Nephrin

Overview
NameNephrin
Smed IDSMED30009392
Length (bp)1673
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009392

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009392SMESG000021277.1 SmedASXL_018902SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009392SMESG000021277.1 SmedASXL_000300SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30009392SMESG000021277.1 dd_Smed_v4_16056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009392SMESG000021277.1 dd_Smed_v4_16056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30009392SMESG000021277.1 dd_Smed_v4_16056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009392SMESG000021277.1 dd_Smed_v4_16056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009392SMESG000021277.1 dd_Smed_v6_16056_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009392SMESG000021277.1 OX_Smed_1.0.10682ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nephrin vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 102.064 bits (253), Expect = 6.651e-22
Identity = 90/400 (22.50%), Postives = 173/400 (43.25%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEG---SPIPYSRALRVQDNSL---TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIG-PDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMST-----LHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP+ +++ W   G   SP    R   +   +L    + R+D  +   Y L  +N  GT     RL+V +   +    D  +++V        ++C   +NP          +L   +NW  L ++ ++                          S+ ++E +S      L I +   +  G YQC+V+N +   A ++L L V     +       +  + G+   SA L C   G P     W ++   L L   +  ++   +   G+++S+LT+ N    QDY  + C A+N +GS    I+L S ++PD P  ++VV++T   + +EW+ GF+GG  Q F + ++++   +   H V +V     +   + +  L  ST+Y + + + + +  S
Sbjct:  671 SANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGL---YQLHCQNSEGTAEARLRLDVHYAPTIRALQDPTEVNVG---GSVDIVCTVDANP----------ILPGMFNWERLGEDEEDQ-------------------------SLDDMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQ--GGVHSSLLTIANVSAAQDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLPQRFCIRYEALG--TPGFHYVDVVP---PQATTFTLTGLQPSTRYRVWLLASNALGDS 1022          
BLAST of Nephrin vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 102.064 bits (253), Expect = 7.307e-22
Identity = 90/400 (22.50%), Postives = 173/400 (43.25%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEG---SPIPYSRALRVQDNSL---TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIG-PDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMST-----LHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP+ +++ W   G   SP    R   +   +L    + R+D  +   Y L  +N  GT     RL+V +   +    D  +++V        ++C   +NP          +L   +NW  L ++ ++                          S+ ++E +S      L I +   +  G YQC+V+N +   A ++L L V     +       +  + G+   SA L C   G P     W ++   L L   +  ++   +   G+++S+LT+ N    QDY  + C A+N +GS    I+L S ++PD P  ++VV++T   + +EW+ GF+GG  Q F + ++++   +   H V +V     +   + +  L  ST+Y + + + + +  S
Sbjct:  671 SANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGL---YQLHCQNSEGTAEARLRLDVHYAPTIRALQDPTEVNVG---GSVDIVCTVDANP----------ILPGMFNWERLGEDEEDQ-------------------------SLDDMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQ--GGVHSSLLTIANVSAAQDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLPQRFCIRYEALG--TPGFHYVDVVP---PQATTFTLTGLQPSTRYRVWLLASNALGDS 1022          
BLAST of Nephrin vs. Ensembl Human
Match: IGSF9 (immunoglobulin superfamily member 9 [Source:HGNC Symbol;Acc:HGNC:18132])

HSP 1 Score: 62.7734 bits (151), Expect = 1.354e-9
Identity = 56/220 (25.45%), Postives = 96/220 (43.64%), Query Frame = 1
Query:  553 MGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-----STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHS--VQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            +G Y C   N++ +A    +   +       I R ++    E+G+   + C   G P P V W +    L      + Q DS        NS L +  + K+ + ++ C ASN    A AR+  S+      T P +  N+ VV +  K   V WE GF+GG+ Q F V +  +++    +H   V L   +    L+  +  L   TQY+  + +++K+
Sbjct:  390 LGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQ----GQAQVDS--------NSSLILRPLTKEAHGHWECSASN----AVARVATSTNVYVLGTSPHVVTNVSVVALP-KGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHDWVSLAVPVGAAHLL--VPGLQPHTQYQFSVLAQNKL 590          
BLAST of Nephrin vs. Ensembl Human
Match: IGSF9 (immunoglobulin superfamily member 9 [Source:HGNC Symbol;Acc:HGNC:18132])

HSP 1 Score: 62.7734 bits (151), Expect = 1.458e-9
Identity = 56/220 (25.45%), Postives = 96/220 (43.64%), Query Frame = 1
Query:  553 MGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-----STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHS--VQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            +G Y C   N++ +A    +   +       I R ++    E+G+   + C   G P P V W +    L      + Q DS        NS L +  + K+ + ++ C ASN    A AR+  S+      T P +  N+ VV +  K   V WE GF+GG+ Q F V +  +++    +H   V L   +    L+  +  L   TQY+  + +++K+
Sbjct:  374 LGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVGRELLIPCSAQGDPPPVVSWTKVGRGLQ----GQAQVDS--------NSSLILRPLTKEAHGHWECSASN----AVARVATSTNVYVLGTSPHVVTNVSVVALP-KGANVSWEPGFDGGYLQRFSVWYTPLAKRPDRMHHDWVSLAVPVGAAHLL--VPGLQPHTQYQFSVLAQNKL 574          
BLAST of Nephrin vs. Ensembl Human
Match: DSCAM (DS cell adhesion molecule [Source:HGNC Symbol;Acc:HGNC:3039])

HSP 1 Score: 62.3882 bits (150), Expect = 2.033e-9
Identity = 83/388 (21.39%), Postives = 159/388 (40.98%), Query Frame = 1
Query:   76 WLSEGSPIPYSRALRVQ--DNSLTIIRSDVDMMRN--YTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMS--TLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDI-HSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            W  +G PIP S  + +   D + ++  S++ +M N  YT IARNE        +L V    + +        V+P +      K   L C A+  P  +   ++W+              +   +     I  NG                  I+++S  +L I ++V  D G Y C V+N + +   K + L V + A  +I+     +    GQ  ++ C   G  KP ++ +     +      ++   ++ +G  + +++  +  + ++D   + C A N  G     I+L+    PD P  I + ++  + I + W  GF+G      I  +    +  SD   S Q  +++  +     I D+  S+ Y IR+ +K++I +S
Sbjct:  465 WQKDGRPIPGSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFV--------VQPRDQDGIYGKAVILNCSAEGYPVPT---IVWKF------------SKGAGVPQFQPIALNG-----------------RIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPA--MITSYPNTTLATQGQKKEMSCTAHGE-KPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTV-REDSGFFSCHAINSYGEDRGIIQLTVQEPPDPP-EIEIKDVKARTITLRWTMGFDG---NSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKS 804          
BLAST of Nephrin vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 82.8037 bits (203), Expect = 2.455e-16
Identity = 84/339 (24.78%), Postives = 136/339 (40.12%), Query Frame = 1
Query:   52 NPSVQSYQWLSEGSPIPYSRALRVQDNSL----TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYF-CQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            NP++  +QW   G P  ++        ++     ++ +D  +   YTL A N +G+ + T +L V + AR+    +  I+   D     L C+A   P  S+  +I        +W   YK              NG+     A++R    ++  +         N      G Y C  +N I   A     L V     ++   R   + G LG  AK  C V+  P  + +W +D   L   +  K+   + ++    Y S L +  I   DY     C A N  G+    I +   T PD PFN+ + N T   I+V WE  F+GG +Q F V ++
Sbjct:  167 NPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGV---YTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDT--VLLECEADGEP--SKANMI--------HW---YK--------------NGEILA--AQHRGHKKAILRL---------NATEQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKVYAVPTVEFVWEKD-EQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYR 461          
BLAST of Nephrin vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 82.4185 bits (202), Expect = 2.785e-16
Identity = 84/339 (24.78%), Postives = 136/339 (40.12%), Query Frame = 1
Query:   52 NPSVQSYQWLSEGSPIPYSRALRVQDNSL----TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYF-CQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            NP++  +QW   G P  ++        ++     ++ +D  +   YTL A N +G+ + T +L V + AR+    +  I+   D     L C+A   P  S+  +I        +W   YK              NG+     A++R    ++  +         N      G Y C  +N I   A     L V     ++   R   + G LG  AK  C V+  P  + +W +D   L   +  K+   + ++    Y S L +  I   DY     C A N  G+    I +   T PD PFN+ + N T   I+V WE  F+GG +Q F V ++
Sbjct:  196 NPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGV---YTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDT--VLLECEADGEP--SKANMI--------HW---YK--------------NGEILA--AQHRGHKKAILRL---------NATEQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKVYAVPTVEFVWEKD-EQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYR 490          
BLAST of Nephrin vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 82.8037 bits (203), Expect = 2.793e-16
Identity = 84/339 (24.78%), Postives = 136/339 (40.12%), Query Frame = 1
Query:   52 NPSVQSYQWLSEGSPIPYSRALRVQDNSL----TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYF-CQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            NP++  +QW   G P  ++        ++     ++ +D  +   YTL A N +G+ + T +L V + AR+    +  I+   D     L C+A   P  S+  +I        +W   YK              NG+     A++R    ++  +         N      G Y C  +N I   A     L V     ++   R   + G LG  AK  C V+  P  + +W +D   L   +  K+   + ++    Y S L +  I   DY     C A N  G+    I +   T PD PFN+ + N T   I+V WE  F+GG +Q F V ++
Sbjct:  677 NPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGV---YTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDT--VLLECEADGEP--SKANMI--------HW---YK--------------NGEILA--AQHRGHKKAILRL---------NATEQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKVYAVPTVEFVWEKD-EQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYR 971          
BLAST of Nephrin vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 82.8037 bits (203), Expect = 3.115e-16
Identity = 84/339 (24.78%), Postives = 136/339 (40.12%), Query Frame = 1
Query:   52 NPSVQSYQWLSEGSPIPYSRALRVQDNSL----TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYF-CQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            NP++  +QW   G P  ++        ++     ++ +D  +   YTL A N +G+ + T +L V + AR+    +  I+   D     L C+A   P  S+  +I        +W   YK              NG+     A++R    ++  +         N      G Y C  +N I   A     L V     ++   R   + G LG  AK  C V+  P  + +W +D   L   +  K+   + ++    Y S L +  I   DY     C A N  G+    I +   T PD PFN+ + N T   I+V WE  F+GG +Q F V ++
Sbjct:  664 NPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGV---YTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDT--VLLECEADGEP--SKANMI--------HW---YK--------------NGEILA--AQHRGHKKAILRL---------NATEQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKVYAVPTVEFVWEKD-EQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYR 958          
BLAST of Nephrin vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 82.4185 bits (202), Expect = 3.160e-16
Identity = 84/339 (24.78%), Postives = 136/339 (40.12%), Query Frame = 1
Query:   52 NPSVQSYQWLSEGSPIPYSRALRVQDNSL----TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYF-CQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            NP++  +QW   G P  ++        ++     ++ +D  +   YTL A N +G+ + T +L V + AR+    +  I+   D     L C+A   P  S+  +I        +W   YK              NG+     A++R    ++  +         N      G Y C  +N I   A     L V     ++   R   + G LG  AK  C V+  P  + +W +D   L   +  K+   + ++    Y S L +  I   DY     C A N  G+    I +   T PD PFN+ + N T   I+V WE  F+GG +Q F V ++
Sbjct:  362 NPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGV---YTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDT--VLLECEADGEP--SKANMI--------HW---YK--------------NGEILA--AQHRGHKKAILRL---------NATEQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKVYAVPTVEFVWEKD-EQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYR 656          
BLAST of Nephrin vs. Ensembl Fly
Match: sns (gene:FBgn0024189 transcript:FBtr0088635)

HSP 1 Score: 123.635 bits (309), Expect = 3.890e-29
Identity = 87/352 (24.72%), Postives = 157/352 (44.60%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRV--QDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSR 1065
            G+ + + L   +NP+  +Y+W  +G+ IP     R+     SL   R   D    Y+  A N  G  +    + V +G   I   SE+I V P E +A L C  +  P  ++  V W+        R+ Y    ++   + +   NG                      S LHI +    D+G ++C+ +N +++   + + L V     I  +     +    G+  +L C   G PKP+ IW +D  +L +    K++ +  ++ S  Y S L V+ +   DY  Y C A N++G A   +RL  +++PD P ++ ++N+T+  + + W  GF+GG +  + V ++   R
Sbjct:  693 GESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGT-TIKSVSENIVVNPGE-DAMLSCTVEGKPL-TEEHVKWE--------RVGY----DMTVKTSTTFANG---------------------TSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRYRMADR 1008          
BLAST of Nephrin vs. Ensembl Fly
Match: sns (gene:FBgn0024189 transcript:FBtr0339277)

HSP 1 Score: 123.635 bits (309), Expect = 4.467e-29
Identity = 87/352 (24.72%), Postives = 157/352 (44.60%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRV--QDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSR 1065
            G+ + + L   +NP+  +Y+W  +G+ IP     R+     SL   R   D    Y+  A N  G  +    + V +G   I   SE+I V P E +A L C  +  P  ++  V W+        R+ Y    ++   + +   NG                      S LHI +    D+G ++C+ +N +++   + + L V     I  +     +    G+  +L C   G PKP+ IW +D  +L +    K++ +  ++ S  Y S L V+ +   DY  Y C A N++G A   +RL  +++PD P ++ ++N+T+  + + W  GF+GG +  + V ++   R
Sbjct:  693 GESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGT-TIKSVSENIVVNPGE-DAMLSCTVEGKPL-TEEHVKWE--------RVGY----DMTVKTSTTFANG---------------------TSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRYRMADR 1008          
BLAST of Nephrin vs. Ensembl Fly
Match: sns (gene:FBgn0024189 transcript:FBtr0111043)

HSP 1 Score: 123.25 bits (308), Expect = 5.083e-29
Identity = 87/352 (24.72%), Postives = 157/352 (44.60%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRV--QDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSR 1065
            G+ + + L   +NP+  +Y+W  +G+ IP     R+     SL   R   D    Y+  A N  G  +    + V +G   I   SE+I V P E +A L C  +  P  ++  V W+        R+ Y    ++   + +   NG                      S LHI +    D+G ++C+ +N +++   + + L V     I  +     +    G+  +L C   G PKP+ IW +D  +L +    K++ +  ++ S  Y S L V+ +   DY  Y C A N++G A   +RL  +++PD P ++ ++N+T+  + + W  GF+GG +  + V ++   R
Sbjct:  693 GESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGIYSCSASNSQGGATLNITVVVEYGT-TIKSVSENIVVNPGE-DAMLSCTVEGKPL-TEEHVKWE--------RVGY----DMTVKTSTTFANG---------------------TSYLHIKDAKREDVGNFRCVADNRVDNPTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRYRMADR 1008          
BLAST of Nephrin vs. Ensembl Fly
Match: fred (gene:FBgn0051774 transcript:FBtr0308126)

HSP 1 Score: 100.138 bits (248), Expect = 1.259e-21
Identity = 89/354 (25.14%), Postives = 157/354 (44.35%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSE-GSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSF-TFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWY--RDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGF-EQEFIVSWKSVS 1062
            G  +T   NP   P V  Y+W  +    I  ++ +  Q    +I ++ +     Y   A NE+G G   T  L V    + +    + ++ +  + +  + C A+  PT  Q R I    +     R ++  R     + G +        +  K R +     N           L+P+D G Y CL  N + SA    ++L +     IVI +  + +  +L +SA++ C V  YPKP+  W    + S LT+ S   ++  +    + +Y SIL +  ++  DY  Y C+A N + S  A IRL     P+ P N++++ + +    + W  GFNGGF   +++VS++ V+
Sbjct:  428 GVTLTCSANPPGWP-VPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVTCSAKGKPT-PQIRWIKDGTE-ILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPN----GN----------QLLPNDRGLYTCLYENDVNSANSS-MHLRIE-HEPIVIHQYNKVAY-DLRESAEVVCRVQAYPKPEFQWQYGNNPSPLTMSSDGHYEISTRMENNDVYTSILRIAHLQHSDYGEYICRAVNPLDSIRAPIRLQPKGSPEKPTNLKILEVGHNYAVLNWTPGFNGGFMSTKYLVSYRRVA 761          
BLAST of Nephrin vs. Ensembl Fly
Match: fred (gene:FBgn0051774 transcript:FBtr0308127)

HSP 1 Score: 100.138 bits (248), Expect = 1.344e-21
Identity = 89/356 (25.00%), Postives = 159/356 (44.66%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSE-GSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSF-TFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKT--YNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWY--RDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGF-EQEFIVSWKSVS 1062
            G  +T   NP   P V  Y+W  +    I  ++ +  Q    +I ++ +     Y   A NE+G G   T  L V    + +    + ++ +  + +  + C A+  PT    ++ W + D T     R ++  R     + G +        +  K R +     N           L+P+D G Y CL  N + SA    ++L +     IVI +  + +  +L +SA++ C V  YPKP+  W    + S LT+ S   ++  +    + +Y SIL +  ++  DY  Y C+A N + S  A IRL     P+ P N++++ + +    + W  GFNGGF   +++VS++ V+
Sbjct:  428 GVTLTCSANPPGWP-VPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGKYHCHAVNELGIGKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVTCSAKGKPT---PQIRW-IKDGTEILPTRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPN----GN----------QLLPNDRGLYTCLYENDVNSA-NSSMHLRI-EHEPIVIHQYNKVAY-DLRESAEVVCRVQAYPKPEFQWQYGNNPSPLTMSSDGHYEISTRMENNDVYTSILRIAHLQHSDYGEYICRAVNPLDSIRAPIRLQPKGSPEKPTNLKILEVGHNYAVLNWTPGFNGGFMSTKYLVSYRRVA 761          
BLAST of Nephrin vs. Ensembl Zebrafish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 75.8702 bits (185), Expect = 6.829e-14
Identity = 85/396 (21.46%), Postives = 152/396 (38.38%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEGSPIPYSRALR--VQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISR--RRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP   + +W+ +G  +   R  R    D +L I+        +Y +   N  G+     RL+V +        S  + +K D         A L+C A +NP  S            ++W+ + +  ++ +         G                        L I+ +     G YQC  +N I         L V     +      R+  S G+    A + C   G P+ +  W ++   L L    +++  +E  G+ ++ SILTV N     DY  + C A N +G  +  I+L S+  PD P +++++ +    + +EW  GF+GG  Q F V ++          S   V+       +Y +  L  ST Y   + + + I +S
Sbjct:  655 SANPDEITCEWIFQGEKLVKERDPRYTFSDWTLEIVNVSRRDGGDYIIECSNAEGSNRTKLRLDVQY--------SPTVRMKSDPVFVNIGDTADLLCVADANPITS----------SMFSWKWMGEGERDELGEESEDDGTG-----------------------VLTIYEVTRDRAGVYQCTADNGISPTGSVEGQLIVRFAPDLQKGPQWRKVASRGDGSNDANVVCQAQGVPRVQFRWAKNGFPLDL-GNPRYEETTESTGT-IHTSILTVINVSAALDYAIFTCTAHNSMGEDSLDIQLLSTNHPDPPSDLKLLRVDQTSVTLEWMPGFDGGLTQIFRVRYQWAGS-----ASYMYVDVFPPTATVYTVTGLNPSTMYNFSVNALNSIGES 1002          
BLAST of Nephrin vs. Ensembl Zebrafish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 75.8702 bits (185), Expect = 7.435e-14
Identity = 85/396 (21.46%), Postives = 152/396 (38.38%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEGSPIPYSRALR--VQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISR--RRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP   + +W+ +G  +   R  R    D +L I+        +Y +   N  G+     RL+V +        S  + +K D         A L+C A +NP  S            ++W+ + +  ++ +         G                        L I+ +     G YQC  +N I         L V     +      R+  S G+    A + C   G P+ +  W ++   L L    +++  +E  G+ ++ SILTV N     DY  + C A N +G  +  I+L S+  PD P +++++ +    + +EW  GF+GG  Q F V ++          S   V+       +Y +  L  ST Y   + + + I +S
Sbjct:  528 SANPDEITCEWIFQGEKLVKERDPRYTFSDWTLEIVNVSRRDGGDYIIECSNAEGSNRTKLRLDVQY--------SPTVRMKSDPVFVNIGDTADLLCVADANPITS----------SMFSWKWMGEGERDELGEESEDDGTG-----------------------VLTIYEVTRDRAGVYQCTADNGISPTGSVEGQLIVRFAPDLQKGPQWRKVASRGDGSNDANVVCQAQGVPRVQFRWAKNGFPLDL-GNPRYEETTESTGT-IHTSILTVINVSAALDYAIFTCTAHNSMGEDSLDIQLLSTNHPDPPSDLKLLRVDQTSVTLEWMPGFDGGLTQIFRVRYQWAGS-----ASYMYVDVFPPTATVYTVTGLNPSTMYNFSVNALNSIGES 875          
BLAST of Nephrin vs. Ensembl Zebrafish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 75.8702 bits (185), Expect = 7.462e-14
Identity = 85/396 (21.46%), Postives = 152/396 (38.38%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEGSPIPYSRALR--VQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISR--RRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP   + +W+ +G  +   R  R    D +L I+        +Y +   N  G+     RL+V +        S  + +K D         A L+C A +NP  S            ++W+ + +  ++ +         G                        L I+ +     G YQC  +N I         L V     +      R+  S G+    A + C   G P+ +  W ++   L L    +++  +E  G+ ++ SILTV N     DY  + C A N +G  +  I+L S+  PD P +++++ +    + +EW  GF+GG  Q F V ++          S   V+       +Y +  L  ST Y   + + + I +S
Sbjct:  700 SANPDEITCEWIFQGEKLVKERDPRYTFSDWTLEIVNVSRRDGGDYIIECSNAEGSNRTKLRLDVQY--------SPTVRMKSDPVFVNIGDTADLLCVADANPITS----------SMFSWKWMGEGERDELGEESEDDGTG-----------------------VLTIYEVTRDRAGVYQCTADNGISPTGSVEGQLIVRFAPDLQKGPQWRKVASRGDGSNDANVVCQAQGVPRVQFRWAKNGFPLDL-GNPRYEETTESTGT-IHTSILTVINVSAALDYAIFTCTAHNSMGEDSLDIQLLSTNHPDPPSDLKLLRVDQTSVTLEWMPGFDGGLTQIFRVRYQWAGS-----ASYMYVDVFPPTATVYTVTGLNPSTMYNFSVNALNSIGES 1047          
BLAST of Nephrin vs. Ensembl Zebrafish
Match: igsf10 (immunoglobulin superfamily, member 10 [Source:ZFIN;Acc:ZDB-GENE-130530-827])

HSP 1 Score: 61.2326 bits (147), Expect = 3.289e-9
Identity = 56/230 (24.35%), Postives = 103/230 (44.78%), Query Frame = 1
Query:  313 CKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGS----IQC--NGD-----YWTYLAKYRASCISVSNIEIM----STLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSG---LYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKP 942
            C A SNP G+ T  +   L       ++ +E+Q+++ +       + C  +GD     +W          ++ S+ +I      TL++ NL  S+ G+Y+C+  ++  S   +V+ L+V    TI  ++   R  +  E G    L C   G P P+++W         +  K     + R+GS    L N  L +  + ++D  ++ C A N +G  T  +++S S KP
Sbjct: 1604 CVA-SNPGGTDTATV--HLQVVATLPVILEEKQQLVKADAGQNLFLPCTTHGDPQPTTHWVLHNGVIVLPLTYSHTKISVFANGTLYLRNLDVSESGKYECIATSSTGSER-RVVTLSVKRTETIPRIVVTSRHHTDVEYGGQLHLNCSAVGNPTPEIMWR--------LPSKVLVDKTHRMGSRIKVLENGTLIIESLNEKDSGDFLCVARNKVGDDTQLMKVSVSMKP 1821          
BLAST of Nephrin vs. Ensembl Zebrafish
Match: igsf10 (immunoglobulin superfamily, member 10 [Source:ZFIN;Acc:ZDB-GENE-130530-827])

HSP 1 Score: 61.2326 bits (147), Expect = 3.330e-9
Identity = 54/226 (23.89%), Postives = 101/226 (44.69%), Query Frame = 1
Query:  325 SNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGS----IQC--NGD-----YWTYLAKYRASCISVSNIEIM----STLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSG---LYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKP 942
            SNP G+ T  +   L       ++ +E+Q+++ +       + C  +GD     +W          ++ S+ +I      TL++ NL  S+ G+Y+C+  ++  S   +V+ L+V    TI  ++   R  +  E G    L C   G P P+++W         +  K     + R+GS    L N  L +  + ++D  ++ C A N +G  T  +++S S KP
Sbjct: 1695 SNPGGTDTATV--HLQVVATLPVILEEKQQLVKADAGQNLFLPCTTHGDPQPTTHWVLHNGVIVLPLTYSHTKISVFANGTLYLRNLDVSESGKYECIATSSTGSER-RVVTLSVKRTETIPRIVVTSRHHTDVEYGGQLHLNCSAVGNPTPEIMWR--------LPSKVLVDKTHRMGSRIKVLENGTLIIESLNEKDSGDFLCVARNKVGDDTQLMKVSVSMKP 1909          
BLAST of Nephrin vs. Ensembl Xenopus
Match: zcchc8 (zinc finger CCHC-type containing 8 [Source:Xenbase;Acc:XB-GENE-977402])

HSP 1 Score: 65.855 bits (159), Expect = 1.001e-10
Identity = 87/375 (23.20%), Postives = 142/375 (37.87%), Query Frame = 1
Query:  115 LRVQ---DNSLTIIRSDVDMMRNYTLIARNEIG-TGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQM------LDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTI----ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLL-SSTQYEIRICSKSKI 1191
            LRV+   D +L I R   +    YT +  N +G + S +  L V + AR++  +   +   P      + C  ++ P    T V W        +DK   W+LL                                         T+H+       +G Y C+  N +    +S   ++L  + P    +     RQ +G EL     + C   G P P + W            +K    S    S L +  L    + K+D+  + C ASN + S TA   L+   T P  P N+RVV ++     V WE G++GGFEQ F V +    RF         V   +     +++ D L   T+Y+  + +++K+
Sbjct:  259 LRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVV--NMPPVIYVPVGIHGHIRCPVEAVP--PVTFVKWNKDGRPLRIDKFSGWKLLDD--------------------------------------GTIHVEEATEELLGTYTCVPYNALGTMGQSPPARLLLKDPPYFTVLPGWEYRQEAGREL----LIPCAAAGDPFPSISW------------RKVGRPSFSKHSVLPSGSLQFRSLSKEDHGEWECVASNVVTSITASAHLTVIGTSPHAPSNVRVV-VSMNTANVSWEAGYDGGFEQTFSVWYGKSDRFGPH----DWVSMPVPSGSSFLLVDSLDPETEYQFSVLAQNKL 570          
BLAST of Nephrin vs. Ensembl Xenopus
Match: zcchc8 (zinc finger CCHC-type containing 8 [Source:Xenbase;Acc:XB-GENE-977402])

HSP 1 Score: 66.2402 bits (160), Expect = 1.068e-10
Identity = 86/374 (22.99%), Postives = 140/374 (37.43%), Query Frame = 1
Query:  115 LRVQ---DNSLTIIRSDVDMMRNYTLIARNEIG-TGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQM------LDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTI----ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            LRV+   D +L I R   +    YT +  N +G + S +  L V + AR++  +   +   P      + C  ++ P    T V W        +DK   W+LL                                         T+H+       +G Y C+  N +    +S   ++L  + P    +     RQ +G EL     + C   G P P + W            +K    S    S L +  L    + K+D+  + C ASN + S TA   L+   T P  P N+RVV ++     V WE G++GGFEQ F V  K       D  S+ +           ++  L   T+Y+  + +++K+
Sbjct:  267 LRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVV--NMPPVIYVPVGIHGHIRCPVEAVP--PVTFVKWNKDGRPLRIDKFSGWKLLDD--------------------------------------GTIHVEEATEELLGTYTCVPYNALGTMGQSPPARLLLKDPPYFTVLPGWEYRQEAGREL----LIPCAAAGDPFPSISW------------RKVGRPSFSKHSVLPSGSLQFRSLSKEDHGEWECVASNVVTSITASAHLTVIGTSPHAPSNVRVV-VSMNTANVSWEAGYDGGFEQTFSVWIKRAQFGPHDWVSMPVPSG----SSFLLVDSLDPETEYQFSVLAQNKL 577          
BLAST of Nephrin vs. Ensembl Xenopus
Match: zcchc8 (zinc finger CCHC-type containing 8 [Source:Xenbase;Acc:XB-GENE-977402])

HSP 1 Score: 66.2402 bits (160), Expect = 1.124e-10
Identity = 86/374 (22.99%), Postives = 140/374 (37.43%), Query Frame = 1
Query:  115 LRVQ---DNSLTIIRSDVDMMRNYTLIARNEIG-TGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQM------LDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTI----ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            LRV+   D +L I R   +    YT +  N +G + S +  L V + AR++  +   +   P      + C  ++ P    T V W        +DK   W+LL                                         T+H+       +G Y C+  N +    +S   ++L  + P    +     RQ +G EL     + C   G P P + W            +K    S    S L +  L    + K+D+  + C ASN + S TA   L+   T P  P N+RVV ++     V WE G++GGFEQ F V  K       D  S+ +           ++  L   T+Y+  + +++K+
Sbjct:  267 LRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVV--NMPPVIYVPVGIHGHIRCPVEAVP--PVTFVKWNKDGRPLRIDKFSGWKLLDD--------------------------------------GTIHVEEATEELLGTYTCVPYNALGTMGQSPPARLLLKDPPYFTVLPGWEYRQEAGREL----LIPCAAAGDPFPSISW------------RKVGRPSFSKHSVLPSGSLQFRSLSKEDHGEWECVASNVVTSITASAHLTVIGTSPHAPSNVRVV-VSMNTANVSWEAGYDGGFEQTFSVWIKRAQFGPHDWVSMPVPSG----SSFLLVDSLDPETEYQFSVLAQNKL 577          
BLAST of Nephrin vs. Ensembl Xenopus
Match: zcchc8 (zinc finger CCHC-type containing 8 [Source:Xenbase;Acc:XB-GENE-977402])

HSP 1 Score: 65.855 bits (159), Expect = 1.398e-10
Identity = 86/374 (22.99%), Postives = 140/374 (37.43%), Query Frame = 1
Query:  115 LRVQ---DNSLTIIRSDVDMMRNYTLIARNEIG-TGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQM------LDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTI----ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            LRV+   D +L I R   +    YT +  N +G + S +  L V + AR++  +   +   P      + C  ++ P    T V W        +DK   W+LL                                         T+H+       +G Y C+  N +    +S   ++L  + P    +     RQ +G EL     + C   G P P + W            +K    S    S L +  L    + K+D+  + C ASN + S TA   L+   T P  P N+RVV ++     V WE G++GGFEQ F V  K       D  S+ +           ++  L   T+Y+  + +++K+
Sbjct:  278 LRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVV--NMPPVIYVPVGIHGHIRCPVEAVP--PVTFVKWNKDGRPLRIDKFSGWKLLDD--------------------------------------GTIHVEEATEELLGTYTCVPYNALGTMGQSPPARLLLKDPPYFTVLPGWEYRQEAGREL----LIPCAAAGDPFPSISW------------RKVGRPSFSKHSVLPSGSLQFRSLSKEDHGEWECVASNVVTSITASAHLTVIGTSPHAPSNVRVV-VSMNTANVSWEAGYDGGFEQTFSVWIKRAQFGPHDWVSMPVPSG----SSFLLVDSLDPETEYQFSVLAQNKL 588          
BLAST of Nephrin vs. Ensembl Xenopus
Match: ccdc14 (coiled-coil domain containing 14 [Source:Xenbase;Acc:XB-GENE-6449725])

HSP 1 Score: 65.855 bits (159), Expect = 1.411e-10
Identity = 93/396 (23.48%), Postives = 169/396 (42.68%), Query Frame = 1
Query:   76 WLSEGSPIPYSRALRVQ--DNSLTIIRSDVDMMRN--YTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQ--CNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVI-WYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNG-----GFEQEF---IVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            W  +G PIP S  + +   D + ++  S++ +M N  YT IARN+        +L V    R +        V+P +      K   L C A+  P  +   ++W+     Y+      + Q  I+ +G IQ   NG                       +L I +++  D G Y C V+N + +   K + L V + A  +I+     +    GQ  ++ C   G  KP ++ W ++   + +    ++   ++ +G  + +++  +  + ++D   + C A N  G     I+L+    PD P  I +  +  + IA+ W  GF+G     G++ E      SW SV R + D+ S QL +          I DL  ++ Y IR+ +K++I +S
Sbjct:  631 WQKDGRPIPASLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNDAAAVEHQSQLIVRVPPRFV--------VQPTDQDGIYGKAVILNCSAEGYPVPT---IVWK-----YSKGAGVPQFQP-IALNGRIQLLTNG-----------------------SLLIKHVLEEDSGYYLCKVSNDVGADVSKSMYLTVKIPA--MITSYPNTTLATQGQKKEMSCTAHGE-KPIIVRWEKEDRMINVPEMSRYLVSTKEVGEEVISTLQILPTV-REDSGFFSCHAINSFGEDRGIIQLTVQEPPDPP-EIEIREVRARSIALRWTMGFDGNSPITGYDIECKNKSDSWDSVQR-TKDV-SPQLNQ--------ATIIDLHPASTYNIRMYAKNRIGKS 971          
BLAST of Nephrin vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 96.6709 bits (239), Expect = 2.699e-20
Identity = 86/396 (21.72%), Postives = 172/396 (43.43%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEG---SPIPYSRALRVQDNSL---TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIG-PDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGL-YNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP+ +++ W   G   SP    R   +   +L    + R+D      Y L  +N  GT     +L+V +   +    D  +++V        ++C   +NP          +L + ++W  L ++ +E+         N D    ++K     + +   ++           S  G YQC+V+N +  AA  ++ L V     +       +  + G+   SA L C   G P     W ++   L L   +  +Y   +   G+ ++S+LT+ N    QDY  + C A+N +GS    I+L S ++PD P  ++VV+++   + +EW+ GF+GG  Q F + ++++     +      ++ +  +   + +  L  ST+Y I + + + +  S
Sbjct:  671 SANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGF---YQLHCQNSEGTAEALLKLDVHYAPTIRALKDPTEVNVG---GSVDIVCTVDANP----------ILPEMFSWERLGEDEEEL---------NLDDMEKMSKGSTGRLRIRQAKL-----------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDL---QDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDHTNIQLVSISRPDPPLGLKVVSVSPHSVGLEWKPGFDGGLPQRFQIRYEAL-----ESPGFLYMDVLPAQATTFTLTGLKPSTRYRIWLLASNALGDS 1022          
BLAST of Nephrin vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 96.2857 bits (238), Expect = 3.204e-20
Identity = 86/396 (21.72%), Postives = 172/396 (43.43%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEG---SPIPYSRALRVQDNSL---TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIG-PDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGL-YNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP+ +++ W   G   SP    R   +   +L    + R+D      Y L  +N  GT     +L+V +   +    D  +++V        ++C   +NP          +L + ++W  L ++ +E+         N D    ++K     + +   ++           S  G YQC+V+N +  AA  ++ L V     +       +  + G+   SA L C   G P     W ++   L L   +  +Y   +   G+ ++S+LT+ N    QDY  + C A+N +GS    I+L S ++PD P  ++VV+++   + +EW+ GF+GG  Q F + ++++     +      ++ +  +   + +  L  ST+Y I + + + +  S
Sbjct:  685 SANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGF---YQLHCQNSEGTAEALLKLDVHYAPTIRALKDPTEVNVG---GSVDIVCTVDANP----------ILPEMFSWERLGEDEEEL---------NLDDMEKMSKGSTGRLRIRQAKL-----------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDL---QDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDHTNIQLVSISRPDPPLGLKVVSVSPHSVGLEWKPGFDGGLPQRFQIRYEAL-----ESPGFLYMDVLPAQATTFTLTGLKPSTRYRIWLLASNALGDS 1036          
BLAST of Nephrin vs. Ensembl Mouse
Match: Dscam (DS cell adhesion molecule [Source:MGI Symbol;Acc:MGI:1196281])

HSP 1 Score: 62.3882 bits (150), Expect = 1.297e-9
Identity = 83/388 (21.39%), Postives = 159/388 (40.98%), Query Frame = 1
Query:   76 WLSEGSPIPYSRALRVQ--DNSLTIIRSDVDMMRN--YTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMS--TLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDI-HSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            W  +G PIP S  + +   D + ++  S++ +M N  YT IARNE        +L V    + +        V+P +      K   L C A+  P  +   ++W+              +   +     I  NG                  I+++S  +L I ++V  D G Y C V+N + +   K + L V + A  +I+     +    GQ  ++ C   G  KP ++ +     +      ++   ++ +G  + +++  +  + ++D   + C A N  G     I+L+    PD P  I + ++  + I + W  GF+G      I  +    +  SD   S Q  +++  +     I D+  S+ Y IR+ +K++I +S
Sbjct:  630 WQKDGRPIPASLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFV--------VQPRDQDGIYGKAVILNCSAEGYPVPT---IVWKF------------SKGAGVPQFQPIALNG-----------------RIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPA--MITSYPNTTLATQGQRKEMSCTAHGE-KPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTV-REDSGFFSCHAINSYGEDRGIIQLTVQEPPDPP-EIEIKDVKARTITLRWTMGFDG---NSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKS 969          
BLAST of Nephrin vs. Ensembl Mouse
Match: Igsf9b (immunoglobulin superfamily, member 9B [Source:MGI Symbol;Acc:MGI:2685354])

HSP 1 Score: 60.077 bits (144), Expect = 5.169e-9
Identity = 50/178 (28.09%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  553 MGRYQCLVNNTI----ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFS 1071
            +G Y C+  NT+    +SA  +++  + P    +     RQ +G EL     + C   G P P + W +         GK  +     L SG     L    + K+D+  + C A+N + S TA   L+   T P  P ++RV +++     V WE G++GG+EQ F V W   ++F 
Sbjct:  392 LGTYTCVPYNTLGTMGQSAPARLVLKDPPYFTVLPGWEYRQEAGREL----LIPCAAAGDPFPVITWRK--------VGKPSRSKHNALPSG----SLQFRALSKEDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRV-HVSMTTANVSWEPGYDGGYEQTFSV-WMKRAQFG 551          
BLAST of Nephrin vs. Ensembl Mouse
Match: Igsf9b (immunoglobulin superfamily, member 9B [Source:MGI Symbol;Acc:MGI:2685354])

HSP 1 Score: 60.4622 bits (145), Expect = 5.375e-9
Identity = 50/177 (28.25%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  553 MGRYQCLVNNTI----ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSS-STKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRF 1068
            +G Y C+  NT+    +SA  +++  + P    +     RQ +G EL     + C   G P P + W +         GK  +     L SG     L    + K+D+  + C A+N + S TA   L+   T P  P ++RV +++     V WE G++GG+EQ F V W   ++F
Sbjct:  392 LGTYTCVPYNTLGTMGQSAPARLVLKDPPYFTVLPGWEYRQEAGREL----LIPCAAAGDPFPVITWRK--------VGKPSRSKHNALPSG----SLQFRALSKEDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRV-HVSMTTANVSWEPGYDGGYEQTFSV-WMKRAQF 550          
BLAST of Nephrin vs. UniProt/SwissProt
Match: sp|O60500|NPHN_HUMAN (Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.509e-21
Identity = 90/400 (22.50%), Postives = 173/400 (43.25%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEG---SPIPYSRALRVQDNSL---TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIG-PDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMST-----LHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP+ +++ W   G   SP    R   +   +L    + R+D  +   Y L  +N  GT     RL+V +   +    D  +++V        ++C   +NP          +L   +NW  L ++ ++                          S+ ++E +S      L I +   +  G YQC+V+N +   A ++L L V     +       +  + G+   SA L C   G P     W ++   L L   +  ++   +   G+++S+LT+ N    QDY  + C A+N +GS    I+L S ++PD P  ++VV++T   + +EW+ GF+GG  Q F + ++++   +   H V +V     +   + +  L  ST+Y + + + + +  S
Sbjct:  671 SANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGL---YQLHCQNSEGTAEARLRLDVHYAPTIRALQDPTEVNVG---GSVDIVCTVDANP----------ILPGMFNWERLGEDEEDQ-------------------------SLDDMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQ--GGVHSSLLTIANVSAAQDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLPQRFCIRYEALG--TPGFHYVDVVP---PQATTFTLTGLQPSTRYRVWLLASNALGDS 1022          
BLAST of Nephrin vs. UniProt/SwissProt
Match: sp|Q9R044|NPHN_RAT (Nephrin OS=Rattus norvegicus OX=10116 GN=Nphs1 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.087e-20
Identity = 89/396 (22.47%), Postives = 172/396 (43.43%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEG---SPIPYSRALRVQDNSL---TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIG-PDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGL-YNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP+ +++ W   G   SP    R   +   +L    + R+D      Y L  +N  GT     +L+V +   +    D  +++V        ++C   +NP          +L + ++W  L +E +++         N D    ++K     + +   ++           S  G YQC+V+N +  AA  ++ L V     +       +  + G+   SA L C   G P     W ++   L L   +  +Y   R   G+ ++S+LT+ N    QDY  + C A+N +GS    I+L S ++PD P  ++VV+I+   + +EW+ GF+GG  Q F + ++++     +      V+ +  +   + +  L  ST+Y I + + + +  S
Sbjct:  685 SANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGF---YQLHCQNSEGTAEALLKLDVHYAPTIRALRDPTEVNVG---GSVDIVCTVDANP----------ILPEMFSWERLGEEEEDL---------NLDDMEKVSKGSTGRLRIRQAKL-----------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDQPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDL---QDPRYTEHRYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDHTNIQLVSISRPDPPLGLKVVSISPHSVGLEWKPGFDGGLPQRFQIRYEAL-----ETPGFLHVDVLPTQATTFTLTGLKPSTRYRIWLLASNALGDS 1036          
BLAST of Nephrin vs. UniProt/SwissProt
Match: sp|Q9QZS7|NPHN_MOUSE (Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 2.241e-19
Identity = 86/396 (21.72%), Postives = 172/396 (43.43%), Query Frame = 1
Query:   46 ASNPSVQSYQWLSEG---SPIPYSRALRVQDNSL---TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIG-PDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATI--VISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGL-YNSILTV-NFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            ++NP+ +++ W   G   SP    R   +   +L    + R+D      Y L  +N  GT     +L+V +   +    D  +++V        ++C   +NP          +L + ++W  L ++ +E+         N D    ++K     + +   ++           S  G YQC+V+N +  AA  ++ L V     +       +  + G+   SA L C   G P     W ++   L L   +  +Y   +   G+ ++S+LT+ N    QDY  + C A+N +GS    I+L S ++PD P  ++VV+++   + +EW+ GF+GG  Q F + ++++     +      ++ +  +   + +  L  ST+Y I + + + +  S
Sbjct:  685 SANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQLWNVTRADDGF---YQLHCQNSEGTAEALLKLDVHYAPTIRALKDPTEVNVG---GSVDIVCTVDANP----------ILPEMFSWERLGEDEEEL---------NLDDMEKMSKGSTGRLRIRQAKL-----------SQAGAYQCIVDNGVAPAARGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDL---QDPRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDHTNIQLVSISRPDPPLGLKVVSVSPHSVGLEWKPGFDGGLPQRFQIRYEAL-----ESPGFLYMDVLPAQATTFTLTGLKPSTRYRIWLLASNALGDS 1036          
BLAST of Nephrin vs. UniProt/SwissProt
Match: sp|Q9U3P2|SYG2_CAEEL (Synaptogenesis protein syg-2 OS=Caenorhabditis elegans OX=6239 GN=syg-2 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.916e-15
Identity = 84/339 (24.78%), Postives = 136/339 (40.12%), Query Frame = 1
Query:   52 NPSVQSYQWLSEGSPIPYSRALRVQDNSL----TIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYF-CQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            NP++  +QW   G P  ++        ++     ++ +D  +   YTL A N +G+ + T +L V + AR+    +  I+   D     L C+A   P  S+  +I        +W   YK              NG+     A++R    ++  +         N      G Y C  +N I   A     L V     ++   R   + G LG  AK  C V+  P  + +W +D   L   +  K+   + ++    Y S L +  I   DY     C A N  G+    I +   T PD PFN+ + N T   I+V WE  F+GG +Q F V ++
Sbjct:  717 NPAISLWQWRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGV---YTLTATNSVGSTNITIKLAVEYSARITSISTPVIAATGDT--VLLECEADGEP--SKANMI--------HW---YK--------------NGEILA--AQHRGHKKAILRL---------NATEQQSGEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKTAGILGGVAKARCKVYAVPTVEFVWEKD-EQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYR 1011          
BLAST of Nephrin vs. UniProt/SwissProt
Match: sp|Q24372|LACH_DROME (Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.129e-11
Identity = 43/147 (29.25%), Postives = 70/147 (47.62%), Query Frame = 1
Query:  511 IMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIP 951
            + +TL I ++   D G Y C+ +N +  + G   N+NV V    VI+  R   G  L     L C +  YP P ++W +D  ++ L + + +            +S L V  +EK+ Y +Y C+A+N  G A AR+ L  +  P  P
Sbjct:  185 VGNTLRIKSVKKEDRGTYYCVADNGV--SKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKD--DIQLANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIPVCP 327          
BLAST of Nephrin vs. TrEMBL
Match: A0A4S2M8S8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001836 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 6.067e-59
Identity = 144/450 (32.00%), Postives = 231/450 (51.33%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSE-----GSPIPYSR-----ALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNW--------------RLLYKERQEVISSS-GSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIV-ISRRRQFSGGELGQS--------------------AKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G  + + L P +NP V    W  E      SP   +R      + ++++ L I   +V  M  YTL+A N +G+  F F LNVTFG +LIG     I++    K+A+L C+A++NPT ++  V W+ +  ++                 +  K  +E ++ S   I+CN   W    KY A C S S   + S L I++L PSD+GRYQC ++N I S A ++++L  P    I+ I R  + + G +  S                    A+L C +   P+P+V W R+ SNLTL+ G +F+   + +  GLY++IL +     +D   YFC+ASN +G  + R+ L  ++KPD+P   R+VN T+  +AV W QGFNGG +Q F + W S     S   + ++ E M  E + YVI  L  +T Y + + +++++F S +F+  +L 
Sbjct:  878 GGTVDLDLTPLANPPVHKLVWYKENQQLISSPAHTNRDGGQIRIYIENSRLHISPVEVGDMSYYTLMASNTMGSTRFKFFLNVTFGPQLIG--KPVINITATGKKAQLECEARANPTPTENAVRWRRISHSFTGMDYATQLPRQNPVSEIPKKTEEESLADSVTGIRCNKGKWHNGFKYFAKCWSKSPGTLTSLLTIYDLGPSDVGRYQCHMDNAIGSPAVRIVDLIYPFAPRIIHIQRWSKAAPGPVTSSLDSENTGTNQSPQTNGLRRQARLTCVIAAEPQPEVTWSREPSNLTLVEGGQFRSQMKLVHPGLYHAILYITQPRDEDNGLYFCKASNLVGEDSGRVELIKASKPDVPQVPRLVNATSTTLAVTWTQGFNGGPKQIFQLRWASNENPESYTQT-EVEEVMESETVTYVISGLQKATTYRVAVSARNEVFGSTRFTQYLLA 1324          
BLAST of Nephrin vs. TrEMBL
Match: A0A4S2M8R7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001836 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 6.183e-59
Identity = 144/450 (32.00%), Postives = 231/450 (51.33%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSE-----GSPIPYSR-----ALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNW--------------RLLYKERQEVISSS-GSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIV-ISRRRQFSGGELGQS--------------------AKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G  + + L P +NP V    W  E      SP   +R      + ++++ L I   +V  M  YTL+A N +G+  F F LNVTFG +LIG     I++    K+A+L C+A++NPT ++  V W+ +  ++                 +  K  +E ++ S   I+CN   W    KY A C S S   + S L I++L PSD+GRYQC ++N I S A ++++L  P    I+ I R  + + G +  S                    A+L C +   P+P+V W R+ SNLTL+ G +F+   + +  GLY++IL +     +D   YFC+ASN +G  + R+ L  ++KPD+P   R+VN T+  +AV W QGFNGG +Q F + W S     S   + ++ E M  E + YVI  L  +T Y + + +++++F S +F+  +L 
Sbjct:  878 GGTVDLDLTPLANPPVHKLVWYKENQQLISSPAHTNRDGGQIRIYIENSRLHISPVEVGDMSYYTLMASNTMGSTRFKFFLNVTFGPQLIG--KPVINITATGKKAQLECEARANPTPTENAVRWRRISHSFTGMDYATQLPRQNPVSEIPKKTEEESLADSVTGIRCNKGKWHNGFKYFAKCWSKSPGTLTSLLTIYDLGPSDVGRYQCHMDNAIGSPAVRIVDLIYPFAPRIIHIQRWSKAAPGPVTSSLDSENTGTNQSPQTNGLRRQARLTCVIAAEPQPEVTWSREPSNLTLVEGGQFRSQMKLVHPGLYHAILYITQPRDEDNGLYFCKASNLVGEDSGRVELIKASKPDVPQVPRLVNATSTTLAVTWTQGFNGGPKQIFQLRWASNENPESYTQT-EVEEVMESETVTYVISGLQKATTYRVAVSARNEVFGSTRFTQYLLA 1324          
BLAST of Nephrin vs. TrEMBL
Match: G7Y3Q6 (Nephrin OS=Clonorchis sinensis OX=79923 GN=CLF_100560 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 8.341e-59
Identity = 141/446 (31.61%), Postives = 230/446 (51.57%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRA------LRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKE--RQEVIS-------------SSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIV-ISRRRQFSGGELGQS--------------------AKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G  + + L P +NP V    W  E   + ++        + ++++ L I   +V  M  YTL+A N +G+  F F LNVTFG +LIG     I++    K+A+L C+A++NPT ++  V W+ +  ++       +  RQ V+S             S   I+CN   W    KY A C S S   + S L I++L PSD+GRYQC ++N I S A ++++L  P    ++ I R  + + G +  S                    A+L C +   P+P+V W R+ +NLTL+ G +F+   + +  GLY++IL +     +D   YFC+ASN +G  + R+ L  ++KPD+P   R+VN T+  +AV W QGFNGG +Q F + W S     S   + +L E +  E + +VI  L  +T Y + + S++++F S +F+  +L 
Sbjct:  266 GGTVDLDLTPLANPPVHKLVWYKENQQLAHTNRGGGQMRIFIENSRLHISPVEVGDMSYYTLMASNTMGSTRFKFFLNVTFGPQLIG--KPIINITATGKKAQLECEARANPTPTENAVRWRRISHSFTGMDYATQLPRQNVVSEIPKKTEEESLADSVTGIRCNKGKWHNGFKYFAKCWSKSPGTLTSLLTIYDLGPSDVGRYQCHMDNAIGSPAVRIVDLIYPFAPRVIHIQRWSKAAPGPVTSSVDSENTDTNQSPQTNGFRRQARLTCVIAAEPQPQVTWSREPANLTLVEGGQFRSQMKLVHPGLYHAILYIAQPRDEDNGLYFCKASNLVGEDSGRVELIKASKPDVPQVPRLVNATSTTLAVTWTQGFNGGPKQIFQLRWASNENPESYTQT-ELEEVLESETVTHVISGLQKATTYRVAVSSRNEVFGSTRFTQYLLA 708          
BLAST of Nephrin vs. TrEMBL
Match: A0A419PHD7 (Nephrin (Fragment) OS=Clonorchis sinensis OX=79923 GN=NPHS1 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.106e-58
Identity = 141/446 (31.61%), Postives = 230/446 (51.57%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRA------LRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKE--RQEVIS-------------SSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIV-ISRRRQFSGGELGQS--------------------AKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G  + + L P +NP V    W  E   + ++        + ++++ L I   +V  M  YTL+A N +G+  F F LNVTFG +LIG     I++    K+A+L C+A++NPT ++  V W+ +  ++       +  RQ V+S             S   I+CN   W    KY A C S S   + S L I++L PSD+GRYQC ++N I S A ++++L  P    ++ I R  + + G +  S                    A+L C +   P+P+V W R+ +NLTL+ G +F+   + +  GLY++IL +     +D   YFC+ASN +G  + R+ L  ++KPD+P   R+VN T+  +AV W QGFNGG +Q F + W S     S   + +L E +  E + +VI  L  +T Y + + S++++F S +F+  +L 
Sbjct:  460 GGTVDLDLTPLANPPVHKLVWYKENQQLAHTNRGGGQMRIFIENSRLHISPVEVGDMSYYTLMASNTMGSTRFKFFLNVTFGPQLIG--KPIINITATGKKAQLECEARANPTPTENAVRWRRISHSFTGMDYATQLPRQNVVSEIPKKTEEESLADSVTGIRCNKGKWHNGFKYFAKCWSKSPGTLTSLLTIYDLGPSDVGRYQCHMDNAIGSPAVRIVDLIYPFAPRVIHIQRWSKAAPGPVTSSVDSENTETNQSPQTNGFRRQARLTCVIAAEPQPQVTWSREPANLTLVEGGQFRSQMKLVHPGLYHAILYIAQPRDEDNGLYFCKASNLVGEDSGRVELIKASKPDVPQVPRLVNATSTTLAVTWTQGFNGGPKQIFQLRWASNENPESYTQT-ELEEVLESETVTHVISGLQKATTYRVAVSSRNEVFGSTRFTQYLLA 902          
BLAST of Nephrin vs. TrEMBL
Match: A0A075AB30 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14339 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.410e-58
Identity = 147/451 (32.59%), Postives = 235/451 (52.11%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSE-----GSPIPYSR-----ALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNW--------------RLLYKERQEVISSS-GSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIV-ISRRRQFSGG-----------ELGQS---------AKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLD-EKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G  + + L P +NP V    W  E      SP   +R      + ++++ L I   +V  M  YTLIA N +G+  F F LNVTFG +LIG     I++    K+A+L C+A++NPT ++  V W+ +  ++                 +  K  +E ++ S   I+CN   W    KY A C S S   + S L I++L PSD+GRYQC ++N I S A ++++L  P    I+ I R  + + G           E  QS         A+L C +   P+P+V W R+ +NLTL+ G +F+   + +  GLY++IL ++    +D   YFC+ASN +G  + R+ L  ++KPD+P   R+VN T+  +AV W QGFNGG +Q F + W S     S  ++   VE +L+ E + +VI  L  +T Y + + S++++F S +F+  +L 
Sbjct:  790 GGTVDLDLTPLANPPVHKLVWYKENQQLISSPAHTNRDGGQMRIFIENSRLHISPVEVSDMSYYTLIASNTMGSTRFKFFLNVTFGPQLIG--KPIINITATGKKAQLECEARANPTPTENAVRWRRISHSFTGMDYATQLPRPNTVSEIPKKTEEESLADSVTGIRCNKGKWHNGFKYFAKCWSKSPGTLTSLLTIYDLGPSDVGRYQCHMDNAIGSPAVRIVDLIYPFAPRIIHIQRWSKAAPGPVTGSLDSENTETNQSPQTNGIRRQARLTCVIAAEPQPEVTWSREPANLTLVEGGQFRSQMKLIHPGLYHAILYLSQPRDEDNGLYFCKASNLVGEDSGRVELMKASKPDVPQVPRLVNATSTTLAVTWTQGFNGGPKQIFQLRWASNENPES--YTQTEVEEVLESETVTHVISGLQKATTYRVAVSSRNEVFGSTRFTQYLLA 1236          
BLAST of Nephrin vs. Ensembl Cavefish
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:ZDB-GENE-051102-1])

HSP 1 Score: 67.0106 bits (162), Expect = 3.989e-11
Identity = 43/179 (24.02%), Postives = 80/179 (44.69%), Query Frame = 1
Query:  523 LHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISR--RRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            L ++ +  +  G YQC  +N I      V  L V     +      R+  S G+      + C   G P+    W ++   L   + +  +  + R G+   +++  VN     DY  + C A N  G     I+L S++ PD P +++++++ +  + +EW  GF+GG  Q F V ++
Sbjct:  804 LTLYEVTRAQAGPYQCTADNEIAPPGSVVGQLVVRFAPELQKGPQWRKVASRGDGSTDVDVLCQAEGVPRVTFTWAKNRVPLDFPNPRYLER-TVREGAIHTSTLTVVNVSAALDYAIFTCTARNSQGEDNLDIQLLSTSYPDPPSDLKLLSVASDSVTLEWMPGFDGGLIQNFRVRYQ 981          
BLAST of Nephrin vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 64.6994 bits (156), Expect = 2.406e-10
Identity = 48/154 (31.17%), Postives = 68/154 (44.16%), Query Frame = 1
Query:  520 TLHIWNLVPSDMGRYQCLVNNTI-ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNIT 978
            TL I N++P D G+Y C V N   E  A  V+ L V      V+  R Q +   LG   KL C   G+P P+  W      +  +        +E+  S L N  L +  +   D   Y C ASN  G+ T  IRL+ +  P +   +R  NI+
Sbjct: 1665 TLTIRNVLPLDQGQYLCTVQNQFGEDKA--VVTLVVLAEHPRVLQPRHQDTVAYLGDMVKLACRAEGHPPPRTTWVLPDRAMLHMDAASSPGAAEQRVSVLPNGTLQIASVAYADRGVYKCIASNAAGADTVSIRLTVTALPPVIQQLRQENIS 1816          

HSP 2 Score: 59.3066 bits (142), Expect = 1.006e-8
Identity = 71/264 (26.89%), Postives = 112/264 (42.42%), Query Frame = 1
Query:  175 YTLIARNEIGTGSFTFRLNVTFGARLIGP-DSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRR------QFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLY-NSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKP 942
            Y  IA N  G  + + RL VT    +I     E+IS+ P+   A L C A+  P    T + W   D      +  K  Q V   +  +  NG                       TL+I  L  +D G+Y+C  +N+I   + + ++L+V    TI  +R R      Q +    G   +L C   G P+P+VIW      L       + YD +R+   +Y N  LT++ + ++D  +Y C A N IG     ++++  TKP
Sbjct: 1781 YKCIASNAAGADTVSIRLTVTALPPVIQQLRQENISL-PEGITAYLNCSARGAP---PTTISWTTPDG-----MQLKPSQLVSGHNLFVFPNG-----------------------TLYIRGLSQADAGKYECTASNSI-GISSRAISLSV--KTTIASARTRITSSSPQVTDVTYGGRLQLDCVATGDPEPRVIWRTPSKKLV---DAHYSYD-QRIK--VYANGSLTIHSLTEKDEGDYLCVARNKIGDDYVPLKVNILTKP 2003          
BLAST of Nephrin vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 64.3142 bits (155), Expect = 2.849e-10
Identity = 48/154 (31.17%), Postives = 68/154 (44.16%), Query Frame = 1
Query:  520 TLHIWNLVPSDMGRYQCLVNNTI-ESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNIT 978
            TL I N++P D G+Y C V N   E  A  V+ L V      V+  R Q +   LG   KL C   G+P P+  W      +  +        +E+  S L N  L +  +   D   Y C ASN  G+ T  IRL+ +  P +   +R  NI+
Sbjct: 1631 TLTIRNVLPLDQGQYLCTVQNQFGEDKA--VVTLVVLAEHPRVLQPRHQDTVAYLGDMVKLACRAEGHPPPRTTWVLPDRAMLHMDAASSPGAAEQRVSVLPNGTLQIASVAYADRGVYKCIASNAAGADTVSIRLTVTALPPVIQQLRQENIS 1782          

HSP 2 Score: 56.225 bits (134), Expect = 8.514e-8
Identity = 68/263 (25.86%), Postives = 106/263 (40.30%), Query Frame = 1
Query:  175 YTLIARNEIGTGSFTFRLNVTFGARLIGP-DSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRR------QFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKP 942
            Y  IA N  G  + + RL VT    +I     E+IS+ P+   A L C A+  P    T + W   D      +  K  Q V   +  +  NG                       TL+I  L  +D G+Y+C  +N+I   + + ++L+V    TI  +R R      Q +    G   +L C   G P+P+VIW      L          D+        N  LT++ + ++D  +Y C A N IG     ++++  TKP
Sbjct: 1747 YKCIASNAAGADTVSIRLTVTALPPVIQQLRQENISL-PEGITAYLNCSARGAP---PTTISWTTPDG-----MQLKPSQLVSGHNLFVFPNG-----------------------TLYIRGLSQADAGKYECTASNSI-GISSRAISLSV--KTTIASARTRITSSSPQVTDVTYGGRLQLDCVATGDPEPRVIWRTPSKKLV---------DAHYRIKVYANGSLTIHSLTEKDEGDYLCVARNKIGDDYVPLKVNILTKP 1965          
BLAST of Nephrin vs. Ensembl Cavefish
Match: LSAMP (limbic system associated membrane protein [Source:HGNC Symbol;Acc:HGNC:6705])

HSP 1 Score: 61.6178 bits (148), Expect = 6.596e-10
Identity = 43/144 (29.86%), Postives = 69/144 (47.92%), Query Frame = 1
Query:  493 SVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRL 924
            S   +E+   L I  ++ +  GRY+C  +N +  AA  V  +NV V     I +  + S  ++G+   L C     PKP+  WYRD   L+ + G   Q    R       ++L V  + ++DY NY C A+N +G+  A + L
Sbjct:  158 SAETLEVGEYLEISGIMRTQAGRYECKASNDV--AAPDVKYVNVIVNYPPFI-KGAKSSETQVGRMGVLQCDATAVPKPEFEWYRDDKRLSNMQGVSIQIIGTR-------TLLLVANVTEEDYGNYTCMATNRLGTHNASVFL 291          
BLAST of Nephrin vs. Ensembl Cavefish
Match: cntn3b (contactin-3-like [Source:NCBI gene;Acc:103046198])

HSP 1 Score: 59.6918 bits (143), Expect = 6.245e-9
Identity = 48/150 (32.00%), Postives = 68/150 (45.33%), Query Frame = 1
Query:  523 LHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPV-----GATIVISRRRQFSGGEL-----GQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKP 942
            L+I  + PSD+G Y C+VNN+I     KVL+   P+     GA      + +    E      G S KL C+  G P P++ W R  S++   S  K +           N+IL +   +++D   Y C A N  G   AR RLS   KP
Sbjct:  184 LYIAKVEPSDVGNYTCVVNNSI--TKDKVLSSPTPLVLRNDGAMGEYEPKIEVHFPETVPAAKGSSVKLECFALGNPVPRISWRR-TSDVPFPSKVKLKNS---------NAILEIPRFQQEDTGTYECVAENSRGKNAARGRLSFHAKP 321          
BLAST of Nephrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.265e-10
Identity = 93/403 (23.08%), Postives = 165/403 (40.94%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSL--TIIRSDVDMMRN--YTLIARNEIGTGSFTFRLNVTFGARLI--GPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVI-WYRDISNLTLISGKK-FQY--DSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFE-QEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            GQ + +     S  S     W  +G P+P     +V+      +++  +V  + N  YT +ARNE  T S   +L V    R +    D + I  KP      L C A   P     ++IW+      N      + Q V+S  G  Q  G+                      +L +  +   D G Y C V+N + +   K + LNV + A  +++ +   +    GQ + L C   G  +P +I W ++    TLI  ++ F+Y   ++  G  L +++  +  + + D   + C A N  G     I+L+    PD P  + V  +  + I + W  GF+G      F + +K+ S         + + + +++  I    DL  +T Y  R+ +K++I
Sbjct:  443 GQRVYVPCVIVSGDSPIRITWHKDGQPLPPRLGAQVETTEFISSLLIPNVTQLHNGNYTCLARNEAATVSHGSQLIVRVPPRFVVQPKDQDGIFGKP----VVLNCSADGYPI---PKIIWKYSKGNGN-----PQFQPVLSGGGRFQPLGN---------------------GSLLLRQVQEEDGGFYLCQVSNGVGTDISKSMLLNVKIPA--LVTSQANVTLATRGQHSNLQCSARG-ERPIIIRWEKE---ETLIDPERMFRYVVYTQDTGDELLSTLQILPTV-RGDSGFFTCHAINSYGEDRGLIQLTVQEPPDPP-EVEVREVNARTITLRWTSGFDGNSPITAFDIEYKNRSDTWEQKQRTKDISSTINQATII---DLHPATHYVFRVYAKNRI 801          
BLAST of Nephrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008285.1 (pep scaffold:Pmarinus_7.0:GL481193:15019:35761:-1 gene:ENSPMAG00000007495.1 transcript:ENSPMAT00000008285.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 2.131e-8
Identity = 40/159 (25.16%), Postives = 77/159 (48.43%), Query Frame = 1
Query:  514 MSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGEL--GQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKK---FQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNI 975
            M TL I ++ PSDMG Y C V N+        + L VP  +  ++  +   +  E+  G+ A+  C+V G PKP+++W +D  +  ++ G++   ++ D  +  +GLY                  C A+N +G   + ++L    +P +PF  ++ ++
Sbjct:   46 MHTLKINSVRPSDMGTYSCKVKNSAGEVNASAI-LGVP--SEQILWSKPPSTAYEVTEGKHARFSCYVTGKPKPEIVWKKD--SEIIVPGRRHLTYEDDDGQCDNGLYT-----------------CTATNVVGKTYSPVQLIVH-EPRVPFRTKLRDV 181          
BLAST of Nephrin vs. Ensembl Sea Lamprey
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 53.5286 bits (127), Expect = 8.629e-8
Identity = 62/252 (24.60%), Postives = 100/252 (39.68%), Query Frame = 1
Query:  490 ISVSNIEIMST--LHIWNLVPSDMGRYQCLVNN----TIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLS---SSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSP 1218
            I V  I+++ T  L I ++     G Y C  N        +A G+++     V A     +  Q     LG SA L C   G P P++IW  +   L L      Q +  RL +G  NS LT+  +  +D   Y C A N  G   A  RL+   S   P  P+++RV   +   + + W +          ++ +    R + D    +  E +    + + + +L  ST Y   +    K + S   S P
Sbjct:  241 IGVEGIQVVGTGNLMISDVAVQHAGVYVCAANRPGTRVRRTAQGRLI-----VQAPPEFMQPPQSVTRSLGASAVLTCSAQGTPSPRIIWLHN--GLPL-----HQSERVRLQNG--NSTLTIQRVCSEDEGIYQCTAENSAGYTQASARLAVLGSDGLPGPPWDLRVRATSATAVELAWREPLQ---NPHGVIGYVLHIRRAQDSEDQEYQEAVSQTTVQHTVLELEPSTHYTFYV----KAYSSGGASQP 471          
BLAST of Nephrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.710e-7
Identity = 52/172 (30.23%), Postives = 76/172 (44.19%), Query Frame = 1
Query:  472 KYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGG------ELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNF--IEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIR 963
            KYR   +++S  E  STL + N+  SD G Y C + N  E+     L       AT+       F  G       +G +  L C V G P+ +V WY+    L   SG K +           N++ T+    + K D  +Y C+A ND GSAT+   LS S + + P+  R
Sbjct: 5450 KYR---VAISEGE--STLEVLNVDKSDEGIYTCKIQN--EAGEDSCL-------ATLATLEPPNFIKGLEPTEIVVGSTVHLECQVAGTPQIRVSWYKGSQKLK--SGDKCKM-------AFKNNLATLELRSLTKADTGDYSCKAENDFGSATSLASLSVSERKNPPYFTR 5598          

HSP 2 Score: 49.6766 bits (117), Expect = 2.023e-6
Identity = 46/171 (26.90%), Postives = 72/171 (42.11%), Query Frame = 1
Query:  496 VSNIEIMSTLHIWNLVPSDMGRYQCLV-NNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKK----FQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIA 993
            V+ +E  STL I     SD G Y C + N++ +     +L +  P        +  +   G  G S    C V G P+ +V WY+    L   SG K    FQ+++         ++L V   EK D   Y C+A N +GSA     L+   +   P   R++    ++I 
Sbjct: 6579 VTTVEGQSTLDILATEISDSGNYTCKIQNDSGQDNCTALLKVLDPP----YFVKSLEPMEGTFGTSVYFECQVAGAPEIRVTWYKGSQKL---SGAKYKTMFQHNT---------AVLEVKNFEKADVGTYSCEAENSLGSAKTSASLAGKERKHPPSFSRMLKNMQQVIG 6733          
BLAST of Nephrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004759.1 (pep scaffold:Pmarinus_7.0:GL479237:38728:63566:1 gene:ENSPMAG00000004331.1 transcript:ENSPMAT00000004759.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 3.068e-7
Identity = 70/307 (22.80%), Postives = 112/307 (36.48%), Query Frame = 1
Query:   73 QWLSEGSPIPYSRALRV-------------QDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGP----DSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSAT--ARIRLSSST 936
            + ++EG P P  R  RV              + +L +   +V+    Y  IA N +G+   +F + V  G+R   P      ED  V P + +A L C A   P        W +  K  N       R             GD                       + +  LV      YQC+ +N   +     L   + V    +   + ++   E  Q   L C VFG PKP + W +D   +  +  KKF+           N  L ++  +K D   Y C+A+ND+ + T  A++R+  +T
Sbjct:  229 ECIAEGLPTPDVRWERVSGHMPRGRFSTGNHNKTLRLHPVEVEDSGQYKCIASNNMGSAHHSFVVTVD-GSRAAAPYWTARPEDRIVAPGD-DAVLHCVAGGKP---PPETHWLLNGKPLNEAPAEPHRT----------VKGDR----------------------IVLKKLVIGQSAVYQCVASNVFGTIIANALVSVLAVPPKFITKDKEEYVVVE-KQPVLLDCKVFGSPKPAIRWSKD-GQVNTLQDKKFKE--------FENGSLYIHEAKKADQGLYMCEATNDLDTGTINAKLRVREAT 488          
BLAST of Nephrin vs. Ensembl Nematostella
Match: EDO43516 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYG4])

HSP 1 Score: 55.8398 bits (133), Expect = 3.242e-8
Identity = 53/236 (22.46%), Postives = 98/236 (41.53%), Query Frame = 1
Query:  517 STLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGEL------GQSAKLF--CWVFGYPKPKV-IWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGF-NGGFE-QEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            S ++I ++   D GRY C   N      G  +     +G  I    R    G  L      G    +F  C   GYP P V IW+                D++++ +G   ++  +   E +D+ +Y C + N  GS    ++L+ + +P  P N++  N+T   + + W+    +GG E  ++++ +               + N  D    Y I +L   T Y+I+I +++K+
Sbjct:  378 SRIYIQDVRLEDEGRYTCEARNNARDQEGHPIVATEEIGLYIKSLPRLNKKGTPLTVYSYLGNPKPVFIRCRFDGYPFPNVTIWF----------------DNKQIANGTEFAMFDIITNELEDFGDYLCWSWNIHGSKNVTVKLTHAREPSRPVNVK-ANVTCSRVTLTWDPPIDDGGMEIMQYVIEYDG------------KIFNTEDTYPKYYITNLKRDTMYDIKIWARNKM 584          
BLAST of Nephrin vs. Ensembl Nematostella
Match: EDO27477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T954])

HSP 1 Score: 51.6026 bits (122), Expect = 9.206e-8
Identity = 36/128 (28.12%), Postives = 58/128 (45.31%), Query Frame = 1
Query:  517 STLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIG 900
            S L ++N+   + G Y+C  +N I   A     L+V     I   +++ F    LG++  L C V G P P V W R  S  ++I      +   R+      S+L V   + +D+ +Y C A N +G
Sbjct:   48 SILTLYNVTRREAGSYECKADNGIRKPAKASAVLSVNFAPEIERQKKKHFET-SLGKAINLTCDVEGGPLPSVTWSRKRSQFSII------FSPVRM-----RSVLEVIPKQSRDFGDYICMARNIMG 163          
BLAST of Nephrin vs. Ensembl Nematostella
Match: EDO46100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR37])

HSP 1 Score: 53.5286 bits (127), Expect = 1.924e-7
Identity = 34/115 (29.57%), Postives = 49/115 (42.61%), Query Frame = 1
Query:  679 LGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGG 1023
            +G+   L C   G P P++ W R     T +SG +              S L++     +D+  Y C ASN  GSA ARI L     P  P +I  V  ++  I + WE   + G
Sbjct:  131 IGKPTSLTCSALGVPAPQITWSRPGQVSTSVSGNQA------------TSELSLTPRSSRDFGEYVCAASNSAGSADARIALIELVPPSSP-SISRVEPSDNEIKLNWEAPASDG 232          
BLAST of Nephrin vs. Ensembl Nematostella
Match: EDO45224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTJ3])

HSP 1 Score: 51.2174 bits (121), Expect = 2.938e-7
Identity = 29/92 (31.52%), Postives = 42/92 (45.65%), Query Frame = 1
Query:  685 QSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNI 960
             +  L C+V G P P + WY   S++T + G                S+LTV    +QDY +Y C+A N +GS    I +   T P  P +I
Sbjct:   32 HTVSLHCYVSGSPPPVITWYNPASHVTSVPG---------------GSVLTVTTRSEQDYGSYTCRAVNSVGSHEHVISVIQWTPPGKPESI 108          
BLAST of Nephrin vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 52.7582 bits (125), Expect = 3.908e-7
Identity = 43/146 (29.45%), Postives = 64/146 (43.84%), Query Frame = 1
Query:  505 IEIMSTLHIW---NLVPSDMGRYQCLVNNTIES--AAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLS 927
            IE + + H++   N    D G Y C   N   S  A   V  L VP     ++S+R +      G+SA L C   G P P+  WY+D   +TL         S R+ +  +  +L    + + D   Y CQ SN +G+A    RL+
Sbjct:  690 IEHLPSEHLFIIRNARGVDTGAYTCTATNGAGSINATAYVTVLEVPRFMQSMVSKRVR-----TGESAVLECKASGSPMPRFTWYKDDKKVTL---------SARVVA--HGQLLVFVTVLRDDEGTYTCQVSNSLGTARQNTRLT 819          
BLAST of Nephrin vs. Ensembl Medaka
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:NCBI gene;Acc:101155460])

HSP 1 Score: 84.7297 bits (208), Expect = 9.801e-17
Identity = 90/356 (25.28%), Postives = 142/356 (39.89%), Query Frame = 1
Query:   28 TIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQ---DNSLTI---IRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISR--RRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK 1053
            TI L  ++NP   S  WL       + R   V+   D SL I    R D  +   YT+   NE G       L+V +          D++ + D         A LIC A +NP          ++   ++W+ L  ER E+   +   +                         S L I N+  +  G YQC  NN I  +    + L V     +      R+  S G+   +A+L C   G P+    W +    L L +  +++  + R GS   +++  VN     DY  + C A N +G     I+L S+  PD P   R V+ T+  + +EW  GFNGG +Q+F + ++
Sbjct:  652 TIPLLVSANPEGVSCVWL-------HRRETLVKGDPDGSLEIRNATRRDAGL---YTIKCENEEGVSQTAITLDVLYAC--------DVTAEKDPVFVNLGGTADLICVADANP----------IISDMFSWKWLEGERVEMGEETQEDES------------------------SLLTIRNVTRAHSGLYQCTANNGIGLSGSVNMQLVVQFKPELQKGPQWRKVASRGDGSTTAELVCRAEGIPRIDFSWEKKGVFLDL-ANPRYEEKTVREGSFHTSTLRVVNVSAVMDYAVFSCYARNSLGEDKVDIQLVSTNHPDPPSMFRHVSSTHDSVTLEWIPGFNGGLQQKFRIRYQ 954          
BLAST of Nephrin vs. Ensembl Medaka
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:NCBI gene;Acc:101155460])

HSP 1 Score: 81.6481 bits (200), Expect = 9.976e-16
Identity = 101/408 (24.75%), Postives = 159/408 (38.97%), Query Frame = 1
Query:   28 TIYLNPASNPSVQSYQWLSEGSPIPYSRALR---VQDNSLTI---IRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDE------KEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISR----RRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIH-SVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQS 1200
            TI L  ++NP   S  WL     +     L    ++D SL I    R D  +   YT+   NE G       L+V +          D++ + D         A LIC A +NP      +I  M                              W +L +        +  +  S L I N+  +  G YQC  NN I   +G V N+ + V     + +    R+  S G+   +A+L C   G P+    W +    L L +  +++  + R GS   +++  VN     DY  + C A N +G     I+L S+  PD P   R V+ T+  + +EW  GFNGG +Q+F +      R+  D   S Q V+    +   + +  L   T Y   I + + I +S
Sbjct:  647 TIPLLVSANPEGVSCVWLHRRETLVKGNNLHHYWLEDGSLEIRNATRRDAGL---YTIKCENEEGVSQTAITLDVLYAC--------DVTAEKDPVFVNLGGTADLICVADANP------IISDMFS----------------------------WKWLGEEEVEMGEETQEDESSLLTIRNVTRAHSGLYQCTANNGI-GLSGSV-NMQLVVQFKPELQKGPQWRKVASRGDGSTTAELVCRAEGIPRIDFSWEKKGVFLDL-ANPRYEEKTVREGSFHTSTLRVVNVSAVMDYAVFSCYARNSLGEDKVDIQLVSTNHPDPPSMFRHVSSTHDSVTLEWIPGFNGGLQQKFRI------RYQWDQSVSFQYVDVFPPDATTFTVTGLQPVTVYNFSINALNAIGES 1000          
BLAST of Nephrin vs. Ensembl Medaka
Match: ENSORLT00000006523.2 (immunoglobulin superfamily member 9B [Source:NCBI gene;Acc:105355464])

HSP 1 Score: 66.2402 bits (160), Expect = 7.195e-11
Identity = 105/447 (23.49%), Postives = 175/447 (39.15%), Query Frame = 1
Query:   76 WLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQ----------------MLDKTYNWRLLYKERQE-----VISSSGSIQCNGDYWTYLA-KYRASCISV-------------------SNIEIMS--------TLHI-----WNLVPS-----------DMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQF---SGGELGQSAK----LFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIE--KQDYMNYFCQASNDIGSATARIR-LSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            WL EG  +  +    V D SLTI+    D    YT  A ++ G    T RL V     ++ P  E+++V    + A   C+A++ P        W+                ++D T    ++++ + E       S S S+  +     YL  +Y A  I++                   +N  + S        +L +     W+L+P             +G Y C+  N +       + ++ P  AT+V+     F    GGE  Q A     + C   G P    I +R +       GK  +     L SG      ++ F+   K+D+  + C A+N + S TA  R L   T P  P +I V+  T     V WE G++GGFEQ F V  K +     D HS+ +       ++  V+  L   T+Y+  + +++K+
Sbjct:  173 WLREGEELATNAKYSVHDGSLTILAITRDDRGAYTCRAYSDQGEVLHTTRLLVQGPPYIVSP-PENVTVN-ISQNALFTCQAEAYPGNLTYTWFWEEDNVYFKNDLKLRVRILIDGTL---IIFRVKPEDAGKYTCSPSNSLGISPSASAYLTVQYPARVINMPPVIYVPRKLPGIIRCPVDANPPVTSVKWEKDGYSLRVEKYPGWSLLPDGSIRVAEATEDSLGTYTCVPYNAL-----GTMGMSPP--ATLVLKDPPYFNVRPGGEYRQEAGRELVIPCAASGDPDIPTITWRKV-------GKPSRSKHNILPSG------SLQFLSLSKEDHGEWECVATNVVTSITASTRILVIGTSPHAPVSIHVLPSTTSA-NVSWEPGYDGGFEQTFSVWSKRIDFGPHDWHSMPVS----GAQIWLVVSGLEPGTEYQFSVLAQNKL 589          
BLAST of Nephrin vs. Ensembl Medaka
Match: ENSORLT00000031429.1 (immunoglobulin superfamily member 9B [Source:NCBI gene;Acc:105355464])

HSP 1 Score: 65.4698 bits (158), Expect = 1.321e-10
Identity = 93/383 (24.28%), Postives = 149/383 (38.90%), Query Frame = 1
Query:  115 LRVQ---DNSLTIIRSDVDMMRNYTLIARNEIG-TGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQM------LDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQF---SGGELGQSAK----LFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIE--KQDYMNYFCQASNDIGSATARIR-LSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSR----FSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            LRV+   D +L I R   +    YT    N +G + S +  L V + AR+I  +   +   P +    + C   +NP    T V W+       ++K   W LL           GSI+                             +       +G Y C+  N +       + ++ P  AT+V+     F    GGE  Q A     + C   G P    I +R +       GK  +     L SG      ++ F+   K+D+  + C A+N + S TA  R L   T P  P +I V+  T     V WE G++GGFEQ F V +  VS+       D HS+ +       ++  V+  L   T+Y+  + +++K+
Sbjct:  278 LRVRILIDGTLIIFRVKPEDAGKYTCSPSNSLGISPSASAYLTVQYPARVI--NMPPVIYVPRKLPGIIRCPVDANP--PVTSVKWEKDGYSLRVEKYPGWSLL---------PDGSIR-----------------------------VAEATEDSLGTYTCVPYNAL-----GTMGMSPP--ATLVLKDPPYFNVRPGGEYRQEAGRELVIPCAASGDPDIPTITWRKV-------GKPSRSKHNILPSG------SLQFLSLSKEDHGEWECVATNVVTSITASTRILVIGTSPHAPVSIHVLPSTTSA-NVSWEPGYDGGFEQTFSVWYGPVSKRIDFGPHDWHSMPVS----GAQIWLVVSGLEPGTEYQFSVLAQNKL 593          
BLAST of Nephrin vs. Ensembl Medaka
Match: ENSORLT00000042424.1 (immunoglobulin superfamily member 9B [Source:NCBI gene;Acc:105355464])

HSP 1 Score: 65.0846 bits (157), Expect = 1.373e-10
Identity = 93/383 (24.28%), Postives = 149/383 (38.90%), Query Frame = 1
Query:  115 LRVQ---DNSLTIIRSDVDMMRNYTLIARNEIG-TGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQM------LDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQF---SGGELGQSAK----LFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIE--KQDYMNYFCQASNDIGSATARIR-LSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSR----FSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKI 1191
            LRV+   D +L I R   +    YT    N +G + S +  L V + AR+I  +   +   P +    + C   +NP    T V W+       ++K   W LL           GSI+                             +       +G Y C+  N +       + ++ P  AT+V+     F    GGE  Q A     + C   G P    I +R +       GK  +     L SG      ++ F+   K+D+  + C A+N + S TA  R L   T P  P +I V+  T     V WE G++GGFEQ F V +  VS+       D HS+ +       ++  V+  L   T+Y+  + +++K+
Sbjct:  278 LRVRILIDGTLIIFRVKPEDAGKYTCSPSNSLGISPSASAYLTVQYPARVI--NMPPVIYVPRKLPGIIRCPVDANP--PVTSVKWEKDGYSLRVEKYPGWSLL---------PDGSIR-----------------------------VAEATEDSLGTYTCVPYNAL-----GTMGMSPP--ATLVLKDPPYFNVRPGGEYRQEAGRELVIPCAASGDPDIPTITWRKV-------GKPSRSKHNILPSG------SLQFLSLSKEDHGEWECVATNVVTSITASTRILVIGTSPHAPVSIHVLPSTTSA-NVSWEPGYDGGFEQTFSVWYGPVSKRIDFGPHDWHSMPVS----GAQIWLVVSGLEPGTEYQFSVLAQNKL 593          
BLAST of Nephrin vs. Planmine SMEST
Match: SMESG000021277.1 (SMESG000021277.1)

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 529/530 (99.81%), Postives = 530/530 (100.00%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILVXXXXXXXXXXXXXXXXXXXXXXXDKLKXXXXXXXXXXXXXXXXXXXXXXXXXXAFYLRKRRNKSHQNSNQNKIENSLGYMQCSNMEMYPTLNPNTRGSSINEISTNNSQRSLDSIKNNFKNNIDQV 1605
            GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILVKTKKTSSSEESSIYSTSSFKTTKDKLKSNNIIITITSVSVFVFVILVINILFVAFYLRKRRNKSHQNSNQNKIENSLGYMQCSNMEMYPTLNPNTRGSSINEISTNNSQRSLDSIKNNFKNNIDQ+
Sbjct:  772 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILVKTKKTSSSEESSIYSTSSFKTTKDKLKSNNIIITITSVSVFVFVILVINILFVAFYLRKRRNKSHQNSNQNKIENSLGYMQCSNMEMYPTLNPNTRGSSINEISTNNSQRSLDSIKNNFKNNIDQL 1301          
BLAST of Nephrin vs. Planmine SMEST
Match: SMESG000021277.1 (SMESG000021277.1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 529/530 (99.81%), Postives = 530/530 (100.00%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILVXXXXXXXXXXXXXXXXXXXXXXXDKLKXXXXXXXXXXXXXXXXXXXXXXXXXXAFYLRKRRNKSHQNSNQNKIENSLGYMQCSNMEMYPTLNPNTRGSSINEISTNNSQRSLDSIKNNFKNNIDQV 1605
            GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILVKTKKTSSSEESSIYSTSSFKTTKDKLKSNNIIITITSVSVFVFVILVINILFVAFYLRKRRNKSHQNSNQNKIENSLGYMQCSNMEMYPTLNPNTRGSSINEISTNNSQRSLDSIKNNFKNNIDQ+
Sbjct:  126 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLICKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVLNLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILVKTKKTSSSEESSIYSTSSFKTTKDKLKSNNIIITITSVSVFVFVILVINILFVAFYLRKRRNKSHQNSNQNKIENSLGYMQCSNMEMYPTLNPNTRGSSINEISTNNSQRSLDSIKNNFKNNIDQL 655          
BLAST of Nephrin vs. Planmine SMEST
Match: SMESG000003359.1 (SMESG000003359.1)

HSP 1 Score: 177.178 bits (448), Expect = 7.963e-47
Identity = 114/415 (27.47%), Postives = 204/415 (49.16%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKP---DEKEAKLICKAQSNPTGSQTRVIW-----QMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIE-SAAGKVLNLNVPVGATIVIS-RRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK-SVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G   +I +   ++PS+  Y WL    P+     +    +  +I+ +  +MM NY+L+  N +G  +F F LN+T+G  L+G   E I V P      +A ++C AQ+NP+  Q  V W     ++LD+     +L K +Q+ ISS   I+C   +     K   +CIS  ++EI++T+ I  +    +G Y+C++ N+ +   A K + L  P     V + R+ +F+    G+S +LFC+  G+P P V W     N +L +  K+     +   G + ++L ++   + D   Y C A N  G ++  + L+    P  P N  V+N+T   ++V W   FNGG +Q+  + W+   +  + D  +  + E+   +   + I +L  + +YEI I S ++   S     PI++
Sbjct:  766 GNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDIL-KGQQKFISSD-PIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKS-ELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIII 1177          
BLAST of Nephrin vs. Planmine SMEST
Match: SMESG000003359.1 (SMESG000003359.1)

HSP 1 Score: 176.792 bits (447), Expect = 8.393e-47
Identity = 114/415 (27.47%), Postives = 204/415 (49.16%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKP---DEKEAKLICKAQSNPTGSQTRVIW-----QMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIE-SAAGKVLNLNVPVGATIVIS-RRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK-SVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G   +I +   ++PS+  Y WL    P+     +    +  +I+ +  +MM NY+L+  N +G  +F F LN+T+G  L+G   E I V P      +A ++C AQ+NP+  Q  V W     ++LD+     +L K +Q+ ISS   I+C   +     K   +CIS  ++EI++T+ I  +    +G Y+C++ N+ +   A K + L  P     V + R+ +F+    G+S +LFC+  G+P P V W     N +L +  K+     +   G + ++L ++   + D   Y C A N  G ++  + L+    P  P N  V+N+T   ++V W   FNGG +Q+  + W+   +  + D  +  + E+   +   + I +L  + +YEI I S ++   S     PI++
Sbjct:  771 GNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDIL-KGQQKFISSD-PIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKS-ELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIII 1182          
BLAST of Nephrin vs. Planmine SMEST
Match: SMESG000003359.1 (SMESG000003359.1)

HSP 1 Score: 176.792 bits (447), Expect = 8.538e-47
Identity = 114/415 (27.47%), Postives = 204/415 (49.16%), Query Frame = 1
Query:   16 GQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKP---DEKEAKLICKAQSNPTGSQTRVIW-----QMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIE-SAAGKVLNLNVPVGATIVIS-RRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK-SVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILV 1227
            G   +I +   ++PS+  Y WL    P+     +    +  +I+ +  +MM NY+L+  N +G  +F F LN+T+G  L+G   E I V P      +A ++C AQ+NP+  Q  V W     ++LD+     +L K +Q+ ISS   I+C   +     K   +CIS  ++EI++T+ I  +    +G Y+C++ N+ +   A K + L  P     V + R+ +F+    G+S +LFC+  G+P P V W     N +L +  K+     +   G + ++L ++   + D   Y C A N  G ++  + L+    P  P N  V+N+T   ++V W   FNGG +Q+  + W+   +  + D  +  + E+   +   + I +L  + +YEI I S ++   S     PI++
Sbjct:  766 GNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDIL-KGQQKFISSD-PIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKS-ELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIII 1177          
The following BLAST results are available for this feature:
BLAST of Nephrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPHS16.651e-2222.50NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
NPHS17.307e-2222.50NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
IGSF91.354e-925.45immunoglobulin superfamily member 9 [Source:HGNC S... [more]
IGSF91.458e-925.45immunoglobulin superfamily member 9 [Source:HGNC S... [more]
DSCAM2.033e-921.39DS cell adhesion molecule [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Nephrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syg-22.455e-1624.78Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-22.785e-1624.78Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-22.793e-1624.78Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-23.115e-1624.78Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-23.160e-1624.78Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Nephrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sns3.890e-2924.72gene:FBgn0024189 transcript:FBtr0088635[more]
sns4.467e-2924.72gene:FBgn0024189 transcript:FBtr0339277[more]
sns5.083e-2924.72gene:FBgn0024189 transcript:FBtr0111043[more]
fred1.259e-2125.14gene:FBgn0051774 transcript:FBtr0308126[more]
fred1.344e-2125.00gene:FBgn0051774 transcript:FBtr0308127[more]
back to top
BLAST of Nephrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphs16.829e-1421.46NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
nphs17.435e-1421.46NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
nphs17.462e-1421.46NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
igsf103.289e-924.35immunoglobulin superfamily, member 10 [Source:ZFIN... [more]
igsf103.330e-923.89immunoglobulin superfamily, member 10 [Source:ZFIN... [more]
back to top
BLAST of Nephrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zcchc81.001e-1023.20zinc finger CCHC-type containing 8 [Source:Xenbase... [more]
zcchc81.068e-1022.99zinc finger CCHC-type containing 8 [Source:Xenbase... [more]
zcchc81.124e-1022.99zinc finger CCHC-type containing 8 [Source:Xenbase... [more]
zcchc81.398e-1022.99zinc finger CCHC-type containing 8 [Source:Xenbase... [more]
ccdc141.411e-1023.48coiled-coil domain containing 14 [Source:Xenbase;A... [more]
back to top
BLAST of Nephrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nphs12.699e-2021.72nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
Nphs13.204e-2021.72nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
Dscam1.297e-921.39DS cell adhesion molecule [Source:MGI Symbol;Acc:M... [more]
Igsf9b5.169e-928.09immunoglobulin superfamily, member 9B [Source:MGI ... [more]
Igsf9b5.375e-928.25immunoglobulin superfamily, member 9B [Source:MGI ... [more]
back to top
BLAST of Nephrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60500|NPHN_HUMAN3.509e-2122.50Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1[more]
sp|Q9R044|NPHN_RAT2.087e-2022.47Nephrin OS=Rattus norvegicus OX=10116 GN=Nphs1 PE=... [more]
sp|Q9QZS7|NPHN_MOUSE2.241e-1921.72Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=... [more]
sp|Q9U3P2|SYG2_CAEEL2.916e-1524.78Synaptogenesis protein syg-2 OS=Caenorhabditis ele... [more]
sp|Q24372|LACH_DROME1.129e-1129.25Lachesin OS=Drosophila melanogaster OX=7227 GN=Lac... [more]
back to top
BLAST of Nephrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M8S86.067e-5932.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M8R76.183e-5932.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y3Q68.341e-5931.61Nephrin OS=Clonorchis sinensis OX=79923 GN=CLF_100... [more]
A0A419PHD71.106e-5831.61Nephrin (Fragment) OS=Clonorchis sinensis OX=79923... [more]
A0A075AB302.410e-5832.59Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Nephrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphs13.989e-1124.02NPHS1 adhesion molecule, nephrin [Source:ZFIN;Acc:... [more]
mxra5a2.406e-1031.17matrix-remodeling-associated protein 5 [Source:NCB... [more]
mxra5a2.849e-1031.17matrix-remodeling-associated protein 5 [Source:NCB... [more]
LSAMP6.596e-1029.86limbic system associated membrane protein [Source:... [more]
cntn3b6.245e-932.00contactin-3-like [Source:NCBI gene;Acc:103046198][more]
back to top
BLAST of Nephrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008186.11.265e-1023.08pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
ENSPMAT00000008285.12.131e-825.16pep scaffold:Pmarinus_7.0:GL481193:15019:35761:-1 ... [more]
igdcc38.629e-824.60immunoglobulin superfamily, DCC subclass, member 3... [more]
ENSPMAT00000002502.11.710e-730.23pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
ENSPMAT00000004759.13.068e-722.80pep scaffold:Pmarinus_7.0:GL479237:38728:63566:1 g... [more]
back to top
BLAST of Nephrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nephrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO435163.242e-822.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274779.206e-828.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461001.924e-729.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452242.938e-731.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481793.908e-729.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nephrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphs19.801e-1725.28NPHS1 adhesion molecule, nephrin [Source:NCBI gene... [more]
nphs19.976e-1624.75NPHS1 adhesion molecule, nephrin [Source:NCBI gene... [more]
ENSORLT00000006523.27.195e-1123.49immunoglobulin superfamily member 9B [Source:NCBI ... [more]
ENSORLT00000031429.11.321e-1024.28immunoglobulin superfamily member 9B [Source:NCBI ... [more]
ENSORLT00000042424.11.373e-1024.28immunoglobulin superfamily member 9B [Source:NCBI ... [more]
back to top
BLAST of Nephrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021277.10.000e+099.81SMESG000021277.1[more]
SMESG000021277.10.000e+099.81SMESG000021277.1[more]
SMESG000003359.17.963e-4727.47SMESG000003359.1[more]
SMESG000003359.18.393e-4727.47SMESG000003359.1[more]
SMESG000003359.18.538e-4727.47SMESG000003359.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009392 ID=SMED30009392|Name=Nephrin|organism=Schmidtea mediterranea sexual|type=transcript|length=1673bp
CTTTAGTTTAATCCAGGGCAGCCTATCACTATCTATTTGAATCCGGCCTC
AAATCCGTCAGTCCAATCGTATCAGTGGCTGTCGGAAGGTTCGCCCATTC
CGTACAGCAGAGCATTACGAGTTCAAGACAATTCATTAACAATTATACGT
TCAGATGTGGACATGATGCGCAATTATACACTCATTGCTCGAAATGAAAT
CGGTACTGGAAGCTTTACATTTCGACTCAATGTTACTTTTGGAGCCAGAT
TAATTGGACCGGATTCCGAAGATATTTCTGTCAAACCCGACGAGAAAGAG
GCTAAATTAATTTGCAAAGCTCAATCAAATCCAACTGGCTCACAGACTCG
AGTGATCTGGCAAATGCTAGATAAAACCTACAACTGGAGACTACTTTATA
AAGAGAGACAAGAAGTCATTTCTTCAAGTGGCTCAATACAATGCAATGGA
GATTATTGGACATATTTGGCAAAATACCGAGCTAGCTGTATATCTGTCAG
TAATATAGAAATAATGAGTACATTGCATATATGGAATCTGGTCCCCTCAG
ATATGGGCAGATACCAATGTCTCGTCAACAACACGATTGAGTCGGCTGCT
GGCAAAGTTTTGAATCTAAATGTCCCAGTTGGAGCCACAATAGTAATCTC
ACGTCGGCGACAGTTTTCCGGTGGAGAGTTGGGACAAAGTGCGAAATTGT
TTTGTTGGGTATTTGGGTATCCGAAACCAAAAGTTATTTGGTATCGGGAT
ATCTCAAATTTGACATTGATATCGGGGAAAAAATTTCAATACGATTCGGA
ACGACTTGGAAGCGGATTGTATAATTCTATATTGACTGTCAATTTCATTG
AGAAACAAGATTATATGAATTATTTTTGTCAGGCATCGAATGATATTGGA
TCTGCTACAGCAAGAATTCGTTTGTCATCATCAACAAAACCTGACATTCC
ATTTAATATTCGCGTTGTAAATATTACAAATAAAATGATAGCTGTTGAAT
GGGAACAAGGATTTAATGGGGGATTCGAGCAAGAATTTATTGTATCGTGG
AAGTCTGTCAGTCGGTTCAGTTCCGATATTCATTCAGTTCAGCTTGTGGA
GAATATGTTGGATGAAAAACTGATTTATGTAATCAAAGATTTATTATCAT
CCACCCAGTATGAAATACGAATTTGTTCTAAAAGTAAAATATTTCAAAGC
TGTCAGTTCTCTTCACCAATTTTAGTAAAAACAAAAAAAACTAGTTCAAG
TGAAGAATCAAGTATTTATTCCACTTCATCTTTCAAAACTACCAAAGATA
AACTCAAGTCTAATAATATTATTATCACAATTACCTCAGTTTCAGTTTTT
GTTTTTGTCATTCTTGTGATCAATATTTTGTTTGTTGCTTTTTATTTACG
AAAAAGAAGAAACAAATCACATCAAAATTCAAATCAAAACAAAATTGAAA
ATTCTTTAGGTTACATGCAGTGCTCAAACATGGAAATGTACCCAACCCTC
AACCCGAACACGCGAGGTTCCTCAATCAACGAAATCTCGACAAACAATTC
TCAGAGAAGTTTAGATAGTATTAAAAATAATTTTAAAAACAATATTGATC
AAGTAACTATTTTTTATTTTACTCCAGAAAAATATATAAAAAAATATATC
GGAATATATACATGAGATGTACA
back to top

protein sequence of SMED30009392-orf-1

>SMED30009392-orf-1 ID=SMED30009392-orf-1|Name=SMED30009392-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=501bp
MMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEKEAKLI
CKAQSNPTGSQTRVIWQMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWT
YLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIESAAGKVL
NLNVPVGATIVISRRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNL
TLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATA
RIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWKSVS
RFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFS
SPILVKTKKTSSSEESSIYSTSSFKTTKDKLKSNNIIITITSVSVFVFVI
LVINILFVAFYLRKRRNKSHQNSNQNKIENSLGYMQCSNMEMYPTLNPNT
RGSSINEISTNNSQRSLDSIKNNFKNNIDQVTIFYFTPEKYIKKYIGIYT
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR003599Ig_sub
IPR003961FN3_dom
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR013320ConA-like_dom_sf
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 35..155
e-value: 0.01
score: 25.0
coord: 166..257
e-value: 0.026
score: 23.7
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 260..346
e-value: 2.0E-5
score: 34.0
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 262..360
score: 11.89
IPR003961Fibronectin type IIICDDcd00063FN3coord: 260..346
e-value: 7.76877E-6
score: 42.4835
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 172..246
e-value: 0.0089
score: 25.2
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 173..254
e-value: 4.0E-11
score: 42.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 259..366
e-value: 1.3E-9
score: 40.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 33..166
e-value: 6.2E-8
score: 34.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 167..258
e-value: 2.1E-14
score: 55.4
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 119..465
NoneNo IPR availablePANTHERPTHR11640:SF102coord: 119..465
NoneNo IPR availableCDDcd00096Igcoord: 47..149
e-value: 5.58606E-4
score: 36.4513
NoneNo IPR availableCDDcd00096Igcoord: 177..253
e-value: 1.46759E-6
score: 43.7701
NoneNo IPR availableTMHMMTMhelixcoord: 386..408
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 155..255
score: 10.19
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 33..153
score: 7.794
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 246..357
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 173..263
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 37..154