SMED30009385

Overview
NameSMED30009385
Smed IDSMED30009385
Length (bp)1073
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009385 (SMED30009385) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009385 (SMED30009385) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009385 (SMED30009385) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009385 (SMED30009385) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009385

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009385h1SMcG0004308 Contig1301GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30009385h1SMcG0004308 Contig39124uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009385h1SMcG0004308 Contig39124newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30009385h1SMcG0004308 dd_Smed_v4_1365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009385h1SMcG0004308 dd_Smed_v4_1365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009385h1SMcG0004308 dd_Smed_v4_1365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009385 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007050:34043..40266 +4254
Homology
BLAST of SMED30009385 vs. Ensembl Human
Match: M6PR (mannose-6-phosphate receptor, cation dependent [Source:HGNC Symbol;Acc:HGNC:6752])

HSP 1 Score: 90.1225 bits (222), Expect = 4.235e-20
Identity = 52/156 (33.33%), Postives = 83/156 (53.21%), Query Frame = -2
Query:  305 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDN 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN      +   + E   K  +C+YLFE+  + AC+       S L  GSI ++    ++ +Y++GG + ++L     G+E  P++ FW+  GN  A+  D+VCR    N
Sbjct:   99 KETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPE----ISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN 250          
BLAST of SMED30009385 vs. Ensembl Human
Match: M6PR (mannose-6-phosphate receptor, cation dependent [Source:HGNC Symbol;Acc:HGNC:6752])

HSP 1 Score: 58.151 bits (139), Expect = 4.854e-10
Identity = 35/117 (29.91%), Postives = 61/117 (52.14%), Query Frame = -2
Query:  344 GDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFA 694
            GD Y +HC    + +++MI CN      +   + E   K  +C+YLFE+  + AC+       S L  GSI ++    ++ +Y++GG + ++L     G+E  P++ FW+  GN  A
Sbjct:    3 GDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPE----ISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVA 115          
BLAST of SMED30009385 vs. Ensembl Human
Match: M6PR (mannose-6-phosphate receptor, cation dependent [Source:HGNC Symbol;Acc:HGNC:6752])

HSP 1 Score: 50.447 bits (119), Expect = 3.945e-7
Identity = 31/98 (31.63%), Postives = 53/98 (54.08%), Query Frame = -2
Query:  305 IEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDN 598
            + E   K  +C+YLFE+  + AC+       S L  GSI ++    ++ +Y++GG + ++L     G+E  P++ FW+  GN  A+  D+VCR    N
Sbjct:   28 VSEERGKVQDCFYLFEMDSSLACSPE----ISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN 121          
BLAST of SMED30009385 vs. Ensembl Human
Match: M6PR (mannose-6-phosphate receptor, cation dependent [Source:HGNC Symbol;Acc:HGNC:6752])

HSP 1 Score: 48.9062 bits (115), Expect = 7.167e-7
Identity = 21/48 (43.75%), Postives = 29/48 (60.42%), Query Frame = -2
Query:  629 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICN 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN
Sbjct:   45 KETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCN 92          
BLAST of SMED30009385 vs. Ensembl Human
Match: M6PR (mannose-6-phosphate receptor, cation dependent [Source:HGNC Symbol;Acc:HGNC:6752])

HSP 1 Score: 49.2914 bits (116), Expect = 2.159e-6
Identity = 21/48 (43.75%), Postives = 29/48 (60.42%), Query Frame = -2
Query:  629 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICN 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN
Sbjct:   99 KETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCN 146          
BLAST of SMED30009385 vs. Ensembl Zebrafish
Match: m6pr (mannose-6-phosphate receptor (cation dependent) [Source:ZFIN;Acc:ZDB-GENE-040426-2285])

HSP 1 Score: 76.2554 bits (186), Expect = 2.071e-15
Identity = 53/151 (35.10%), Postives = 80/151 (52.98%), Query Frame = -2
Query:  320 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCR 772
            K   IG ++ T    G++W  L Y  G+ Y SHC +  + ++IMI C+   +     ++EEN  K   CYYLFEL     C       +S L  GSI +I+++  + +Y+IGG + ++L     G+E  PN  FW   GN  A+  D+VCR
Sbjct:   87 KTIRIGDYSKTVATAGSDWVLLIYEGGEKYDSHCSSEERKAMIMISCSSSSKSAFSVVMEEN-QKQKNCYYLFELDTTAVCPA----VSSKLSAGSIVLIVVISSLTVYIIGGFLYQRLVVGAKGVEQFPNFAFWSEIGNLSADGCDFVCR 232          
BLAST of SMED30009385 vs. Ensembl Zebrafish
Match: m6pr (mannose-6-phosphate receptor (cation dependent) [Source:ZFIN;Acc:ZDB-GENE-040426-2285])

HSP 1 Score: 76.2554 bits (186), Expect = 2.071e-15
Identity = 53/151 (35.10%), Postives = 80/151 (52.98%), Query Frame = -2
Query:  320 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCR 772
            K   IG ++ T    G++W  L Y  G+ Y SHC +  + ++IMI C+   +     ++EEN  K   CYYLFEL     C       +S L  GSI +I+++  + +Y+IGG + ++L     G+E  PN  FW   GN  A+  D+VCR
Sbjct:   87 KTIRIGDYSKTVATAGSDWVLLIYEGGEKYDSHCSSEERKAMIMISCSSSSKSAFSVVMEEN-QKQKNCYYLFELDTTAVCPA----VSSKLSAGSIVLIVVISSLTVYIIGGFLYQRLVVGAKGVEQFPNFAFWSEIGNLSADGCDFVCR 232          
BLAST of SMED30009385 vs. Ensembl Xenopus
Match: tpbgl (trophoblast glycoprotein like [Source:Xenbase;Acc:XB-GENE-6469693])

HSP 1 Score: 99.3673 bits (246), Expect = 1.745e-23
Identity = 62/159 (38.99%), Postives = 91/159 (57.23%), Query Frame = -2
Query:  293 VIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVC--RPNTDNYKYQ 763
            VIGR N+T I  G++W  L Y SGD Y +HC+N  + +++MI CN         +I+E  NK+SEC+YLFE+  + AC   +    S L  GSI +I+   ++ +YLIGG + ++      G+E  PNI  W+  GN  A+  D+VC  RP T    Y+
Sbjct:   97 VIGRINDTHIINGSDWIMLYYRSGDKYDTHCNNEARKAMVMISCNKGTVGDGFTVIQEERNKSSECFYLFEMDSSLACPPEE----SHLSAGSILLIVFAVLVAVYLIGGFLYQRFVVGAKGMEQFPNITLWQELGNLSADGCDFVCRSRPRTSETAYR 251          
BLAST of SMED30009385 vs. Ensembl Mouse
Match: M6pr (mannose-6-phosphate receptor, cation dependent [Source:MGI Symbol;Acc:MGI:96904])

HSP 1 Score: 90.1225 bits (222), Expect = 3.044e-20
Identity = 54/156 (34.62%), Postives = 84/156 (53.85%), Query Frame = -2
Query:  305 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDN 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN      +   + E   K  +C+YLFE+  + AC+       S L  GSI ++I   ++ +Y+IGG + ++L     G+E  P++ FW+  GN  A+  D+VCR    N
Sbjct:  100 KETVVGRINETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAANFNPVSEERGKVQDCFYLFEMDSSLACSPE----VSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN 251          
BLAST of SMED30009385 vs. Ensembl Mouse
Match: M6pr (mannose-6-phosphate receptor, cation dependent [Source:MGI Symbol;Acc:MGI:96904])

HSP 1 Score: 90.1225 bits (222), Expect = 3.044e-20
Identity = 54/156 (34.62%), Postives = 84/156 (53.85%), Query Frame = -2
Query:  305 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDN 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN      +   + E   K  +C+YLFE+  + AC+       S L  GSI ++I   ++ +Y+IGG + ++L     G+E  P++ FW+  GN  A+  D+VCR    N
Sbjct:  100 KETVVGRINETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAANFNPVSEERGKVQDCFYLFEMDSSLACSPE----VSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN 251          
BLAST of SMED30009385 vs. UniProt/SwissProt
Match: sp|P11456|MPRD_BOVIN (Cation-dependent mannose-6-phosphate receptor OS=Bos taurus OX=9913 GN=M6PR PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.701e-20
Identity = 54/156 (34.62%), Postives = 85/156 (54.49%), Query Frame = -2
Query:  305 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDN 772
            K+ V+GRFN T I  G+NW  L Y  GD Y +HC    + +++MI CN      +   + E   K  +C+YLFE+  + AC+       S L  GSI ++ +  ++ +Y+IGG + ++L     G+E  P++ FW+  GN  A+  D+VCR    N
Sbjct:  101 KETVVGRFNETQIFNGSNWIMLIYKGGDEYDNHCGREQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPE----ISHLSVGSILLVTLASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN 252          
BLAST of SMED30009385 vs. UniProt/SwissProt
Match: sp|Q6AY20|MPRD_RAT (Cation-dependent mannose-6-phosphate receptor OS=Rattus norvegicus OX=10116 GN=M6pr PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.064e-19
Identity = 54/151 (35.76%), Postives = 84/151 (55.63%), Query Frame = -2
Query:  320 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCR 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN     G+   + E   K  +C+YLFE+  + AC+       S L  GSI ++I   ++ +Y+IGG + ++L     G+E  P++ FW+  GN  A+  D+VCR
Sbjct:  100 KETVVGRINETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAGNFNPVSEERGKIQDCFYLFEMDSSLACSPE----VSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCR 246          
BLAST of SMED30009385 vs. UniProt/SwissProt
Match: sp|P20645|MPRD_HUMAN (Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.034e-19
Identity = 52/156 (33.33%), Postives = 83/156 (53.21%), Query Frame = -2
Query:  305 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDN 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN      +   + E   K  +C+YLFE+  + AC+       S L  GSI ++    ++ +Y++GG + ++L     G+E  P++ FW+  GN  A+  D+VCR    N
Sbjct:   99 KETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPE----ISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN 250          
BLAST of SMED30009385 vs. UniProt/SwissProt
Match: sp|P24668|MPRD_MOUSE (Cation-dependent mannose-6-phosphate receptor OS=Mus musculus OX=10090 GN=M6pr PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.129e-19
Identity = 54/156 (34.62%), Postives = 84/156 (53.85%), Query Frame = -2
Query:  305 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDN 772
            K+ V+GR N T I  G+NW  L Y  GD Y +HC    + +++MI CN      +   + E   K  +C+YLFE+  + AC+       S L  GSI ++I   ++ +Y+IGG + ++L     G+E  P++ FW+  GN  A+  D+VCR    N
Sbjct:  100 KETVVGRINETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAANFNPVSEERGKVQDCFYLFEMDSSLACSPE----VSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRN 251          
BLAST of SMED30009385 vs. TrEMBL
Match: Q7T0X9 (M6pr-prov protein OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 3.715e-23
Identity = 64/159 (40.25%), Postives = 93/159 (58.49%), Query Frame = -2
Query:  293 VIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVC--RPNTDNYKYQ 763
            VIGR N+T I  G +W  L YGSGD Y SHC+N  + +++MI CN  +      +I+E  NK+ EC+YLFE+  + AC   +    S LG GSI +I+   ++ +Y+IGG + ++      G+E  PNI FW+  GN  A+  D+VC  RP T    Y+
Sbjct:   98 VIGRINDTHIMSGTDWILLIYGSGDKYDSHCNNEARKAMVMISCNKKMLGDHFAVIQEERNKSRECFYLFEMDSSLACPPEE----SHLGVGSILLIVFAVLVAVYIIGGFLYQRFVVGAKGMEQFPNITFWQELGNLMADGCDFVCRSRPRTSETAYR 252          
BLAST of SMED30009385 vs. TrEMBL
Match: A0A1L8FIC6 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18034317mg PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.355e-22
Identity = 64/159 (40.25%), Postives = 92/159 (57.86%), Query Frame = -2
Query:  293 VIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVC--RPNTDNYKYQ 763
            VIGR N+T I  G +W  L YGSGD Y SHC+N  + +++MI CN         +I+E  NK+ EC+YLFE+  + AC   +    S LG GSI +I+   ++ +Y+IGG + ++      G+E  PNI FW+  GN  A+  D+VC  RP T    Y+
Sbjct:   98 VIGRINDTHIMSGTDWILLIYGSGDKYDSHCNNEARKAMVMISCNKKTLGDHFAVIQEERNKSRECFYLFEMDSSLACPPEE----SHLGVGSILLIVFAVLVAVYIIGGFLYQRFVVGAKGMEQFPNITFWQELGNLMADGCDFVCRSRPRTSETAYR 252          
BLAST of SMED30009385 vs. TrEMBL
Match: A9UMN8 (LOC496207 protein OS=Xenopus laevis OX=8355 GN=LOC496207 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.532e-22
Identity = 59/159 (37.11%), Postives = 94/159 (59.12%), Query Frame = -2
Query:  293 VIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVC--RPNTDNYKYQ 763
            VIGR N+T I  G +W  L YGSGD Y +HC++  + +++MI C+    +G   +++E  NK+ EC+YLFE+  + AC   +    S L  GSI +I+   ++ +Y++GG + ++      G+E  PNI FW+  GN  A+  D+VC  RP T +  Y+
Sbjct:   96 VIGRINDTHIISGTDWILLIYGSGDKYDNHCNSEARKAMVMISCSKKTLRGDFTVVQEERNKSRECFYLFEMDSSLACPPEE----SHLSVGSILLIVFAVLVAVYIVGGFLYQRFVVGAKGMEQFPNITFWQELGNLMADGCDFVCRSRPRTSDTAYR 250          
BLAST of SMED30009385 vs. TrEMBL
Match: Q32NU6 (M6pr protein OS=Xenopus laevis OX=8355 GN=m6pr PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.712e-22
Identity = 64/159 (40.25%), Postives = 92/159 (57.86%), Query Frame = -2
Query:  293 VIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVC--RPNTDNYKYQ 763
            VIGR N+T I  G +W  L YGSGD Y SHC+N  + +++MI CN         +I+E  NK+ EC+YLFE+  + AC   +    S LG GSI +I+   ++ +Y+IGG + ++      G+E  PNI FW+  GN  A+  D+VC  RP T    Y+
Sbjct:   98 VIGRINDTHIMSGTDWILLIYGSGDKYDSHCNNEARKAMVMISCNKKTLGDHFAVIQEERNKSRECFYLFEMDSSLACPPEE----SHLGVGSILLIVFAVLVAVYIIGGFLYQRFVVGAKGMEQFPNITFWQELGNLMADGCDFVCRSRPRTSETAYR 252          
BLAST of SMED30009385 vs. TrEMBL
Match: A0A2T7PPW5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02421 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 4.056e-22
Identity = 63/153 (41.18%), Postives = 91/153 (59.48%), Query Frame = -2
Query:  320 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGS--LKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCR 772
            K   IG++N TDIK G NW +L+Y  G+ Y SHC+N  + ++I+I C+P+    +  L++IEE+ N+T  CYYLFEL H + C         SL  GSI +I+   V  +YLI G + ++      GIE IPN  FW+  GN  A+  D++CR
Sbjct:   94 KPVKIGQYNQTDIKAGKNWVYLEYLEGEKYNSHCNNEKRKAVILITCDPEATDNANPLEIIEESKNRTEGCYYLFELAHPEVCEVE--TQNKSLSVGSIVLIVFSCVAAVYLIAGALYQRFVLGAKGIEQIPNYEFWKDFGNLQADGCDFICR 244          
BLAST of SMED30009385 vs. Ensembl Cavefish
Match: m6pr (mannose-6-phosphate receptor, cation dependent [Source:NCBI gene;Acc:103031197])

HSP 1 Score: 80.8777 bits (198), Expect = 4.919e-18
Identity = 52/148 (35.14%), Postives = 77/148 (52.03%), Query Frame = -2
Query:  320 VIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCR 763
            +IG +N+T    G++W  L Y  G+ Y +HC    + +IIM+ CN       L ++ E   +  +C+YLFEL  +  C        S L  GSI +II    + +YLIGG + ++L     G+E  PN  FW   GN  A+  D+VCR
Sbjct:   94 LIGSYNDTQAIKGSDWIMLIYRGGEKYDTHCSKEERKAIIMLSCNKSAVVPELTVVLEQRERLLDCFYLFELDSSALCPVTP----SQLSAGSILLIIGFSCLAVYLIGGFLYQRLVVGAKGVEQFPNYAFWSEIGNLSADGCDFVCR 237          

HSP 2 Score: 29.261 bits (64), Expect = 4.919e-18
Identity = 19/47 (40.43%), Postives = 26/47 (55.32%), Query Frame = -1
Query:  765 ESIQGEIFNTTDDGTYKYSFGICVNPENKPGDYSSVIQYSIKDGKKI 905
            +S  G+  N T   +Y Y F +C + E K G  + VIQ  +KDGK I
Sbjct:   49 QSFTGKYVNGTS--SYTYIFRVCDDVEGKQG--AGVIQKELKDGKPI 91          
BLAST of SMED30009385 vs. Ensembl Nematostella
Match: EDO46637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP75])

HSP 1 Score: 70.4774 bits (171), Expect = 5.367e-14
Identity = 40/140 (28.57%), Postives = 71/140 (50.71%), Query Frame = -2
Query:  320 NWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEE------NTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCR 721
            +W  + Y +G  Y SHC  T + S +M+ C+P  ++G+LK+IEE      + N+  +CYYLFE+ +  AC       +       + VI+    + +    G + ++      G+E IPN   W+  G+  A+  +++CR
Sbjct:   84 DWFLISYPNGKKYNSHCGGTQRRSDVMVTCDPTADRGTLKIIEEYIYNSSSPNQGDQCYYLFEINNKAACTVKPSSLSPGSIILIVFVIVACVYLFL----GFLYQRFIVGAKGMEQIPNYNLWKNFGSLQADGCNFLCR 219          
BLAST of SMED30009385 vs. Ensembl Medaka
Match: m6pr (mannose-6-phosphate receptor, cation dependent [Source:NCBI gene;Acc:101170458])

HSP 1 Score: 91.2781 bits (225), Expect = 1.514e-20
Identity = 54/151 (35.76%), Postives = 86/151 (56.95%), Query Frame = -2
Query:  320 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCR 772
            K  V+G + +T    G++W  L Y SG+ Y  HC    + + IMI CN + + G L+++ E+ N++++C+YLFEL  +  C   +    S L  GSI +II   ++ +YL+GG + ++L     G+E  PN  FW   GN  A+  D+VCR
Sbjct:  122 KPTVVGMYTDTQAIGGSDWVMLIYRSGEAYDQHCSQEKRKAYIMISCNRNTDMGQLEVVVEDRNRSTDCFYLFELDSSTVCPAIE----SHLSPGSIILIIAFVLLALYLVGGFLYQRLIVGAKGMEQFPNYAFWVEVGNLAADGCDFVCR 268          
BLAST of SMED30009385 vs. Planmine SMEST
Match: SMESG000031786.1 (SMESG000031786.1)

HSP 1 Score: 286.574 bits (732), Expect = 2.531e-125
Identity = 189/190 (99.47%), Postives = 190/190 (100.00%), Query Frame = -2
Query:  203 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDNYKYQRYXXXXXXXXXLTINXXXXXXXXDEILVLP 772
            KKYVIGRFNNTDIKIG+NWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQILSTSSLGGGSIAVIIMVFVIVIYLIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDNYKYQRYNLSSNNNNNLTINDLDPGDDDDEILVLP
Sbjct:   90 KKYVIGRFNNTDIKIGSNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQILSTSSLGGGSIAVIIMVFVIVIYLIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDNYKYQRYNLSSNNNNNLTINDLDPGDDDDEILVLP 279          

HSP 2 Score: 182.185 bits (461), Expect = 2.531e-125
Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = -1
Query:  768 KKINFYILSIFFSLNLIYIEGGFTNSTCQFPLHQILHKGMIFLESIQGEIFNTTDDGTYKYSFGICVNPENKPGDYSSVIQYSIKDGKK 1034
            KKINFYILSIFFSLNLIYIEGGFTNSTCQFPLHQILHKGMIFLESIQGEIFNTTDDGTYKYSFGICVNPENKPGDYSSVIQYSIKDGKK
Sbjct:    3 KKINFYILSIFFSLNLIYIEGGFTNSTCQFPLHQILHKGMIFLESIQGEIFNTTDDGTYKYSFGICVNPENKPGDYSSVIQYSIKDGKK 91          
BLAST of SMED30009385 vs. Planmine SMEST
Match: SMESG000031786.1 (SMESG000031786.1)

HSP 1 Score: 285.804 bits (730), Expect = 9.255e-102
Identity = 189/190 (99.47%), Postives = 190/190 (100.00%), Query Frame = -2
Query:  203 KKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQIXXXXXXXXXSXXXXXXXXXXXXXXIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDNYKYQRYXXXXXXXXXLTINXXXXXXXXDEILVLP 772
            KKYVIGRFNNTDIKIG+NWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQILSTSSLGGGSIAVIIMVFVIVIYLIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDNYKYQRYNLSSNNNNNLTINDLDPGDDDDEILVLP
Sbjct:   49 KKYVIGRFNNTDIKIGSNWAFLKYGSGDPYRSHCDNTYKNSIIMIICNPDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQILSTSSLGGGSIAVIIMVFVIVIYLIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDYVCRPNTDNYKYQRYNLSSNNNNNLTINDLDPGDDDDEILVLP 238          

HSP 2 Score: 103.99 bits (258), Expect = 9.255e-102
Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = -1
Query:  768 MIFLESIQGEIFNTTDDGTYKYSFGICVNPENKPGDYSSVIQYSIKDGKK 917
            MIFLESIQGEIFNTTDDGTYKYSFGICVNPENKPGDYSSVIQYSIKDGKK
Sbjct:    1 MIFLESIQGEIFNTTDDGTYKYSFGICVNPENKPGDYSSVIQYSIKDGKK 50          
The following BLAST results are available for this feature:
BLAST of SMED30009385 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
M6PR4.235e-2033.33mannose-6-phosphate receptor, cation dependent [So... [more]
M6PR4.854e-1029.91mannose-6-phosphate receptor, cation dependent [So... [more]
M6PR3.945e-731.63mannose-6-phosphate receptor, cation dependent [So... [more]
M6PR7.167e-743.75mannose-6-phosphate receptor, cation dependent [So... [more]
M6PR2.159e-643.75mannose-6-phosphate receptor, cation dependent [So... [more]
back to top
BLAST of SMED30009385 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009385 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009385 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
m6pr2.071e-1535.10mannose-6-phosphate receptor (cation dependent) [S... [more]
m6pr2.071e-1535.10mannose-6-phosphate receptor (cation dependent) [S... [more]
back to top
BLAST of SMED30009385 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpbgl1.745e-2338.99trophoblast glycoprotein like [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30009385 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
M6pr3.044e-2034.62mannose-6-phosphate receptor, cation dependent [So... [more]
M6pr3.044e-2034.62mannose-6-phosphate receptor, cation dependent [So... [more]
back to top
BLAST of SMED30009385 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P11456|MPRD_BOVIN3.701e-2034.62Cation-dependent mannose-6-phosphate receptor OS=B... [more]
sp|Q6AY20|MPRD_RAT1.064e-1935.76Cation-dependent mannose-6-phosphate receptor OS=R... [more]
sp|P20645|MPRD_HUMAN2.034e-1933.33Cation-dependent mannose-6-phosphate receptor OS=H... [more]
sp|P24668|MPRD_MOUSE2.129e-1934.62Cation-dependent mannose-6-phosphate receptor OS=M... [more]
back to top
BLAST of SMED30009385 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q7T0X93.715e-2340.25M6pr-prov protein OS=Xenopus laevis OX=8355 PE=2 S... [more]
A0A1L8FIC61.355e-2240.25Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A9UMN81.532e-2237.11LOC496207 protein OS=Xenopus laevis OX=8355 GN=LOC... [more]
Q32NU61.712e-2240.25M6pr protein OS=Xenopus laevis OX=8355 GN=m6pr PE=... [more]
A0A2T7PPW54.056e-2241.18Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of SMED30009385 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
m6pr4.919e-1835.14mannose-6-phosphate receptor, cation dependent [So... [more]
back to top
BLAST of SMED30009385 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009385 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009385 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO466375.367e-1428.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30009385 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
m6pr1.514e-2035.76mannose-6-phosphate receptor, cation dependent [So... [more]
back to top
BLAST of SMED30009385 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000031786.12.531e-12599.47SMESG000031786.1[more]
SMESG000031786.19.255e-10299.47SMESG000031786.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009385 ID=SMED30009385|Name=SMED30009385|organism=Schmidtea mediterranea sexual|type=transcript|length=1073bp
CCGCCACCAGAATATTCTAATTTTAACTTTACCGACATAAATATTTATCC
AATGTTGAATCGCACAGTGATTAAATTACACTAAATTTATAAGATAATCG
TGAAATTGTAATTGAAATTAAAATTTTTTTTTAAAAATGAAGACTCAATT
TTATTAAAGTGTAAAAAATACATTGCAGCAACTCGATAATTAACTTTTCC
TACGGTAAGACCAGAATTTCGTCATCATCATCTCCAGGATCTAGATCGTT
TATAGTTAAATTATTGTTATTGTTTGATGACAAATTGTATCTTTGGTATT
TGTAGTTATCAGTGTTGGGCCTGCACACGTAATCCACGCAATTTGCAAAA
CAATTGCCACAGCGCCTCCAGAATCCGATATTTGGAATGAGTTCTATCCC
ATCCTGATTGTAGAATAGCTTCTTAATGACCATGCCGCCAATAAGGTAGA
TAACAATTACAAATACCATTATTATCACAGCAATAGATCCGCCACCAAGG
GAACTTGTAGATAAAATTTGATTAGTATTACAAGCTTTTGCATGTTGTAA
TTCAAACAAATAATAGCATTCACTTGTTTTGTTCGTATTTTCTTCAATAA
GTTTCAGAGAACCTTTCTCTAAATCAGGATTGCATATAATCATAATTATG
GAATTTTTATAAGTATTGTCGCAATGACTGCGGTAAGGATCTCCAGAACC
ATATTTTAGAAATGCCCAATTATTTCCAATTTTAATATCTGTGTTATTAA
ATCTACCTATAACATATTTTTTTACCATCCTTTATACTGTATTGAATAAC
TGATGAATAATCTCCTGGTTTATTTTCAGGATTGACACAGATTCCAAATG
AATACTTATAAGTGCCATCGTCAGTAGTGTTGAAAATTTCACCTTGAATA
CTTTCAAGAAAAATCATTCCCTTGTGTAAAATCTGATGCAAAGGAAATTG
ACATGTTGAATTAGTAAAACCGCCTTCTATGTATATCAAATTTAGTGAAA
AAAATATAGATAAAATATAAAAGTTAATTTTTTTTATTCATATTACTCGA
AAAATAAGAAGTGAAGAAGGACA
back to top

protein sequence of SMED30009385-orf-1

>SMED30009385-orf-1 ID=SMED30009385-orf-1|Name=SMED30009385-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MVKKYVIGRFNNTDIKIGNNWAFLKYGSGDPYRSHCDNTYKNSIIMIICN
PDLEKGSLKLIEENTNKTSECYYLFELQHAKACNTNQILSTSSLGGGSIA
VIIMVFVIVIYLIGGMVIKKLFYNQDGIELIPNIGFWRRCGNCFANCVDY
VCRPNTDNYKYQRYNLSSNNNNNLTINDLDPGDDDDEILVLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000296Man_6_P_rcpt
IPR009011Man6P_isomerase_rcpt-bd_dom_sf
IPR028927Man-6-P_rcpt
Vocabulary: molecular function
TermDefinition
GO:0005537mannose binding
GO:0015578mannose transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0000323lytic vacuole
Vocabulary: biological process
TermDefinition
GO:0015761mannose transport