNEIIPADILLLNSSDENNICYVETANLDGETNLKQREVVNGLFKEDERFSPRNF---NFKLKCETPNNHIYRFHGAIELDDSHTLAVGKENLLLRGCIVRNTKNVEGVVVYAGHDTKAMLNNSGPRSKHSKVERDLNLDVIACVVILFTLCFLGGLGCGIWTQNNDFFNAHFAPGGESSAPMEGFIRFWTFIIILQVLIPYSLYVSAELVKLGQVFLISSDLQLYHEETDQPVICRALNINEDLGQIKYVFSDKTGTLTENKMVFKKCTIGGVNY---PHE--SAQDLPD 432          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO37904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEC7])

HSP 1 Score: 189.504 bits (480), Expect = 3.093e-54
Identity = 101/249 (40.56%), Postives = 152/249 (61.04%), Query Frame = 1
Query: 2320 SQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYS 3066
            S   +VV LVK + +  +TLAIGDGAND GMIQ AHVGIG+ G EG+QA   SDYAI++FRFL R+LLVHG W Y R   L+ Y FYKNVCF   QF +A  + FSGQ ++  + +  YN+ FT+ P L  G+F++    +     P LY+++ ++S      F+ W+ +  +H+L+ F+   L    D+ F +   G   F G  ++   V+  ++K  L    WTWL+H+  WGS++ +F++ I+++
Sbjct:    2 SYNDQVVQLVKVSKEKPVTLAIGDGANDCGMIQEAHVGIGVMGKEGRQAVMTSDYAISRFRFLARVLLVHGHWYYIRSAILVQYFFYKNVCFITPQFIYAFFNAFSGQPLYHGFLLTCYNIFFTSLPILIFGIFEQHIGGDILQGRPSLYQDVAKNSRLSWVQFIYWVASGYWHALVFFFGGYLMFQGDL-FGSINVGIWSF-GTFVFAVCVIVSNLKLALVTHYWTWLTHVVTWGSILTFFLFAIVFN 248          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp8a1 (ATPase phospholipid transporting 8A1 [Source:NCBI gene;Acc:101175086])

HSP 1 Score: 1231.08 bits (3184), Expect = 0.000e+0
Identity = 613/1154 (53.12%), Postives = 805/1154 (69.76%), Query Frame = 1
Query:   88 GY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGP---------DETFSAQK-------DPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            GY KT        L +    R++ +N PQ  K+C N++STAKYN LTF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGR+TT VPL  IL ++A+KEI+ED KRHKAD   N  +  +L+N  W  + W+++ VG  V+  NG  +PADLV+L+SSEP GM YIETSNLDGETNLK+RQGL  T ++  I  LM++ G + CE PN HLYEF GN+ L G   + LG DQ+LLRGA L+NT+W+ G+VVY+GH+TK+M NST PPLK S+VER+TN  IL L G LL ++L  S    +W     + AWY+  + K         NFLTF+IL+N +IPISL VT+EV++  Q FFINWD +M    TNTPA ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C++ G+ YG  P         D+  S+Q        DP+LLE L+       +   F   +A+CHT VPE+ D +I+YQA+SPDE ALV+AA+ +G++F  RTPD + + +     +Y++L+VLEFTS RKRMSVI++TP  KI L+ KGAD+VIY+RL+ +S+  ++TL +LE+FA  GLRTLC A A+I  + Y+ W+     A  S++NR  KL    E IEKNL L+GA+AIEDKLQD+VPETI  L KA IKIW+LTGDKQETA+NIG+SC+LLT+NM + +++ DSLD TR  L       G+ + K+ND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDVGMIQ AHVG+GISG EG QAA +SDY+IAQF++L  LLLVHGAWNYNR+ K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  HD  F NG+T   L LGN +YT+VV+TV +KAGLE  +WT  SH+AIWGS+  W V+FI+YS L+ L+ L+  M+     +FSSG FW+GL+ IP  +L  D+A+KAVK+  F++L + V ++E  ++DPG+++              R   L      + V      + +  +  GYAFSQ+E+GVVSQS++IR Y++T ++
Sbjct:   17 GYEKTEDTSEKTSLADQEDARLMYLNQPQFTKFCSNRVSTAKYNVLTFLPRFLYSQFRRAANAFFLFIALLQQIPDVSPTGRWTTLVPLIFILVVAAVKEIIEDLKRHKADSVVNKKECQVLRNGAWEIVHWEKVAVGEVVRAANGDHLPADLVILSSSEPQGMCYIETSNLDGETNLKIRQGLQATAELKDIDSLMRLSGRMECESPNLHLYEFVGNIRLHGHSAVPLGPDQILLRGAQLRNTQWIHGVVVYTGHDTKLMQNSTRPPLKLSNVERITNFQILVLFGCLLAISLVCSFGQTIWKYQYGNDAWYMDLNCKDGGAANFGLNFLTFIILFNNLIPISLLVTLEVIKFIQAFFINWDTDMLYEPTNTPAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTVAGVAYGHAPEGEEGSFAEDDCHSSQSSEEAGFNDPSLLENLQSNHPTAAVILDFMSMMAICHTAVPERIDGKILYQAASPDEGALVRAAQNLGFVFSGRTPDSVIVEMLGSEEKYELLHVLEFTSSRKRMSVIIRTPSGKIRLYCKGADSVIYDRLADSSRYKEITLKHLEQFATEGLRTLCFAVADISESSYQHWQELHLRACTSLQNRALKLEESYELIEKNLQLLGATAIEDKLQDKVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLTKNMGMLVINEDSLDVTRETLSYHCGMLGDALYKDNDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVGMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLLVHGAWNYNRVAKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVIFTALPPLTLGIFERSCRKENMLKYPELYKTSQNAMGFNTKVFWAHCLNGLFHSVILFWFPLQAFRHDTVFGNGRTPDYLLLGNMVYTFVVITVCLKAGLETSSWTMFSHIAIWGSIGLWVVFFIVYSALWPLIPLAPDMSGEAVMMFSSGVFWMGLVFIPITSLVFDVAYKAVKKAFFKTLVDEVQELEALSKDPGEVV-------HGKSLTERAQLLKNVFKKSTVSLYRSDSMQHNLLHGYAFSQDENGVVSQSEVIRAYDTTKQR 1162          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:NCBI gene;Acc:101162251])

HSP 1 Score: 1230.7 bits (3183), Expect = 0.000e+0
Identity = 626/1176 (53.23%), Postives = 818/1176 (69.56%), Query Frame = 1
Query:   52 DKAPVPDNTDAPGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNAN-KDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            DK P   +  + GY+     + +E+  TTSQ        R V +N PQ  K+C N +ST KY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L++  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD +    LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +S+   +W   + K   WYL       +++   +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+T A ARTSNLNEELGQV+Y+FSDKTGTLT N+M FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I    +   Y++LNVLEF+S RKRMSV+V+TP+ ++ L+ KGADNVI+ERL  AS+  +LT+ +LE+FA  GLRTLC AY +++   Y++W  E++ AS  I++R  KL    E +EKNL+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETA+NIGYSC+L+T  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N L++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  +    HD PF +GQ    LF GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+  W V+F +YS ++  + ++  M      V     FWLGL+L+P+A L +D AW A +R++ +SL E V ++E    DPG  +  D   +  N  R+         TP+ V  +N       V+ GYAFSQEEHGVVSQS+++R Y++T ++P
Sbjct:   49 DKRP---SCSSAGYR----KADDEMSGTTSQAEPIDATARTVLLNRPQTTKFCDNHVSTTKYGVLTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRSGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTAGFQSLEDLIVLTGRLECEGPNRHLYDFTGTLRLDSQNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSVGAAIWNKVHTKAACWYLSPADDISTNFA--YNLLTFIILYNNLIPISLLVTLEVVKFIQALFINWDVEMYYSETDTAAMARTSNLNEELGQVKYLFSDKTGTLTCNIMHFKKCTIAGITYGHFPDLDCDRSMEDFSNLPSNSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKGLGFVFTARTPHSVIIEARGKEMTYELLNVLEFSSNRKRMSVVVRTPNGRLRLYCKGADNVIFERLHEASQYKELTIAHLEQFATEGLRTLCFAYVDLEEGTYQEWLKEYNSASTVIKDRAQKLEECYELLEKNLMLLGATAIEDRLQAGVPETIATLMKADIKIWVLTGDKQETAINIGYSCRLVTHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFELRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMLRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKMLEHDSPFSSGQGNDYLFAGNMVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSIALWMVFFAVYSVIWPTIPIAPDMLGQAGRVMQCWYFWLGLVLVPTACLLKDFAWTAARRSVRKSLLEEVQELEAHAVDPGAAVLRDSSGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVTHGYAFSQEEHGVVSQSEVVRSYDTTRQRP 1211          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:NCBI gene;Acc:101162251])

HSP 1 Score: 1229.93 bits (3181), Expect = 0.000e+0
Identity = 626/1173 (53.37%), Postives = 817/1173 (69.65%), Query Frame = 1
Query:   61 PVPDNTDAPGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNAN-KDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            P P  + A GY+     + +E+  TTSQ        R V +N PQ  K+C N +ST KY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L++  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD +    LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +S+   +W   + K   WYL       +++   +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+T A ARTSNLNEELGQV+Y+FSDKTGTLT N+M FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I    +   Y++LNVLEF+S RKRMSV+V+TP+ ++ L+ KGADNVI+ERL  AS+  +LT+ +LE+FA  GLRTLC AY +++   Y++W  E++ AS  I++R  KL    E +EKNL+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETA+NIGYSC+L+T  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N L++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  +    HD PF +GQ    LF GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+  W V+F +YS ++  + ++  M      V     FWLGL+L+P+A L +D AW A +R++ +SL E V ++E    DPG  +  D   +  N  R+         TP+ V  +N       V+ GYAFSQEEHGVVSQS+++R Y++T ++P
Sbjct:    5 PGPSCSSA-GYR----KADDEMSGTTSQAEPIDATARTVLLNRPQTTKFCDNHVSTTKYGVLTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRSGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTAGFQSLEDLIVLTGRLECEGPNRHLYDFTGTLRLDSQNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSVGAAIWNKVHTKAACWYLSPADDISTNFA--YNLLTFIILYNNLIPISLLVTLEVVKFIQALFINWDVEMYYSETDTAAMARTSNLNEELGQVKYLFSDKTGTLTCNIMHFKKCTIAGITYGHFPDLDCDRSMEDFSNLPSNSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKGLGFVFTARTPHSVIIEARGKEMTYELLNVLEFSSNRKRMSVVVRTPNGRLRLYCKGADNVIFERLHEASQYKELTIAHLEQFATEGLRTLCFAYVDLEEGTYQEWLKEYNSASTVIKDRAQKLEECYELLEKNLMLLGATAIEDRLQAGVPETIATLMKADIKIWVLTGDKQETAINIGYSCRLVTHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFELRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMLRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKMLEHDSPFSSGQGNDYLFAGNMVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSIALWMVFFAVYSVIWPTIPIAPDMLGQAGRVMQCWYFWLGLVLVPTACLLKDFAWTAARRSVRKSLLEEVQELEAHAVDPGAAVLRDSSGRSLNE-RAHLLTRVFRKTPSSVGRSNSVQQ--TVTHGYAFSQEEHGVVSQSEVVRSYDTTRQRP 1166          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp8a1 (ATPase phospholipid transporting 8A1 [Source:NCBI gene;Acc:101175086])

HSP 1 Score: 1224.54 bits (3167), Expect = 0.000e+0
Identity = 607/1139 (53.29%), Postives = 801/1139 (70.32%), Query Frame = 1
Query:   88 GY-KTMTQHSVEELKETTSQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQ-KDPNLLEKLKYGDSEVDM---FFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKK 3489
            GY KT        L +    R++ +N PQ  K+C N++STAKYN LTF+P+FL+ QFRR AN FFL IA+LQQ P+VSPTGR+TT VPL  IL ++A+KEI+ED KRHKAD   N  +  +L+N  W  + W++++VG+ +K+     +PAD V+L+SSEP GM YIETSNLDGETNLK+RQGL  T ++  I  LM++ G + CE PN HLYEF GN+ L G   + LG DQ+LLRGA L+NT+W+ G+VVY+GH+TK+M NST PPLK S+VER+TN  IL L G LL ++L  S    +W     + AWY+  + K         NFLTF+IL+N +IPISL VT+EV++  Q FFINWD +M    TNTPA ARTSNLNEELGQV+YIFSDKTGTLT NVM+FK+C++ G+ YG     +  A   DP+LLE L+       +   F   +A+CHT VPE+ D +I+YQA+SPDE ALV+AA+ +G++F  RTPD + + +     +Y++L+VLEFTS RKRMSVI++TP  KI L+ KGAD+VIY+RL+ +S+  ++TL +LE+FA  GLRTLC A A+I  + Y+ W+     A  S++NR  KL    E IEKNL L+GA+AIEDKLQD+VPETI  L KA IKIW+LTGDKQETA+NIG+SC+LLT+NM + +++ DSLD TR  L       G+ + K+ND  L++ G TLK+AL F  R  FL +ALSCKAVICCRVSP QK+EVV +VK  +K  ITLAIGDGANDVGMIQ AHVG+GISG EG QAA +SDY+IAQF++L  LLLVHGAWNYNR+ K ILY FYKN+  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PPL LG+F+RSC  EN LKYP+LY+  Q +  F+ KVF    LN L+HS+ILFW  + A  HD  F NG+T   L LGN +YT+VV+TV +KAGLE  +WT  SH+AIWGS+  W V+FI+YS L+ L+ L+  M+     +FSSG FW+GL+ IP  +L  D+A+KAVK+  F++L + V ++E  ++DPG+++              R   L      + V      + +  +  GYAFSQ+E+GVVSQS++IR Y++T ++
Sbjct:   17 GYEKTEDTSEKTSLADQEDARLMYLNQPQFTKFCSNRVSTAKYNVLTFLPRFLYSQFRRAANAFFLFIALLQQIPDVSPTGRWTTLVPLIFILVVAAVKEIIEDLKRHKADSVVNKKECQVLRNGAWEIVHWEKVEVGDIIKVNGSDFVPADAVILSSSEPQGMCYIETSNLDGETNLKIRQGLQATAELKDIDSLMRLSGRMECESPNLHLYEFVGNIRLHGHSAVPLGPDQILLRGAQLRNTQWIHGVVVYTGHDTKLMQNSTRPPLKLSNVERITNFQILVLFGCLLAISLVCSFGQTIWKYQYGNDAWYMDLNCKDGGAANFGLNFLTFIILFNNLIPISLLVTLEVIKFIQAFFINWDTDMLYEPTNTPAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQFKKCTVAGVAYGHSSQSSEEAGFNDPSLLENLQSNHPTAAVILDFMSMMAICHTAVPERIDGKILYQAASPDEGALVRAAQNLGFVFSGRTPDSVIVEMLGSEEKYELLHVLEFTSSRKRMSVIIRTPSGKIRLYCKGADSVIYDRLADSSRYKEITLKHLEQFATEGLRTLCFAVADISESSYQHWQELHLRACTSLQNRALKLEESYELIEKNLQLLGATAIEDKLQDKVPETIETLMKADIKIWILTGDKQETAINIGHSCKLLTKNMGMLVINEDSLDVTRETLSYHCGMLGDALYKDNDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVK-VITLAIGDGANDVGMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLLVHGAWNYNRVAKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVIFTALPPLTLGIFERSCRKENMLKYPELYKTSQNAMGFNTKVFWAHCLNGLFHSVILFWFPLQAFRHDTVFGNGRTPDYLLLGNMVYTFVVITVCLKAGLETSSWTMFSHIAIWGSIGLWVVFFIVYSALWPLIPLAPDMSGEAVMMFSSGVFWMGLVFIPITSLVFDVAYKAVKKAFFKTLVDEVQELEALSKDPGEVV-------HGKSLTERAQLLKNVFKKSTVSLYRSDSMQHNLLHGYAFSQDENGVVSQSEVIRAYDTTKQR 1147          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp8a2 (ATPase phospholipid transporting 8A2 [Source:NCBI gene;Acc:101162251])

HSP 1 Score: 1217.99 bits (3150), Expect = 0.000e+0
Identity = 630/1214 (51.89%), Postives = 821/1214 (67.63%), Query Frame = 1
Query:   52 DKAPVPDNTDAPGYKTMTQHSVEELKETTSQ--------RIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNAN-KDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPD-------ETFSAQ----------KDPNLLEKLKYG---DSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRK-----------------FCNPFRSRDAKLG-GPTT--PTIVDDNNR-------FNHRPR-----------VSSGYAFSQEEHGVVSQSQLIREYNSTIKKP 3492
            DK P   +  + GY+     + +E+  TTSQ        R V +N PQ  K+C N +ST KY  LTF+P+FL+EQ RR AN FFL IA++QQ P+VSPTGRYTT VPL  ILT++ IKEI+EDYKRHKAD++ N  K  +L++  W  I WKQ+ VG+ VK+ NGQ +PAD+V+++SSEP  M Y ETSNLDGETNLK+RQGL  T    ++ DL+ + G + CE PNRHLY+F G L LD +    LG DQ+LLRGA L+NT+WV GIVVY+GH++K+M NST  PLKRS+VER+TN  IL L G+LL + L +S+   +W   + K   WYL       +++   +N LTF+ILYN +IPISL VT+EVV+  Q  FINWD+EMY  +T+T A ARTSNLNEELGQV+Y+FSDKTGTLT N+M FK+C+I GI YG  PD       E FS             DP L++ ++       ++  F   +AVCHTVVPE+EDN+IIYQASSPDE ALVK AK +G++F  RTP  + I    +   Y++LNVLEF+S RKRMSV+V+TP+ ++ L+ KGADNVI+ERL  AS+  +LT+ +LE+FA  GLRTLC AY +++   Y++W  E++ AS  I++R  KL    E +EKNL+L+GA+AIED+LQ  VPETI+ L KA IKIWVLTGDKQETA+NIGYSC+L+T  MSL I++ DSLD TR  L       G+++ KEN++ L++ G TLK+AL F+ R  FL +ALSCKAVICCRVSP QK+E+V +VK ++K AITLAIGDGANDVGMIQ AHVG+GISG EG QA  +SDY+IAQF +L +LLLVHGAW+YNR+TK ILY FYKNV  ++I+ WFA V+GFSGQI+FERW IG YNVIFTA PP  LG+FDR CS +N L++PQLYR  Q +  F+ KVF    +N+L HS+ILFW  +    HD PF +GQ    LF GN +YTYVVVTV +KAG+E  AWT  SHLA+WGS+  W V+F +YS ++  + ++  M      V     FWLGL+L+P+A L +D AW A +R++ +SL E V ++E    DPG  +  D   +                  C     +D   G GP    P +   N R       F   P            V+ GYAFSQEEHGVVSQS+++R Y++T ++P
Sbjct:   49 DKRP---SCSSAGYR----KADDEMSGTTSQAEPIDATARTVLLNRPQTTKFCDNHVSTTKYGVLTFLPRFLYEQIRRAANAFFLFIALMQQIPDVSPTGRYTTLVPLIFILTVAGIKEIIEDYKRHKADNTVNKKKTTVLRSGAWQTIIWKQVAVGDIVKVTNGQHLPADMVIVSSSEPQAMCYTETSNLDGETNLKIRQGLSLTAGFQSLEDLIVLTGRLECEGPNRHLYDFTGTLRLDSQNPAPLGPDQVLLRGAQLRNTQWVVGIVVYTGHDSKLMQNSTKAPLKRSNVERVTNMQILVLFGILLVMALVSSVGAAIWNKVHTKAACWYLSPADDISTNFA--YNLLTFIILYNNLIPISLLVTLEVVKFIQALFINWDVEMYYSETDTAAMARTSNLNEELGQVKYLFSDKTGTLTCNIMHFKKCTIAGITYGHFPDLDCDRSMEDFSNLPSNSHNSTEFDDPALIQNIEKNHPTSPQICEFLTMMAVCHTVVPEREDNQIIYQASSPDEGALVKGAKGLGFVFTARTPHSVIIEARGKEMTYELLNVLEFSSNRKRMSVVVRTPNGRLRLYCKGADNVIFERLHEASQYKELTIAHLEQFATEGLRTLCFAYVDLEEGTYQEWLKEYNSASTVIKDRAQKLEECYELLEKNLMLLGATAIEDRLQAGVPETIATLMKADIKIWVLTGDKQETAINIGYSCRLVTHGMSLIIVNEDSLDATRATLTAHCSSLGDSLRKENELALIIDGQTLKYALSFELRQAFLDLALSCKAVICCRVSPLQKSEIVDMVKKHVK-AITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNSSDYSIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFDRPCSQQNMLRFPQLYRITQNAEGFNTKVFWGHCINALIHSIILFWFPLKMLEHDSPFSSGQGNDYLFAGNMVYTYVVVTVCLKAGMETTAWTRFSHLAVWGSIALWMVFFAVYSVIWPTIPIAPDMLGQAGRVMQCWYFWLGLVLVPTACLLKDFAWTAARRSVRKSLLEEVQELEAHAVDPGAAVLRDSSGRRSAASLSFGPFIFFLSVCCLWLCPQDRSQGRGPVELRPALQSLNERAHLLTRVFRKTPSSVGRSNSVQQTVTHGYAFSQEEHGVVSQSEVVRSYDTTRQRP 1252          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000026251.1 (SMESG000026251.1)

HSP 1 Score: 2009.96 bits (5206), Expect = 0.000e+0
Identity = 1000/1156 (86.51%), Postives = 1047/1156 (90.57%), Query Frame = 1
Query:   43 MSNDKAPVPDNTDAPGYKTMT-QHSVEELKETT-SQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 3504
            M NDK PVPDNTDAPGYKTMT QHS EE K+T+ SQRIVNINHPQ VKYC+NKIS +KYNFLTFMPKFLFEQFR+Y N++FLLI ILQQFPNVSPTGRYTTAVPLF ILT+SAIKEIVEDYKRHKADDSTNNSK+LILQNSEWVEICWK+LQVGN VKLINGQ IPADLVLLASSEPH MSYIETSNLDGETNLKMRQGLPRTC ILTITDL+K+ GHI CEVPNRHLYEF GNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTT PLK+SSVER  NRYIL   G+L+FLTL T+IAN++ TNA KD AWYLGF+           NFL   I Y++IIPIS+ V +E+ R  Q+ FIN DIEMYDPDTNTPANARTSNLNEELGQ+RYIFSDKTGTLTRN+MEFKQCSIGGIIYGKG  +T S QKD NLLEKLKYGDSEVDMFFKALAVCHTVVP+KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKI INNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLS ASKNGKLTLDNL+EFAKIGLRTLCIAYAEIDSN+YEKWK EF EASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGEN+GKENDIGLVV+GDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNR+ KLILYSFYKNVCFF+IQFWFA  S FSGQIIFERWSI FYNVIFTAAPPLALG+FDRSCS++  LKYP+LYREIQ SSTFDLKVFLTWIL S++HS ILFWL V  NNHDI FRNGQTGSL +LGNCIY YVVVTVS+KAGLE   WTW SHLAI GSVVAWFVYFIIYSHLFQL GLS SMALMYQAVFSSGTFWLGLILIPS AL  DI  KA+  T FESLR+ VM+ EKR     KIIPIDIKRK+ NPFRSR AKLGGPTT TIVDDNNR         GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK
Sbjct:    5 MPNDKKPVPDNTDAPGYKTMTPQHSDEESKDTSNSQRIVNINHPQLVKYCINKISASKYNFLTFMPKFLFEQFRKYGNLYFLLIVILQQFPNVSPTGRYTTAVPLFFILTLSAIKEIVEDYKRHKADDSTNNSKLLILQNSEWVEICWKKLQVGNIVKLINGQKIPADLVLLASSEPHAMSYIETSNLDGETNLKMRQGLPRTCHILTITDLVKIRGHIECEVPNRHLYEFYGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTAPLKKSSVERKMNRYILVTFGILVFLTLVTTIANMISTNAIKDIAWYLGFEGSNFG-----LNFLENFITYHSIIPISVSVQLEMARFGQSHFINEDIEMYDPDTNTPANARTSNLNEELGQIRYIFSDKTGTLTRNIMEFKQCSIGGIIYGKGAGDTLSVQKDTNLLEKLKYGDSEVDMFFKALAVCHTVVPDKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKILINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSPASKNGKLTLDNLKEFAKIGLRTLCIAYAEIDSNKYEKWKKEFLEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENLGKENDIGLVVNGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRIAKLILYSFYKNVCFFMIQFWFATESSFSGQIIFERWSIAFYNVIFTAAPPLALGIFDRSCSSKILLKYPRLYREIQHSSTFDLKVFLTWILYSIFHSAILFWLPVYINNHDILFRNGQTGSLFYLGNCIYAYVVVTVSLKAGLELRVWTWPSHLAISGSVVAWFVYFIIYSHLFQLTGLSVSMALMYQAVFSSGTFWLGLILIPSVALCLDIVCKAINITPFESLRKIVMEREKR-----KIIPIDIKRKYYNPFRSRYAKLGGPTTLTIVDDNNR---------GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 1141          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000026251.1 (SMESG000026251.1)

HSP 1 Score: 2008.42 bits (5202), Expect = 0.000e+0
Identity = 1000/1156 (86.51%), Postives = 1047/1156 (90.57%), Query Frame = 1
Query:   43 MSNDKAPVPDNTDAPGYKTMT-QHSVEELKETT-SQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 3504
            M NDK PVPDNTDAPGYKTMT QHS EE K+T+ SQRIVNINHPQ VKYC+NKIS +KYNFLTFMPKFLFEQFR+Y N++FLLI ILQQFPNVSPTGRYTTAVPLF ILT+SAIKEIVEDYKRHKADDSTNNSK+LILQNSEWVEICWK+LQVGN VKLINGQ IPADLVLLASSEPH MSYIETSNLDGETNLKMRQGLPRTC ILTITDL+K+ GHI CEVPNRHLYEF GNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTT PLK+SSVER  NRYIL   G+L+FLTL T+IAN++ TNA KD AWYLGF+           NFL   I Y++IIPIS+ V +E+ R  Q+ FIN DIEMYDPDTNTPANARTSNLNEELGQ+RYIFSDKTGTLTRN+MEFKQCSIGGIIYGKG  +T S QKD NLLEKLKYGDSEVDMFFKALAVCHTVVP+KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKI INNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLS ASKNGKLTLDNL+EFAKIGLRTLCIAYAEIDSN+YEKWK EF EASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGEN+GKENDIGLVV+GDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNR+ KLILYSFYKNVCFF+IQFWFA  S FSGQIIFERWSI FYNVIFTAAPPLALG+FDRSCS++  LKYP+LYREIQ SSTFDLKVFLTWIL S++HS ILFWL V  NNHDI FRNGQTGSL +LGNCIY YVVVTVS+KAGLE   WTW SHLAI GSVVAWFVYFIIYSHLFQL GLS SMALMYQAVFSSGTFWLGLILIPS AL  DI  KA+  T FESLR+ VM+ EKR     KIIPIDIKRK+ NPFRSR AKLGGPTT TIVDDNNR         GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK
Sbjct:   11 MPNDKKPVPDNTDAPGYKTMTPQHSDEESKDTSNSQRIVNINHPQLVKYCINKISASKYNFLTFMPKFLFEQFRKYGNLYFLLIVILQQFPNVSPTGRYTTAVPLFFILTLSAIKEIVEDYKRHKADDSTNNSKLLILQNSEWVEICWKKLQVGNIVKLINGQKIPADLVLLASSEPHAMSYIETSNLDGETNLKMRQGLPRTCHILTITDLVKIRGHIECEVPNRHLYEFYGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTAPLKKSSVERKMNRYILVTFGILVFLTLVTTIANMISTNAIKDIAWYLGFEGSNFG-----LNFLENFITYHSIIPISVSVQLEMARFGQSHFINEDIEMYDPDTNTPANARTSNLNEELGQIRYIFSDKTGTLTRNIMEFKQCSIGGIIYGKGAGDTLSVQKDTNLLEKLKYGDSEVDMFFKALAVCHTVVPDKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKILINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSPASKNGKLTLDNLKEFAKIGLRTLCIAYAEIDSNKYEKWKKEFLEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENLGKENDIGLVVNGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRIAKLILYSFYKNVCFFMIQFWFATESSFSGQIIFERWSIAFYNVIFTAAPPLALGIFDRSCSSKILLKYPRLYREIQHSSTFDLKVFLTWILYSIFHSAILFWLPVYINNHDILFRNGQTGSLFYLGNCIYAYVVVTVSLKAGLELRVWTWPSHLAISGSVVAWFVYFIIYSHLFQLTGLSVSMALMYQAVFSSGTFWLGLILIPSVALCLDIVCKAINITPFESLRKIVMEREKR-----KIIPIDIKRKYYNPFRSRYAKLGGPTTLTIVDDNNR---------GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 1147          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000026251.1 (SMESG000026251.1)

HSP 1 Score: 2008.42 bits (5202), Expect = 0.000e+0
Identity = 1000/1156 (86.51%), Postives = 1047/1156 (90.57%), Query Frame = 1
Query:   43 MSNDKAPVPDNTDAPGYKTMT-QHSVEELKETT-SQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 3504
            M NDK PVPDNTDAPGYKTMT QHS EE K+T+ SQRIVNINHPQ VKYC+NKIS +KYNFLTFMPKFLFEQFR+Y N++FLLI ILQQFPNVSPTGRYTTAVPLF ILT+SAIKEIVEDYKRHKADDSTNNSK+LILQNSEWVEICWK+LQVGN VKLINGQ IPADLVLLASSEPH MSYIETSNLDGETNLKMRQGLPRTC ILTITDL+K+ GHI CEVPNRHLYEF GNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTT PLK+SSVER  NRYIL   G+L+FLTL T+IAN++ TNA KD AWYLGF+           NFL   I Y++IIPIS+ V +E+ R  Q+ FIN DIEMYDPDTNTPANARTSNLNEELGQ+RYIFSDKTGTLTRN+MEFKQCSIGGIIYGKG  +T S QKD NLLEKLKYGDSEVDMFFKALAVCHTVVP+KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKI INNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLS ASKNGKLTLDNL+EFAKIGLRTLCIAYAEIDSN+YEKWK EF EASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGEN+GKENDIGLVV+GDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNR+ KLILYSFYKNVCFF+IQFWFA  S FSGQIIFERWSI FYNVIFTAAPPLALG+FDRSCS++  LKYP+LYREIQ SSTFDLKVFLTWIL S++HS ILFWL V  NNHDI FRNGQTGSL +LGNCIY YVVVTVS+KAGLE   WTW SHLAI GSVVAWFVYFIIYSHLFQL GLS SMALMYQAVFSSGTFWLGLILIPS AL  DI  KA+  T FESLR+ VM+ EKR     KIIPIDIKRK+ NPFRSR AKLGGPTT TIVDDNNR         GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK
Sbjct:   14 MPNDKKPVPDNTDAPGYKTMTPQHSDEESKDTSNSQRIVNINHPQLVKYCINKISASKYNFLTFMPKFLFEQFRKYGNLYFLLIVILQQFPNVSPTGRYTTAVPLFFILTLSAIKEIVEDYKRHKADDSTNNSKLLILQNSEWVEICWKKLQVGNIVKLINGQKIPADLVLLASSEPHAMSYIETSNLDGETNLKMRQGLPRTCHILTITDLVKIRGHIECEVPNRHLYEFYGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTAPLKKSSVERKMNRYILVTFGILVFLTLVTTIANMISTNAIKDIAWYLGFEGSNFG-----LNFLENFITYHSIIPISVSVQLEMARFGQSHFINEDIEMYDPDTNTPANARTSNLNEELGQIRYIFSDKTGTLTRNIMEFKQCSIGGIIYGKGAGDTLSVQKDTNLLEKLKYGDSEVDMFFKALAVCHTVVPDKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKILINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSPASKNGKLTLDNLKEFAKIGLRTLCIAYAEIDSNKYEKWKKEFLEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENLGKENDIGLVVNGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRIAKLILYSFYKNVCFFMIQFWFATESSFSGQIIFERWSIAFYNVIFTAAPPLALGIFDRSCSSKILLKYPRLYREIQHSSTFDLKVFLTWILYSIFHSAILFWLPVYINNHDILFRNGQTGSLFYLGNCIYAYVVVTVSLKAGLELRVWTWPSHLAISGSVVAWFVYFIIYSHLFQLTGLSVSMALMYQAVFSSGTFWLGLILIPSVALCLDIVCKAINITPFESLRKIVMEREKR-----KIIPIDIKRKYYNPFRSRYAKLGGPTTLTIVDDNNR---------GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 1150          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000026251.1 (SMESG000026251.1)

HSP 1 Score: 2006.88 bits (5198), Expect = 0.000e+0
Identity = 1000/1156 (86.51%), Postives = 1047/1156 (90.57%), Query Frame = 1
Query:   43 MSNDKAPVPDNTDAPGYKTMT-QHSVEELKETT-SQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 3504
            M NDK PVPDNTDAPGYKTMT QHS EE K+T+ SQRIVNINHPQ VKYC+NKIS +KYNFLTFMPKFLFEQFR+Y N++FLLI ILQQFPNVSPTGRYTTAVPLF ILT+SAIKEIVEDYKRHKADDSTNNSK+LILQNSEWVEICWK+LQVGN VKLINGQ IPADLVLLASSEPH MSYIETSNLDGETNLKMRQGLPRTC ILTITDL+K+ GHI CEVPNRHLYEF GNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTT PLK+SSVER  NRYIL   G+L+FLTL T+IAN++ TNA KD AWYLGF+           NFL   I Y++IIPIS+ V +E+ R  Q+ FIN DIEMYDPDTNTPANARTSNLNEELGQ+RYIFSDKTGTLTRN+MEFKQCSIGGIIYGKG  +T S QKD NLLEKLKYGDSEVDMFFKALAVCHTVVP+KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKI INNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLS ASKNGKLTLDNL+EFAKIGLRTLCIAYAEIDSN+YEKWK EF EASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGEN+GKENDIGLVV+GDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNR+ KLILYSFYKNVCFF+IQFWFA  S FSGQIIFERWSI FYNVIFTAAPPLALG+FDRSCS++  LKYP+LYREIQ SSTFDLKVFLTWIL S++HS ILFWL V  NNHDI FRNGQTGSL +LGNCIY YVVVTVS+KAGLE   WTW SHLAI GSVVAWFVYFIIYSHLFQL GLS SMALMYQAVFSSGTFWLGLILIPS AL  DI  KA+  T FESLR+ VM+ EKR     KIIPIDIKRK+ NPFRSR AKLGGPTT TIVDDNNR         GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK
Sbjct:    1 MPNDKKPVPDNTDAPGYKTMTPQHSDEESKDTSNSQRIVNINHPQLVKYCINKISASKYNFLTFMPKFLFEQFRKYGNLYFLLIVILQQFPNVSPTGRYTTAVPLFFILTLSAIKEIVEDYKRHKADDSTNNSKLLILQNSEWVEICWKKLQVGNIVKLINGQKIPADLVLLASSEPHAMSYIETSNLDGETNLKMRQGLPRTCHILTITDLVKIRGHIECEVPNRHLYEFYGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTAPLKKSSVERKMNRYILVTFGILVFLTLVTTIANMISTNAIKDIAWYLGFEGSNFG-----LNFLENFITYHSIIPISVSVQLEMARFGQSHFINEDIEMYDPDTNTPANARTSNLNEELGQIRYIFSDKTGTLTRNIMEFKQCSIGGIIYGKGAGDTLSVQKDTNLLEKLKYGDSEVDMFFKALAVCHTVVPDKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKILINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSPASKNGKLTLDNLKEFAKIGLRTLCIAYAEIDSNKYEKWKKEFLEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENLGKENDIGLVVNGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRIAKLILYSFYKNVCFFMIQFWFATESSFSGQIIFERWSIAFYNVIFTAAPPLALGIFDRSCSSKILLKYPRLYREIQHSSTFDLKVFLTWILYSIFHSAILFWLPVYINNHDILFRNGQTGSLFYLGNCIYAYVVVTVSLKAGLELRVWTWPSHLAISGSVVAWFVYFIIYSHLFQLTGLSVSMALMYQAVFSSGTFWLGLILIPSVALCLDIVCKAINITPFESLRKIVMEREKR-----KIIPIDIKRKYYNPFRSRYAKLGGPTTLTIVDDNNR---------GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 1137          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000026251.1 (SMESG000026251.1)

HSP 1 Score: 2004.18 bits (5191), Expect = 0.000e+0
Identity = 1000/1159 (86.28%), Postives = 1047/1159 (90.34%), Query Frame = 1
Query:   43 MSNDKAPVPDNTDAPGYKTMT-QHSVEELKETT-SQRIVNINHPQPVKYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQ---QFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYIXXXXXXXXXXXXATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLILYNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEKLKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIPFRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAWFVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIAWKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLGGPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 3504
            M NDK PVPDNTDAPGYKTMT QHS EE K+T+ SQRIVNINHPQ VKYC+NKIS +KYNFLTFMPKFLFEQFR+Y N++FLLI ILQ   QFPNVSPTGRYTTAVPLF ILT+SAIKEIVEDYKRHKADDSTNNSK+LILQNSEWVEICWK+LQVGN VKLINGQ IPADLVLLASSEPH MSYIETSNLDGETNLKMRQGLPRTC ILTITDL+K+ GHI CEVPNRHLYEF GNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTT PLK+SSVER  NRYIL   G+L+FLTL T+IAN++ TNA KD AWYLGF+           NFL   I Y++IIPIS+ V +E+ R  Q+ FIN DIEMYDPDTNTPANARTSNLNEELGQ+RYIFSDKTGTLTRN+MEFKQCSIGGIIYGKG  +T S QKD NLLEKLKYGDSEVDMFFKALAVCHTVVP+KEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKI INNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLS ASKNGKLTLDNL+EFAKIGLRTLCIAYAEIDSN+YEKWK EF EASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGEN+GKENDIGLVV+GDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNR+ KLILYSFYKNVCFF+IQFWFA  S FSGQIIFERWSI FYNVIFTAAPPLALG+FDRSCS++  LKYP+LYREIQ SSTFDLKVFLTWIL S++HS ILFWL V  NNHDI FRNGQTGSL +LGNCIY YVVVTVS+KAGLE   WTW SHLAI GSVVAWFVYFIIYSHLFQL GLS SMALMYQAVFSSGTFWLGLILIPS AL  DI  KA+  T FESLR+ VM+ EKR     KIIPIDIKRK+ NPFRSR AKLGGPTT TIVDDNNR         GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK
Sbjct:   11 MPNDKKPVPDNTDAPGYKTMTPQHSDEESKDTSNSQRIVNINHPQLVKYCINKISASKYNFLTFMPKFLFEQFRKYGNLYFLLIVILQALIQFPNVSPTGRYTTAVPLFFILTLSAIKEIVEDYKRHKADDSTNNSKLLILQNSEWVEICWKKLQVGNIVKLINGQKIPADLVLLASSEPHAMSYIETSNLDGETNLKMRQGLPRTCHILTITDLVKIRGHIECEVPNRHLYEFYGNLALDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTAPLKKSSVERKMNRYILVTFGILVFLTLVTTIANMISTNAIKDIAWYLGFEGSNFG-----LNFLENFITYHSIIPISVSVQLEMARFGQSHFINEDIEMYDPDTNTPANARTSNLNEELGQIRYIFSDKTGTLTRNIMEFKQCSIGGIIYGKGAGDTLSVQKDTNLLEKLKYGDSEVDMFFKALAVCHTVVPDKEDNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKILINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVLFTKGADNVIYERLSPASKNGKLTLDNLKEFAKIGLRTLCIAYAEIDSNKYEKWKKEFLEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKTRTQLIEVRQGFGENLGKENDIGLVVNGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRIAKLILYSFYKNVCFFMIQFWFATESSFSGQIIFERWSIAFYNVIFTAAPPLALGIFDRSCSSKILLKYPRLYREIQHSSTFDLKVFLTWILYSIFHSAILFWLPVYINNHDILFRNGQTGSLFYLGNCIYAYVVVTVSLKAGLELRVWTWPSHLAISGSVVAWFVYFIIYSHLFQLTGLSVSMALMYQAVFSSGTFWLGLILIPSVALCLDIVCKAINITPFESLRKIVMEREKR-----KIIPIDIKRKYYNPFRSRYAKLGGPTTLTIVDDNNR---------GYAFSQEEHGVVSQSQLIREYNSTIKKPEGNK 1150          
The following BLAST results are available for this feature:
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP8A10.000e+053.20ATPase phospholipid transporting 8A1 [Source:HGNC ... [more]
ATP8A10.000e+053.66ATPase phospholipid transporting 8A1 [Source:HGNC ... [more]
ATP8A20.000e+055.37ATPase phospholipid transporting 8A2 [Source:HGNC ... [more]
ATP8B40.000e+040.75ATPase phospholipid transporting 8B4 (putative) [S... [more]
ATP8B40.000e+040.75ATPase phospholipid transporting 8B4 (putative) [S... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tat-10.000e+047.37Phospholipid-transporting ATPase tat-1 [Source:Un... [more]
tat-10.000e+047.37Phospholipid-transporting ATPase tat-1 [Source:Un... [more]
tat-10.000e+047.64Phospholipid-transporting ATPase tat-1 [Source:Un... [more]
tat-10.000e+047.64Phospholipid-transporting ATPase tat-1 [Source:Un... [more]
tat-10.000e+049.28Phospholipid-transporting ATPase tat-1 [Source:Un... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP8A0.000e+053.57gene:FBgn0259221 transcript:FBtr0299755[more]
ATP8A0.000e+053.57gene:FBgn0259221 transcript:FBtr0299761[more]
ATP8A0.000e+053.57gene:FBgn0259221 transcript:FBtr0299754[more]
ATP8A0.000e+053.57gene:FBgn0259221 transcript:FBtr0299763[more]
ATP8A0.000e+053.57gene:FBgn0259221 transcript:FBtr0299762[more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp8a20.000e+054.12ATPase phospholipid transporting 8A2 [Source:ZFIN;... [more]
atp8a20.000e+052.97ATPase phospholipid transporting 8A2 [Source:ZFIN;... [more]
atp8a20.000e+052.97ATPase phospholipid transporting 8A2 [Source:ZFIN;... [more]
atp8a20.000e+052.97ATPase phospholipid transporting 8A2 [Source:ZFIN;... [more]
atp8a20.000e+052.97ATPase phospholipid transporting 8A2 [Source:ZFIN;... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP8A20.000e+054.94ATPase, aminophospholipid transporter, class I, ty... [more]
ATP8A20.000e+054.94ATPase, aminophospholipid transporter, class I, ty... [more]
ATP8A10.000e+054.04ATPase, aminophospholipid transporter (APLT), clas... [more]
ATP8A20.000e+055.09ATPase, aminophospholipid transporter, class I, ty... [more]
ATP8A20.000e+055.33ATPase, aminophospholipid transporter, class I, ty... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp8a10.000e+053.80ATPase, aminophospholipid transporter (APLT), clas... [more]
Atp8a10.000e+054.10ATPase, aminophospholipid transporter (APLT), clas... [more]
Atp8a10.000e+053.71ATPase, aminophospholipid transporter (APLT), clas... [more]
Atp8a20.000e+055.08ATPase, aminophospholipid transporter-like, class ... [more]
Atp8b20.000e+040.24ATPase, class I, type 8B, member 2 [Source:MGI Sym... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70704|AT8A1_MOUSE0.000e+053.80Phospholipid-transporting ATPase IA OS=Mus musculu... [more]
sp|Q9Y2Q0|AT8A1_HUMAN0.000e+053.20Phospholipid-transporting ATPase IA OS=Homo sapien... [more]
sp|P98200|AT8A2_MOUSE0.000e+055.08Phospholipid-transporting ATPase IB OS=Mus musculu... [more]
sp|Q29449|AT8A1_BOVIN0.000e+053.75Probable phospholipid-transporting ATPase IA OS=Bo... [more]
sp|Q9NTI2|AT8A2_HUMAN0.000e+055.37Phospholipid-transporting ATPase IB OS=Homo sapien... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LX990.000e+060.54Phospholipid-transporting ATPase OS=Opisthorchis f... [more]
A0A4S2LXA20.000e+060.09Phospholipid-transporting ATPase OS=Opisthorchis f... [more]
A0A4S2LXA00.000e+060.37Phospholipid-transporting ATPase OS=Opisthorchis f... [more]
A0A5K4EJ870.000e+061.05Phospholipid-transporting ATPase OS=Schistosoma ma... [more]
A0A210QR000.000e+059.46Phospholipid-transporting ATPase OS=Mizuhopecten y... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP8A10.000e+053.70ATPase phospholipid transporting 8A1 [Source:NCBI ... [more]
ATP8A10.000e+053.08ATPase phospholipid transporting 8A1 [Source:NCBI ... [more]
ATP8A10.000e+055.32ATPase phospholipid transporting 8A1 [Source:NCBI ... [more]
atp8a20.000e+053.21ATPase phospholipid transporting 8A2 [Source:ZFIN;... [more]
ATP8A10.000e+054.18ATPase phospholipid transporting 8A1 [Source:NCBI ... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp8b10.000e+039.77ATPase phospholipid transporting 8B1 [Source:ZFIN;... [more]
atp8b40.000e+038.72ATPase phospholipid transporting 8B4 [Source:ZFIN;... [more]
ATP8A10.000e+056.34ATPase phospholipid transporting 8A1 [Source:HGNC ... [more]
ATP8A10.000e+042.06ATPase phospholipid transporting 8A1 [Source:HGNC ... [more]
atp10a1.399e-12436.58ATPase phospholipid transporting 10A [Source:ZFIN;... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DRS20.000e+043.84Trans-golgi network aminophospholipid translocase ... [more]
DNF18.505e-1537.85Aminophospholipid translocase (flippase); type 4 P... [more]
DNF27.818e-1336.00Aminophospholipid translocase (flippase); type 4 P... [more]
NEO11.815e-13232.66Phospholipid translocase (flippase), role in phosp... [more]
DNF34.000e-8635.04Trans-golgi network aminophospholipid translocase ... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360120.000e+053.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422740.000e+041.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379030.000e+038.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407894.624e-13541.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379043.093e-5440.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp8a10.000e+053.12ATPase phospholipid transporting 8A1 [Source:NCBI ... [more]
atp8a20.000e+053.23ATPase phospholipid transporting 8A2 [Source:NCBI ... [more]
atp8a20.000e+053.37ATPase phospholipid transporting 8A2 [Source:NCBI ... [more]
atp8a10.000e+053.29ATPase phospholipid transporting 8A1 [Source:NCBI ... [more]
atp8a20.000e+051.89ATPase phospholipid transporting 8A2 [Source:NCBI ... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026251.10.000e+086.51SMESG000026251.1[more]
SMESG000026251.10.000e+086.51SMESG000026251.1[more]
SMESG000026251.10.000e+086.51SMESG000026251.1[more]
SMESG000026251.10.000e+086.51SMESG000026251.1[more]
SMESG000026251.10.000e+086.28SMESG000026251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009405 ID=SMED30009405|Name=Phospholipid-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=3658bp
AATTAATACATACTTTTGAAAATTTTTCCTTTTTGATTAGTGATGTCAAA
TGATAAGGCACCAGTTCCGGATAATACAGATGCTCCAGGTTATAAAACAA
TGACACAGCATAGTGTTGAGGAGTTAAAAGAAACAACTTCTCAGCGAATT
GTAAATATAAACCATCCTCAACCCGTTAAATATTGCCTAAATAAAATAAG
TACGGCCAAATATAATTTTCTAACATTTATGCCAAAATTTCTATTTGAAC
AATTCAGAAGATATGCGAATATATTTTTCCTACTGATTGCAATATTACAA
CAATTTCCAAACGTTTCCCCAACCGGAAGGTATACGACCGCAGTTCCGTT
ATTCATCATTCTCACCATATCTGCTATCAAGGAAATTGTTGAGGATTATA
AACGGCATAAAGCAGACGATTCAACAAATAATAGCAAAATACTCATACTG
CAAAACAGCGAATGGGTTGAGATTTGTTGGAAGCAATTACAAGTTGGGAA
TTTTGTTAAATTGATAAATGGACAAGGAATTCCTGCTGATTTGGTTCTGC
TTGCGTCCAGTGAACCGCACGGCATGAGTTACATTGAAACTTCGAATCTA
GACGGTGAAACTAACTTGAAAATGCGACAGGGCCTTCCGAGAACCTGTGA
TATTTTAACAATAACTGACCTTATGAAAATGCACGGTCACATAGCTTGCG
AGGTTCCCAATCGACATTTGTATGAATTTTGTGGCAATTTGGCATTGGAT
GGGGAGAAGAAAATCTCCCTGGGAAATGACCAGTTGCTATTACGGGGCGC
CACCTTGAAAAATACGAAATGGGTGTTTGGGATTGTTGTCTACAGCGGCC
ATGAAACAAAGGTCATGCTCAACAGCACGACGCCGCCATTGAAAAGGTCA
TCTGTGGAACGAATGACAAATAGATATATTTTAGGGTTATGCGGGCTTTT
GCTATTCCTGACTTTAGCAACATCTATTGCCAATGTGGTCTGGACAAACG
CCAATAAGGATACAGCATGGTATCTTGGGTTTGACAGAAAACCTATAAGT
CACTGGGAAAGATTTTTCAATTTCTTGACCTTTCTCATCCTCTATAACAC
GATCATTCCTATTAGTTTGCCTGTTACAATGGAGGTCGTGCGAACCTTTC
AAACGTTTTTCATAAATTGGGACATTGAAATGTATGATCCTGATACAAAT
ACCCCTGCAAACGCCAGAACATCTAATCTCAATGAAGAACTAGGACAGGT
AAGATATATATTCTCGGACAAAACCGGCACACTGACAAGAAATGTCATGG
AATTCAAACAGTGCTCTATTGGAGGAATCATATATGGTAAAGGGCCAGAT
GAGACATTTTCAGCACAGAAAGACCCAAATTTATTGGAAAAACTAAAATA
CGGTGATTCTGAAGTAGATATGTTTTTCAAAGCATTGGCAGTTTGCCATA
CAGTCGTTCCAGAGAAAGAAGATAATGAAATAATATACCAAGCTTCTAGT
CCAGACGAATCAGCTCTCGTGAAAGCAGCGAAAGAAATGGGATATATATT
TCACACCAGAACGCCGGACGGAATTAAGATTTCGATAAACAACGAAAATT
ATGAGTATAAAGTGTTGAATGTTCTCGAGTTTACAAGTTTACGCAAGCGG
ATGTCCGTCATTGTTAAAACTCCAGATTCGAAAATAGTTCTTTTTACTAA
AGGAGCCGATAATGTAATTTATGAACGTCTTTCAACGGCTTCCAAAAATG
GAAAACTTACCCTTGACAACTTGGAGGAATTTGCAAAAATTGGTTTACGA
ACTTTATGCATCGCATATGCAGAAATTGATTCTAATGAATATGAGAAATG
GAAGGGAGAATTCCATGAAGCGAGTGTTTCTATTGAAAACCGAGAAAATA
AATTGGCTGCAGTTGCGGAAAAGATTGAAAAAAATTTAATATTGATCGGT
GCTTCTGCAATTGAGGATAAGCTCCAAGACCAAGTGCCAGAGACTATATC
AAATCTTGCAAAAGCCGGCATCAAAATATGGGTTCTCACCGGAGATAAAC
AAGAAACTGCAGTCAATATCGGCTATTCCTGTCAATTGCTGACACAAAAT
ATGAGTCTCTGTATTCTGGATTCAGATTCACTTGACAAAACCCGAACGCA
ATTAATTGAGGTCAGGCAAGGGTTTGGAGAAAATATTGGAAAGGAAAATG
ATATTGGGCTCGTTGTCAGTGGAGATACTCTCAAATTCGCATTAGACTTT
CAATGTCGCGATGATTTCCTTCAAATTGCATTATCATGCAAGGCTGTCAT
TTGCTGCAGAGTAAGCCCTTCTCAAAAAGCTGAAGTTGTAACACTGGTGA
AATCCAATATTAAAGATGCAATAACACTAGCAATAGGAGATGGTGCTAAT
GACGTAGGAATGATACAGGCGGCGCATGTAGGCATTGGTATCAGCGGCTT
GGAAGGCCAACAAGCAGCATGCAATTCCGACTATGCTATCGCACAATTTA
GATTTCTTAATCGTCTTTTACTGGTTCACGGAGCTTGGAATTACAATCGG
CTTACAAAGCTTATTCTTTATTCATTTTATAAAAACGTATGCTTCTTTGT
GATACAGTTTTGGTTTGCAATTGTAAGTGGATTTTCTGGTCAAATTATTT
TCGAGCGCTGGTCGATCGGATTTTACAATGTGATATTTACCGCTGCCCCT
CCTTTAGCTTTGGGATTATTTGATCGAAGCTGTAGCGCGGAAAATTCATT
AAAATATCCTCAACTCTACCGAGAAATTCAACAGAGCTCCACTTTCGATC
TCAAAGTGTTTCTCACATGGATTCTCAATTCCTTATATCATTCTCTGATT
CTATTTTGGTTGACAGTTTTGGCTAATAATCACGATATCCCTTTCAGAAA
TGGTCAAACGGGAAGCTTGTTGTTCTTAGGAAACTGTATTTATACGTACG
TTGTTGTTACTGTGTCAGTGAAGGCAGGCCTGGAGCACATAGCTTGGACA
TGGCTCTCACATCTAGCTATATGGGGCAGTGTTGTGGCGTGGTTTGTCTA
TTTCATAATCTACTCACATCTGTTCCAATTAGTCGGATTATCAGCTAGCA
TGGCTCTAATGTATCAAGCTGTATTCAGTAGTGGAACATTCTGGCTCGGT
CTGATTTTAATTCCTTCAGCTGCTCTAACCCGTGATATCGCCTGGAAAGC
TGTAAAAAGAACGCTATTTGAATCGCTCCGGGAGCGTGTAATGCAAATGG
AAAAAAGAAATCAGGACCCGGGGAAAATTATTCCTATTGACATCAAAAGA
AAATTTTGCAATCCTTTCCGTTCCCGAGATGCTAAACTTGGCGGACCAAC
AACACCAACAATCGTGGATGATAATAATCGATTTAACCACAGGCCGCGCG
TCTCAAGTGGCTACGCATTTTCCCAGGAGGAGCACGGCGTGGTTAGCCAA
TCACAATTGATACGCGAGTACAACTCAACGATAAAGAAGCCCGAAGGAAA
TAAATAGCCAATGAATGAATATTATTATTATTATTATTATCGGCAACAAA
CCTTACCAGATACACAATTGTAATTATGCGATCTATTTTCCGCCCTCCTC
ACGGGCAATATCCTTCTTTTTGTTGATTTTAACTACAGTTGAAATTATAT
GATGTTTT
back to top

protein sequence of SMED30009405-orf-1

>SMED30009405-orf-1 ID=SMED30009405-orf-1|Name=SMED30009405-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1155bp
MSNDKAPVPDNTDAPGYKTMTQHSVEELKETTSQRIVNINHPQPVKYCLN
KISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTA
VPLFIILTISAIKEIVEDYKRHKADDSTNNSKILILQNSEWVEICWKQLQ
VGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPR
TCDILTITDLMKMHGHIACEVPNRHLYEFCGNLALDGEKKISLGNDQLLL
RGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYILGLC
GLLLFLTLATSIANVVWTNANKDTAWYLGFDRKPISHWERFFNFLTFLIL
YNTIIPISLPVTMEVVRTFQTFFINWDIEMYDPDTNTPANARTSNLNEEL
GQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKDPNLLEK
LKYGDSEVDMFFKALAVCHTVVPEKEDNEIIYQASSPDESALVKAAKEMG
YIFHTRTPDGIKISINNENYEYKVLNVLEFTSLRKRMSVIVKTPDSKIVL
FTKGADNVIYERLSTASKNGKLTLDNLEEFAKIGLRTLCIAYAEIDSNEY
EKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPE
TISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDSDSLDKT
RTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCK
AVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGI
SGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVC
FFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAE
NSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHDIP
FRNGQTGSLLFLGNCIYTYVVVTVSVKAGLEHIAWTWLSHLAIWGSVVAW
FVYFIIYSHLFQLVGLSASMALMYQAVFSSGTFWLGLILIPSAALTRDIA
WKAVKRTLFESLRERVMQMEKRNQDPGKIIPIDIKRKFCNPFRSRDAKLG
GPTTPTIVDDNNRFNHRPRVSSGYAFSQEEHGVVSQSQLIREYNSTIKKP
EGNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR032631P-type_ATPase_N
IPR023299ATPase_P-typ_cyto_dom_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023214HAD_sf
IPR032630P_typ_ATPase_c
IPR018303ATPase_P-typ_P_site
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0046872metal ion binding
GO:0000287magnesium ion binding
GO:0004012phospholipid-translocating ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0015914phospholipid transport
GO:0045332phospholipid translocation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane