DEAD/DEAH box helicase

Overview
NameDEAD/DEAH box helicase
Smed IDSMED30009341
Length (bp)610
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DEAD/DEAH box helicase (SMED30009341) t-SNE clustered cells

Violin plots show distribution of expression levels for DEAD/DEAH box helicase (SMED30009341) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DEAD/DEAH box helicase (SMED30009341) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DEAD/DEAH box helicase (SMED30009341) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009341

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009341SMESG000046681.1 Contig2611newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009341SMESG000046681.1 Contig2611uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DEAD/DEAH box helicase vs. Ensembl Human
Match: DDX6 (DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2747])

HSP 1 Score: 41.2022 bits (95), Expect = 1.982e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  218 VVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDII 264          

HSP 2 Score: 30.8018 bits (68), Expect = 1.982e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  271 RQILLYSATFPLSVQKF 287          

HSP 3 Score: 27.335 bits (59), Expect = 1.982e-9
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  224 NIIGTSGGTSLNDDIVRLQQT 286
             ++ T+GGT+L DDI+RL  T
Sbjct:  195 KVMATTGGTNLRDDIMRLDDT 215          
BLAST of DEAD/DEAH box helicase vs. Ensembl Human
Match: DDX6 (DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2747])

HSP 1 Score: 41.2022 bits (95), Expect = 1.982e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  218 VVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDII 264          

HSP 2 Score: 30.8018 bits (68), Expect = 1.982e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  271 RQILLYSATFPLSVQKF 287          

HSP 3 Score: 27.335 bits (59), Expect = 1.982e-9
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  224 NIIGTSGGTSLNDDIVRLQQT 286
             ++ T+GGT+L DDI+RL  T
Sbjct:  195 KVMATTGGTNLRDDIMRLDDT 215          
BLAST of DEAD/DEAH box helicase vs. Ensembl Human
Match: DDX6 (DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2747])

HSP 1 Score: 41.2022 bits (95), Expect = 1.982e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  218 VVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDII 264          

HSP 2 Score: 30.8018 bits (68), Expect = 1.982e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  271 RQILLYSATFPLSVQKF 287          

HSP 3 Score: 27.335 bits (59), Expect = 1.982e-9
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  224 NIIGTSGGTSLNDDIVRLQQT 286
             ++ T+GGT+L DDI+RL  T
Sbjct:  195 KVMATTGGTNLRDDIMRLDDT 215          
BLAST of DEAD/DEAH box helicase vs. Ensembl Celegans
Match: cgh-1 (ATP-dependent RNA helicase cgh-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95YF3])

HSP 1 Score: 50.0618 bits (118), Expect = 3.065e-9
Identity = 25/79 (31.65%), Postives = 43/79 (54.43%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL------------FPSVK*CCIQ*HSHNLF 489
            +++A+ GR  DL+++G+     CK  V+DE+DK LS +F+G++D +I  L            FP+     +Q H H  +
Sbjct:  164 LVIATPGRILDLMEKGVAKMEHCKTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPY 242          

HSP 2 Score: 28.4906 bits (62), Expect = 3.065e-9
Identity = 13/27 (48.15%), Postives = 19/27 (70.37%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQT 286
            SK  ++ ++ T+GGT L DDI+RL  T
Sbjct:  135 SKHIQLKVMVTTGGTDLRDDIMRLNGT 161          
BLAST of DEAD/DEAH box helicase vs. Ensembl Fly
Match: me31B (gene:FBgn0004419 transcript:FBtr0079976)

HSP 1 Score: 49.2914 bits (116), Expect = 3.406e-8
Identity = 21/50 (42.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +I+A+ GR  DL+ + +   + C+I V+DE+DK LS +F+G++D++I KL
Sbjct:  148 LIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKL 197          

HSP 2 Score: 25.7942 bits (55), Expect = 3.406e-8
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQ 283
            +K   + ++ T+GGT L DDI+R+ Q
Sbjct:  119 AKHLDIRVMVTTGGTILKDDILRIYQ 144          
BLAST of DEAD/DEAH box helicase vs. Ensembl Fly
Match: me31B (gene:FBgn0004419 transcript:FBtr0079975)

HSP 1 Score: 49.2914 bits (116), Expect = 4.059e-8
Identity = 21/50 (42.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +I+A+ GR  DL+ + +   + C+I V+DE+DK LS +F+G++D++I KL
Sbjct:  179 LIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKL 228          

HSP 2 Score: 25.7942 bits (55), Expect = 4.059e-8
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQ 283
            +K   + ++ T+GGT L DDI+R+ Q
Sbjct:  150 AKHLDIRVMVTTGGTILKDDILRIYQ 175          
BLAST of DEAD/DEAH box helicase vs. Ensembl Zebrafish
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 39.6614 bits (91), Expect = 4.919e-10
Identity = 18/50 (36.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +++A+ GR  DLIK+G+      ++ V+DE+DK LS +F  +++ I+  L
Sbjct:  219 VVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILSSL 268          

HSP 2 Score: 32.7278 bits (73), Expect = 4.919e-10
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            QRQI+LYS TFP SVQ+F
Sbjct:  271 QRQILLYSATFPLSVQKF 288          

HSP 3 Score: 28.8758 bits (63), Expect = 4.919e-10
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  195 VKVMATTGGTNLRDDIMRLDET 216          
BLAST of DEAD/DEAH box helicase vs. Ensembl Zebrafish
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 39.6614 bits (91), Expect = 4.919e-10
Identity = 18/50 (36.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +++A+ GR  DLIK+G+      ++ V+DE+DK LS +F  +++ I+  L
Sbjct:  219 VVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILSSL 268          

HSP 2 Score: 32.7278 bits (73), Expect = 4.919e-10
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            QRQI+LYS TFP SVQ+F
Sbjct:  271 QRQILLYSATFPLSVQKF 288          

HSP 3 Score: 28.8758 bits (63), Expect = 4.919e-10
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  195 VKVMATTGGTNLRDDIMRLDET 216          
BLAST of DEAD/DEAH box helicase vs. Ensembl Zebrafish
Match: ddx61 (DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFIN;Acc:ZDB-GENE-030131-6611])

HSP 1 Score: 41.2022 bits (95), Expect = 9.665e-10
Identity = 21/48 (43.75%), Postives = 33/48 (68.75%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIG 432
            +I+A+ GR  DLIK+G+   +  ++ VMDE+DK LS +F  +I+ II 
Sbjct:  210 VIIATPGRILDLIKKGVAKVDKVQMAVMDEADKLLSQDFVVLIEDIIS 257          

HSP 2 Score: 31.187 bits (69), Expect = 9.665e-10
Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            +RQI+LYS TFP SVQ+F
Sbjct:  262 KRQILLYSATFPISVQKF 279          

HSP 3 Score: 27.7202 bits (60), Expect = 9.665e-10
Identity = 10/21 (47.62%), Postives = 17/21 (80.95%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQ 283
            + ++ T+GGT+L DDI+RL +
Sbjct:  186 IKVMATTGGTNLRDDIMRLDE 206          
BLAST of DEAD/DEAH box helicase vs. Ensembl Zebrafish
Match: ddx61 (DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFIN;Acc:ZDB-GENE-030131-6611])

HSP 1 Score: 41.2022 bits (95), Expect = 9.665e-10
Identity = 21/48 (43.75%), Postives = 33/48 (68.75%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIG 432
            +I+A+ GR  DLIK+G+   +  ++ VMDE+DK LS +F  +I+ II 
Sbjct:  210 VIIATPGRILDLIKKGVAKVDKVQMAVMDEADKLLSQDFVVLIEDIIS 257          

HSP 2 Score: 31.187 bits (69), Expect = 9.665e-10
Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            +RQI+LYS TFP SVQ+F
Sbjct:  262 KRQILLYSATFPISVQKF 279          

HSP 3 Score: 27.7202 bits (60), Expect = 9.665e-10
Identity = 10/21 (47.62%), Postives = 17/21 (80.95%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQ 283
            + ++ T+GGT+L DDI+RL +
Sbjct:  186 IKVMATTGGTNLRDDIMRLDE 206          
BLAST of DEAD/DEAH box helicase vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 40.817 bits (94), Expect = 2.395e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  222 VVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDII 268          

HSP 2 Score: 30.8018 bits (68), Expect = 2.395e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  275 RQILLYSATFPLSVQKF 291          

HSP 3 Score: 27.7202 bits (60), Expect = 2.395e-9
Identity = 11/22 (50.00%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL  T
Sbjct:  198 VKVMATTGGTNLRDDIMRLDDT 219          
BLAST of DEAD/DEAH box helicase vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 40.817 bits (94), Expect = 2.480e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  222 VVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDII 268          

HSP 2 Score: 30.8018 bits (68), Expect = 2.480e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  275 RQILLYSATFPLSVQKF 291          

HSP 3 Score: 27.7202 bits (60), Expect = 2.480e-9
Identity = 11/22 (50.00%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL  T
Sbjct:  198 VKVMATTGGTNLRDDIMRLDDT 219          
BLAST of DEAD/DEAH box helicase vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 40.817 bits (94), Expect = 2.488e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  222 VVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDII 268          

HSP 2 Score: 30.8018 bits (68), Expect = 2.488e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  275 RQILLYSATFPLSVQKF 291          

HSP 3 Score: 27.7202 bits (60), Expect = 2.488e-9
Identity = 11/22 (50.00%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL  T
Sbjct:  198 VKVMATTGGTNLRDDIMRLDDT 219          
BLAST of DEAD/DEAH box helicase vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 40.817 bits (94), Expect = 2.783e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  216 VVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDII 262          

HSP 2 Score: 30.8018 bits (68), Expect = 2.783e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  269 RQILLYSATFPLSVQKF 285          

HSP 3 Score: 27.7202 bits (60), Expect = 2.783e-9
Identity = 11/22 (50.00%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL  T
Sbjct:  192 VKVMATTGGTNLRDDIMRLDDT 213          
BLAST of DEAD/DEAH box helicase vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 40.4318 bits (93), Expect = 9.219e-7
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  173 VVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDII 219          

HSP 2 Score: 30.8018 bits (68), Expect = 9.219e-7
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  226 RQILLYSATFPLSVQKF 242          
BLAST of DEAD/DEAH box helicase vs. Ensembl Mouse
Match: Ddx6 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:MGI Symbol;Acc:MGI:104976])

HSP 1 Score: 41.2022 bits (95), Expect = 1.369e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  218 VVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDII 264          

HSP 2 Score: 30.8018 bits (68), Expect = 1.369e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  271 RQILLYSATFPLSVQKF 287          

HSP 3 Score: 27.7202 bits (60), Expect = 1.369e-9
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  224 NIIGTSGGTSLNDDIVRLQQT 286
             ++ T+GGT+L DDI+RL  T
Sbjct:  195 KVMATTGGTNLRDDIMRLDDT 215          
BLAST of DEAD/DEAH box helicase vs. Ensembl Mouse
Match: Ddx6 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:MGI Symbol;Acc:MGI:104976])

HSP 1 Score: 41.2022 bits (95), Expect = 1.369e-9
Identity = 18/47 (38.30%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ V+DE+DK LS +F  +++ II
Sbjct:  218 VVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDII 264          

HSP 2 Score: 30.8018 bits (68), Expect = 1.369e-9
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  271 RQILLYSATFPLSVQKF 287          

HSP 3 Score: 27.7202 bits (60), Expect = 1.369e-9
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  224 NIIGTSGGTSLNDDIVRLQQT 286
             ++ T+GGT+L DDI+RL  T
Sbjct:  195 KVMATTGGTNLRDDIMRLDDT 215          
BLAST of DEAD/DEAH box helicase vs. UniProt/SwissProt
Match: sp|P0CQ80|DHH1_CRYNJ (ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=DHH1 PE=3 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 1.258e-10
Identity = 21/44 (47.73%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVID 420
            +++ + GR  DL  +GI S N C +FVMDE+DK LS +F  VI+
Sbjct:  158 ILVGTPGRILDLGSKGIASLNKCGVFVMDEADKLLSEDFMPVIE 201          

HSP 2 Score: 31.5722 bits (70), Expect = 1.258e-10
Identity = 12/21 (57.14%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQ 283
            + ++ T+GGT+L DDI+RLQQ
Sbjct:  134 LQVMITTGGTTLRDDILRLQQ 154          

HSP 3 Score: 29.6462 bits (65), Expect = 1.258e-10
Identity = 10/18 (55.56%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            +RQ+ML+S TFP +V++F
Sbjct:  210 ERQVMLFSATFPWTVKEF 227          
BLAST of DEAD/DEAH box helicase vs. UniProt/SwissProt
Match: sp|P0CQ81|DHH1_CRYNB (ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=DHH1 PE=3 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 1.258e-10
Identity = 21/44 (47.73%), Postives = 30/44 (68.18%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVID 420
            +++ + GR  DL  +GI S N C +FVMDE+DK LS +F  VI+
Sbjct:  158 ILVGTPGRILDLGSKGIASLNKCGVFVMDEADKLLSEDFMPVIE 201          

HSP 2 Score: 31.5722 bits (70), Expect = 1.258e-10
Identity = 12/21 (57.14%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQ 283
            + ++ T+GGT+L DDI+RLQQ
Sbjct:  134 LQVMITTGGTTLRDDILRLQQ 154          

HSP 3 Score: 29.6462 bits (65), Expect = 1.258e-10
Identity = 10/18 (55.56%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            +RQ+ML+S TFP +V++F
Sbjct:  210 ERQVMLFSATFPWTVKEF 227          
BLAST of DEAD/DEAH box helicase vs. UniProt/SwissProt
Match: sp|Q58Z64|DHH1_CRYNH (ATP-dependent RNA helicase VAD1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=VAD1 PE=1 SV=1)

HSP 1 Score: 43.5134 bits (101), Expect = 2.601e-10
Identity = 21/44 (47.73%), Postives = 29/44 (65.91%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVID 420
            +++ + GR  DL  +GI   N C IFVMDE+DK LS +F  VI+
Sbjct:  158 ILVGTPGRILDLGSKGIAGLNKCGIFVMDEADKLLSEDFMPVIE 201          

HSP 2 Score: 31.187 bits (69), Expect = 2.601e-10
Identity = 12/21 (57.14%), Postives = 18/21 (85.71%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQ 283
            + ++ T+GGT+L DDI+RLQQ
Sbjct:  134 LQVMITTGGTTLRDDILRLQQ 154          

HSP 3 Score: 30.0314 bits (66), Expect = 2.601e-10
Identity = 10/18 (55.56%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            +RQ+ML+S TFP +V++F
Sbjct:  210 ERQVMLFSATFPWTVKEF 227          
BLAST of DEAD/DEAH box helicase vs. UniProt/SwissProt
Match: sp|Q7XMK8|RH6_ORYSJ (DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0533000 PE=2 SV=1)

HSP 1 Score: 43.1282 bits (100), Expect = 6.272e-10
Identity = 21/53 (39.62%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKLFPS 447
            +++ + GR  DL K+G+     C + VMDE+DK LS EF+  I  +I +  PS
Sbjct:  245 LLVGTPGRILDLTKKGVCVLKNCSMLVMDEADKLLSPEFQPSIQELI-RYLPS 296          

HSP 2 Score: 32.3426 bits (72), Expect = 6.272e-10
Identity = 15/26 (57.69%), Postives = 19/26 (73.08%), Query Frame = 2
Query:  209 KLYKMNIIGTSGGTSLNDDIVRLQQT 286
            K  K+ ++ T+GGTSL DDIVRL Q 
Sbjct:  217 KHLKIQVMVTTGGTSLKDDIVRLYQP 242          

HSP 3 Score: 27.7202 bits (60), Expect = 6.272e-10
Identity = 10/19 (52.63%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
            S RQI+++S TFP +V++F
Sbjct:  296 SNRQILMFSATFPVTVKEF 314          
BLAST of DEAD/DEAH box helicase vs. UniProt/SwissProt
Match: sp|Q8RXK6|RH8_ARATH (DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana OX=3702 GN=RH8 PE=2 SV=1)

HSP 1 Score: 44.2838 bits (103), Expect = 4.127e-9
Identity = 18/47 (38.30%), Postives = 31/47 (65.96%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++ + GR  DL K+G+     C + VMDE+DK LS EF+  ++++I
Sbjct:  252 LLVGTPGRILDLTKKGVCVLKDCSVLVMDEADKLLSQEFQPSVEHLI 298          

HSP 2 Score: 30.8018 bits (68), Expect = 4.127e-9
Identity = 14/26 (53.85%), Postives = 19/26 (73.08%), Query Frame = 2
Query:  209 KLYKMNIIGTSGGTSLNDDIVRLQQT 286
            K  K+ ++ T+GGTSL DDI+RL Q 
Sbjct:  224 KHLKIQVMVTTGGTSLKDDIMRLYQP 249          

HSP 3 Score: 25.409 bits (54), Expect = 4.127e-9
Identity = 9/19 (47.37%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
              RQI+++S TFP +V+ F
Sbjct:  303 ESRQILMFSATFPVTVKDF 321          
BLAST of DEAD/DEAH box helicase vs. TrEMBL
Match: A4UY08 (DEAD box RNA helicase Me31B OS=Dugesia japonica OX=6161 GN=Djcbc-1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.019e-21
Identity = 36/50 (72.00%), Postives = 42/50 (84.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +ILA+ GR NDLIKR I+STNFCKI V+DE+DK LS +FE VIDYII KL
Sbjct:  170 IILATPGRVNDLIKRDIVSTNFCKILVIDEADKLLSADFEEVIDYIISKL 219          

HSP 2 Score: 38.891 bits (89), Expect = 1.019e-21
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
            +QRQIMLYS TFPQSVQQF
Sbjct:  221 TQRQIMLYSATFPQSVQQF 239          

HSP 3 Score: 35.039 bits (79), Expect = 1.019e-21
Identity = 17/27 (62.96%), Postives = 21/27 (77.78%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQT 286
            +K  +  I+ T+GGTSL DDIVRLQQT
Sbjct:  141 AKHTETKIMVTTGGTSLKDDIVRLQQT 167          
BLAST of DEAD/DEAH box helicase vs. TrEMBL
Match: A8IT25 (Cytoplasmic DExD/H-box RNA helicase OS=Chlamydomonas reinhardtii OX=3055 GN=DEH1 PE=3 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.897e-11
Identity = 23/54 (42.59%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  277 STN*MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
             T  +++A+ GR  DL  +G+   N C++ VMDE+DK LS EF+ V++ +IG L
Sbjct:  148 QTTHIVVATPGRVVDLASKGVARLNECRMLVMDEADKLLSPEFQPVVEQLIGYL 201          

HSP 2 Score: 33.113 bits (74), Expect = 1.897e-11
Identity = 15/27 (55.56%), Postives = 20/27 (74.07%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQT 286
            SK   + ++ T+GGTSL DDI+RL QT
Sbjct:  123 SKYLSIEVMVTTGGTSLKDDIMRLYQT 149          

HSP 3 Score: 29.6462 bits (65), Expect = 1.897e-11
Identity = 12/19 (63.16%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
              RQIMLYS TFP +V+ F
Sbjct:  203 DDRQIMLYSATFPVTVKAF 221          
BLAST of DEAD/DEAH box helicase vs. TrEMBL
Match: D8TXT3 (DEAD-box RNA helicase, ATP-dependent, cytoplasmic OS=Volvox carteri f. nagariensis OX=3068 GN=deh1 PE=3 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 6.222e-11
Identity = 23/52 (44.23%), Postives = 35/52 (67.31%), Query Frame = 1
Query:  277 STN*MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIG 432
             T  +++A+ GR  DL  +G+   N CK+ VMDE+DK LS EF+ V++ +IG
Sbjct:  149 QTTHIVVATPGRVVDLAGKGVARLNECKMLVMDEADKLLSPEFQPVVEQLIG 200          

HSP 2 Score: 31.9574 bits (71), Expect = 6.222e-11
Identity = 14/27 (51.85%), Postives = 20/27 (74.07%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQT 286
            +K   + ++ T+GGTSL DDI+RL QT
Sbjct:  124 AKYLNVEVMVTTGGTSLKDDIMRLYQT 150          

HSP 3 Score: 29.261 bits (64), Expect = 6.222e-11
Identity = 12/19 (63.16%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
              RQIMLYS TFP +V+ F
Sbjct:  204 EDRQIMLYSATFPVTVKAF 222          
BLAST of DEAD/DEAH box helicase vs. TrEMBL
Match: A0A5E4NAL0 (Uncharacterized protein OS=Cinara cedri OX=506608 GN=CINCED_3A019670 PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.070e-10
Identity = 25/53 (47.17%), Postives = 39/53 (73.58%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKLFPS 447
            +I+A+ GR  DL+ + I   + C+I V+DE+DK LS +F+G++D+II KL PS
Sbjct:  109 VIIATPGRILDLLDKSIAKVDHCRILVLDEADKLLSQDFKGMLDHIISKL-PS 160          

HSP 2 Score: 32.7278 bits (73), Expect = 1.070e-10
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
            S+RQI+LYS TFP +V+QF
Sbjct:  160 SERQILLYSATFPLTVKQF 178          

HSP 3 Score: 26.9498 bits (58), Expect = 1.070e-10
Identity = 11/26 (42.31%), Postives = 19/26 (73.08%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQ 283
            +K   + ++ T+GGT+L DDI+R+ Q
Sbjct:   80 AKHLDIRVMVTTGGTNLKDDILRIYQ 105          
BLAST of DEAD/DEAH box helicase vs. TrEMBL
Match: A0A5E4N1P3 (Uncharacterized protein OS=Cinara cedri OX=506608 GN=CINCED_3A019670 PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.284e-10
Identity = 25/53 (47.17%), Postives = 39/53 (73.58%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKLFPS 447
            +I+A+ GR  DL+ + I   + C+I V+DE+DK LS +F+G++D+II KL PS
Sbjct:  177 VIIATPGRILDLLDKSIAKVDHCRILVLDEADKLLSQDFKGMLDHIISKL-PS 228          

HSP 2 Score: 32.7278 bits (73), Expect = 1.284e-10
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
            S+RQI+LYS TFP +V+QF
Sbjct:  228 SERQILLYSATFPLTVKQF 246          

HSP 3 Score: 26.9498 bits (58), Expect = 1.284e-10
Identity = 11/26 (42.31%), Postives = 19/26 (73.08%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQ 283
            +K   + ++ T+GGT+L DDI+R+ Q
Sbjct:  148 AKHLDIRVMVTTGGTNLKDDILRIYQ 173          
BLAST of DEAD/DEAH box helicase vs. Ensembl Cavefish
Match: ENSAMXT00000045184.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:103037120])

HSP 1 Score: 41.5874 bits (96), Expect = 1.847e-10
Identity = 21/47 (44.68%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +I+A+ GR  DLIK+G+   +  ++ VMDE+DK LS +F  +I+ II
Sbjct:  214 VIIATPGRILDLIKKGVAKVDKVQMIVMDEADKLLSQDFVVLIEDII 260          

HSP 2 Score: 31.9574 bits (71), Expect = 1.847e-10
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  267 RQILLYSATFPTSVQKF 283          

HSP 3 Score: 28.8758 bits (63), Expect = 1.847e-10
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  190 VKVMATTGGTNLRDDIMRLDET 211          
BLAST of DEAD/DEAH box helicase vs. Ensembl Cavefish
Match: ddx61 (probable ATP-dependent RNA helicase DDX6 [Source:NCBI gene;Acc:103044136])

HSP 1 Score: 41.2022 bits (95), Expect = 4.762e-10
Identity = 20/47 (42.55%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ VMDE+DK LS +F  +I+ II
Sbjct:  210 VVIATPGRILDLIKKGVAKVDKVQMMVMDEADKLLSQDFVVLIEDII 256          

HSP 2 Score: 30.8018 bits (68), Expect = 4.762e-10
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  263 RQILLYSATFPVSVQRF 279          

HSP 3 Score: 29.261 bits (64), Expect = 4.762e-10
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  186 VKVMATTGGTNLKDDIMRLDET 207          
BLAST of DEAD/DEAH box helicase vs. Ensembl Cavefish
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:103046116])

HSP 1 Score: 38.5058 bits (88), Expect = 8.820e-10
Identity = 17/48 (35.42%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIG 432
            +++A+ GR  DLIK+G+      ++ V+DE+DK LS +F  +++ I+ 
Sbjct:  219 VVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILS 266          

HSP 2 Score: 32.7278 bits (73), Expect = 8.820e-10
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            QRQI+LYS TFP SVQ+F
Sbjct:  271 QRQILLYSATFPLSVQKF 288          

HSP 3 Score: 28.8758 bits (63), Expect = 8.820e-10
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  195 VKVMATTGGTNLRDDIMRLDET 216          
BLAST of DEAD/DEAH box helicase vs. Ensembl Cavefish
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:103046116])

HSP 1 Score: 38.1206 bits (87), Expect = 1.021e-9
Identity = 17/48 (35.42%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIG 432
            +++A+ GR  DLIK+G+      ++ V+DE+DK LS +F  +++ I+ 
Sbjct:  219 VVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILS 266          

HSP 2 Score: 32.7278 bits (73), Expect = 1.021e-9
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            QRQI+LYS TFP SVQ+F
Sbjct:  271 QRQILLYSATFPLSVQKF 288          

HSP 3 Score: 28.8758 bits (63), Expect = 1.021e-9
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  195 VKVMATTGGTNLRDDIMRLDET 216          
BLAST of DEAD/DEAH box helicase vs. Ensembl Sea Lamprey
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 39.2762 bits (90), Expect = 3.919e-10
Identity = 19/47 (40.43%), Postives = 32/47 (68.09%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +I+A+ GR  DLI +G+   +  ++ V+DE+DK LS +F  ++D II
Sbjct:  221 VIIATPGRILDLINKGLAKVDAVQMIVLDEADKLLSQDFVQMLDDII 267          

HSP 2 Score: 30.8018 bits (68), Expect = 3.919e-10
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  274 RQILLYSATFPLSVQKF 290          

HSP 3 Score: 28.8758 bits (63), Expect = 3.919e-10
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  197 VKVMATTGGTNLRDDILRLDET 218          
BLAST of DEAD/DEAH box helicase vs. Ensembl Yeast
Match: DHH1 (Cytoplasmic DEAD-box helicase, stimulates mRNA decapping; coordinates distinct steps in mRNA function and decay, interacting with both decapping and deadenylase complexes; role in translational repression, mRNA decay, and possibly mRNA export; interacts and cooperates with Ngr1p to promote specific mRNA decay; ATP- and RNA-bound form promotes processing body (PB) assembly, while ATPase stimulation by Not1p promotes PB disassembly; forms cytoplasmic foci on replication stress [Source:SGD;Acc:S000002319])

HSP 1 Score: 43.5134 bits (101), Expect = 1.259e-7
Identity = 19/53 (35.85%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKLFPS 447
            +++ + GR  DL  R +   + C +F+MDE+DK LS +F+ +I+ I+  L P+
Sbjct:  167 ILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPT 219          

HSP 2 Score: 27.335 bits (59), Expect = 1.259e-7
Identity = 11/17 (64.71%), Postives = 15/17 (88.24%), Query Frame = 2
Query:  236 TSGGTSLNDDIVRLQQT 286
            T+GGT+L DDI+RL +T
Sbjct:  148 TTGGTNLRDDILRLNET 164          
BLAST of DEAD/DEAH box helicase vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 40.817 bits (94), Expect = 2.072e-6
Identity = 19/47 (40.43%), Postives = 31/47 (65.96%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR NDL++RG +S    K  V+DE+D+ L   FE  I +I+
Sbjct:  278 LLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIV 324          

HSP 2 Score: 25.7942 bits (55), Expect = 2.072e-6
Identity = 7/20 (35.00%), Postives = 13/20 (65.00%), Query Frame = 3
Query:  438 ISQRQIMLYSVTFPQSVQQF 497
            + +RQ +++S TFP  +Q  
Sbjct:  332 VGERQTLMFSATFPADIQHL 351          
BLAST of DEAD/DEAH box helicase vs. Ensembl Nematostella
Match: EDO39940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H2])

HSP 1 Score: 43.8986 bits (102), Expect = 8.390e-10
Identity = 20/50 (40.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +I+A+ GR  DL+K+ +   + C++ VMDE+DK LS +F+ +++ II  L
Sbjct:  168 VIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHL 217          

HSP 2 Score: 27.335 bits (59), Expect = 8.390e-10
Identity = 11/18 (61.11%), Postives = 15/18 (83.33%), Query Frame = 2
Query:  224 NIIGTSGGTSLNDDIVRL 277
             ++ T+GGTSL DDI+RL
Sbjct:  145 QVMVTTGGTSLKDDILRL 162          

HSP 3 Score: 27.335 bits (59), Expect = 8.390e-10
Identity = 11/19 (57.89%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
              RQI+L+S TFP SV+ F
Sbjct:  219 ENRQILLFSATFPISVRDF 237          
BLAST of DEAD/DEAH box helicase vs. Ensembl Medaka
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:101169303])

HSP 1 Score: 42.3578 bits (98), Expect = 7.783e-11
Identity = 19/48 (39.58%), Postives = 34/48 (70.83%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIG 432
            +++A+ GR  DLIK+G+   N  ++ V+DE+DK LS +F  +++ I+G
Sbjct:  214 VVIATPGRILDLIKKGVAKVNQVQMIVLDEADKLLSQDFVVMMEEILG 261          

HSP 2 Score: 32.7278 bits (73), Expect = 7.783e-11
Identity = 14/18 (77.78%), Postives = 16/18 (88.89%), Query Frame = 3
Query:  444 QRQIMLYSVTFPQSVQQF 497
            QRQI+LYS TFP SVQ+F
Sbjct:  266 QRQILLYSATFPLSVQKF 283          

HSP 3 Score: 28.8758 bits (63), Expect = 7.783e-11
Identity = 11/22 (50.00%), Postives = 18/22 (81.82%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQT 286
            + ++ T+GGT+L DDI+RL +T
Sbjct:  190 VKVMATTGGTNLRDDIMRLDET 211          
BLAST of DEAD/DEAH box helicase vs. Ensembl Medaka
Match: ENSORLT00000028513.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 41.2022 bits (95), Expect = 9.826e-10
Identity = 20/47 (42.55%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ VMDE+DK LS +F  +I+ II
Sbjct:  211 VVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDII 257          

HSP 2 Score: 31.5722 bits (70), Expect = 9.826e-10
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  264 RQILLYSATFPMSVQKF 280          

HSP 3 Score: 27.335 bits (59), Expect = 9.826e-10
Identity = 10/21 (47.62%), Postives = 17/21 (80.95%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQ 283
            + ++ T+GGT+L DDI+RL +
Sbjct:  187 VKVMATTGGTNLRDDIMRLDE 207          
BLAST of DEAD/DEAH box helicase vs. Ensembl Medaka
Match: ENSORLT00000045064.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 41.2022 bits (95), Expect = 9.826e-10
Identity = 20/47 (42.55%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ VMDE+DK LS +F  +I+ II
Sbjct:  211 VVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDII 257          

HSP 2 Score: 31.5722 bits (70), Expect = 9.826e-10
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  264 RQILLYSATFPMSVQKF 280          

HSP 3 Score: 27.335 bits (59), Expect = 9.826e-10
Identity = 10/21 (47.62%), Postives = 17/21 (80.95%), Query Frame = 2
Query:  221 MNIIGTSGGTSLNDDIVRLQQ 283
            + ++ T+GGT+L DDI+RL +
Sbjct:  187 VKVMATTGGTNLRDDIMRLDE 207          
BLAST of DEAD/DEAH box helicase vs. Ensembl Medaka
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:101169303])

HSP 1 Score: 42.3578 bits (98), Expect = 5.462e-8
Identity = 19/48 (39.58%), Postives = 34/48 (70.83%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIG 432
            +++A+ GR  DLIK+G+   N  ++ V+DE+DK LS +F  +++ I+G
Sbjct:  165 VVIATPGRILDLIKKGVAKVNQVQMIVLDEADKLLSQDFVVMMEEILG 212          

HSP 2 Score: 32.3426 bits (72), Expect = 5.462e-8
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
             QRQI+LYS TFP SVQ+F
Sbjct:  216 KQRQILLYSATFPLSVQKF 234          
BLAST of DEAD/DEAH box helicase vs. Ensembl Medaka
Match: ENSORLT00000011518.2 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 40.817 bits (94), Expect = 2.749e-7
Identity = 20/47 (42.55%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +++A+ GR  DLIK+G+   +  ++ VMDE+DK LS +F  +I+ II
Sbjct:  162 VVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDII 208          

HSP 2 Score: 31.5722 bits (70), Expect = 2.749e-7
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  447 RQIMLYSVTFPQSVQQF 497
            RQI+LYS TFP SVQ+F
Sbjct:  215 RQILLYSATFPMSVQKF 231          
BLAST of DEAD/DEAH box helicase vs. Planmine SMEST
Match: SMESG000073910.1 (SMESG000073910.1)

HSP 1 Score: 79.337 bits (194), Expect = 2.010e-25
Identity = 37/50 (74.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +ILA+ GR NDLIKR I+STNFCKI V+DE+DK LS +FE VIDYIIGKL
Sbjct:  171 IILATPGRVNDLIKRDIVSTNFCKILVIDEADKLLSADFEEVIDYIIGKL 220          

HSP 2 Score: 38.891 bits (89), Expect = 2.010e-25
Identity = 17/19 (89.47%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
            +QRQIMLYS TFPQSVQQF
Sbjct:  222 AQRQIMLYSATFPQSVQQF 240          

HSP 3 Score: 35.039 bits (79), Expect = 2.010e-25
Identity = 17/27 (62.96%), Postives = 21/27 (77.78%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQT 286
            +K  +  I+ T+GGTSL DDIVRLQQT
Sbjct:  142 AKHTETKIMVTTGGTSLKDDIVRLQQT 168          
BLAST of DEAD/DEAH box helicase vs. Planmine SMEST
Match: SMESG000027870.1 (SMESG000027870.1)

HSP 1 Score: 45.4394 bits (106), Expect = 7.568e-10
Identity = 18/50 (36.00%), Postives = 34/50 (68.00%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYIIGKL 438
            +++ + GR  DL+KR +++  +CK  V+DE+DK LS +F+ ++  I+  L
Sbjct:  150 LVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCL 199          

HSP 2 Score: 28.1054 bits (61), Expect = 7.568e-10
Identity = 12/26 (46.15%), Postives = 17/26 (65.38%), Query Frame = 2
Query:  206 SKLYKMNIIGTSGGTSLNDDIVRLQQ 283
            SK  K  ++ T+GGT L +DI RL +
Sbjct:  121 SKYLKFKVMVTTGGTDLTEDICRLNR 146          

HSP 3 Score: 26.1794 bits (56), Expect = 7.568e-10
Identity = 9/19 (47.37%), Postives = 14/19 (73.68%), Query Frame = 3
Query:  441 SQRQIMLYSVTFPQSVQQF 497
              RQI+LYS T+P ++ +F
Sbjct:  201 KDRQILLYSATYPVTLHEF 219          
BLAST of DEAD/DEAH box helicase vs. Planmine SMEST
Match: SMESG000058317.1 (SMESG000058317.1)

HSP 1 Score: 46.595 bits (109), Expect = 5.179e-6
Identity = 22/47 (46.81%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 MILASLGRANDLIKRGILSTNFCKIFVMDESDKFLSGEFEGVIDYII 429
            +I+ + GR ND+I+RG L TN  K+FV+DE+D+ LS  F+  I  +I
Sbjct:  137 VIVGTPGRVNDMIERGNLKTNNIKMFVLDEADEMLSRGFKEQIHSVI 183          
The following BLAST results are available for this feature:
BLAST of DEAD/DEAH box helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DDX61.982e-938.30DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX61.982e-938.30DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX61.982e-938.30DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cgh-13.065e-931.65ATP-dependent RNA helicase cgh-1 [Source:UniProtK... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
me31B3.406e-842.00gene:FBgn0004419 transcript:FBtr0079976[more]
me31B4.059e-842.00gene:FBgn0004419 transcript:FBtr0079975[more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ddx64.919e-1036.00DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ddx64.919e-1036.00DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ddx619.665e-1043.75DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFI... [more]
ddx619.665e-1043.75DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFI... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx62.395e-938.30DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx62.480e-938.30DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx62.488e-938.30DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx62.783e-938.30DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx69.219e-738.30DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ddx61.369e-938.30DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:M... [more]
Ddx61.369e-938.30DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:M... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0CQ80|DHH1_CRYNJ1.258e-1047.73ATP-dependent RNA helicase DHH1 OS=Cryptococcus ne... [more]
sp|P0CQ81|DHH1_CRYNB1.258e-1047.73ATP-dependent RNA helicase DHH1 OS=Cryptococcus ne... [more]
sp|Q58Z64|DHH1_CRYNH2.601e-1047.73ATP-dependent RNA helicase VAD1 OS=Cryptococcus ne... [more]
sp|Q7XMK8|RH6_ORYSJ6.272e-1039.62DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sat... [more]
sp|Q8RXK6|RH8_ARATH4.127e-938.30DEAD-box ATP-dependent RNA helicase 8 OS=Arabidops... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4UY081.019e-2172.00DEAD box RNA helicase Me31B OS=Dugesia japonica OX... [more]
A8IT251.897e-1142.59Cytoplasmic DExD/H-box RNA helicase OS=Chlamydomon... [more]
D8TXT36.222e-1144.23DEAD-box RNA helicase, ATP-dependent, cytoplasmic ... [more]
A0A5E4NAL01.070e-1047.17Uncharacterized protein OS=Cinara cedri OX=506608 ... [more]
A0A5E4N1P31.284e-1047.17Uncharacterized protein OS=Cinara cedri OX=506608 ... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000045184.11.847e-1044.68probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ddx614.762e-1042.55probable ATP-dependent RNA helicase DDX6 [Source:N... [more]
ddx68.820e-1035.42DEAD-box helicase 6 [Source:NCBI gene;Acc:10304611... [more]
ddx61.021e-935.42DEAD-box helicase 6 [Source:NCBI gene;Acc:10304611... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddx63.919e-1040.43DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DHH11.259e-735.85Cytoplasmic DEAD-box helicase, stimulates mRNA dec... [more]
DED12.072e-640.43ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399408.390e-1040.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx67.783e-1139.58DEAD-box helicase 6 [Source:NCBI gene;Acc:10116930... [more]
ENSORLT00000028513.19.826e-1042.55probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ENSORLT00000045064.19.826e-1042.55probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ddx65.462e-839.58DEAD-box helicase 6 [Source:NCBI gene;Acc:10116930... [more]
ENSORLT00000011518.22.749e-742.55probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
back to top
BLAST of DEAD/DEAH box helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000073910.12.010e-2574.00SMESG000073910.1[more]
SMESG000027870.17.568e-1036.00SMESG000027870.1[more]
SMESG000058317.15.179e-646.81SMESG000058317.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009341 ID=SMED30009341|Name=DEAD/DEAH box helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=610bp
ATTGTTTAAATAATTAATATTTTTAAAAATATATTAAATGTCAAAATTAG
AAAATATAAATATTTTATTAATTTTAATCAACCTTTTTCAAGACATCGGA
TCCAAGATTGGTGCATCATTCGTTCATGAACCAATAGTAAGTATTTATAT
TTGTTACTTGTAATTTATAAGTTAAATAATATGACCATTTTTGTTTAATA
AAAAATCGAAGTTGTACAAAATGAACATAATTGGTACCTCGGGTGGGACC
AGTTTGAATGATGATATTGTTAGACTTCAACAAACTAAATGATATTAGCT
TCTCTTGGTCGAGCTAATGATTTAATTAAACGAGGTATACTGTCTACAAA
TTTTTGTAAAATATTTGTAATGGATGAAAGTGACAAATTTTTATCAGGAG
AGTTTGAAGGAGTAATTGATTATATTATCGGTAAACTATTTCCCAGCGTC
AAATAATGTTGTATTCAGTAACATTCCCACAATCTGTTCAACAATTTTTA
ATAAAGTTATGCATGATTCATATAAAATTAATTTAAATATAATTAAAATT
ATATTGCAACATTGTGTTTGCGCTAAATTACCTAAAATATCAAATGGGAT
TCATACTTGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0010603regulation of cytoplasmic mRNA processing body assembly
GO:0017148negative regulation of translation
GO:0033962cytoplasmic mRNA processing body assembly
GO:0034063stress granule assembly
GO:0045900negative regulation of translational elongation
GO:0051028mRNA transport
GO:0000290deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0006397mRNA processing
GO:0006417regulation of translation
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0090079translation regulator activity, nucleic acid binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003682chromatin binding
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0004386helicase activity
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0098562cytoplasmic side of membrane
GO:0000932P-body
GO:0005737cytoplasm
GO:0010494cytoplasmic stress granule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..54
e-value: 1.9E-7
score: 32.5
NoneNo IPR availableCDDcd17940DEADc_DDX6coord: 2..50
e-value: 4.33347E-9
score: 47.2926
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..51