SMED30009340

Overview
NameSMED30009340
Smed IDSMED30009340
Length (bp)2349
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009340 (SMED30009340) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009340 (SMED30009340) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009340 (SMED30009340) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009340 (SMED30009340) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009340

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009340h1SMcG0019693 Contig4736uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009340h1SMcG0019693 Contig4736newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30009340h1SMcG0019693 SmedASXL_070553SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30009340h1SMcG0019693 SmedASXL_073923SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30009340h1SMcG0019693 SmedASXL_017633SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30009340h1SMcG0019693 SmedASXL_017632SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30009340h1SMcG0019700 SmedASXL_017632SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019693 Contig42720uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019693 Contig42720newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019693 Contig4736uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019693 Contig4736newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0007079 Contig3764GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019691 Contig3764GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019693 Contig33926newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019693 Contig33926uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019693 Contig3764GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009340h1SMcG0019692 Contig3764GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30009340h1SMcG0019693 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009340h1SMcG0019693 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009340h1SMcG0019693 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009340h1SMcG0019693 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009340h1SMcG0019700 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009340h1SMcG0019700 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009340h1SMcG0019700 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009340h1SMcG0019700 dd_Smed_v4_1543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009340h1SMcG0019693 dd_Smed_v4_8067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009340h1SMcG0019693 dd_Smed_v4_8067_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30009340h1SMcG0019700 dd_Smed_v6_1543_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009340h1SMcG0019700 dd_Smed_v6_1543_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30009340h1SMcG0019693 dd_Smed_v6_1543_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009340h1SMcG0019693 dd_Smed_v6_1543_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30009340h1SMcG0019691 dd_Smed_v6_1543_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009340h1SMcG0019691 dd_Smed_v6_1543_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009340 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006226:12695..19209 +9233
v31.006912:2265..9930 +9122
v31.006228:14413..17116 +8173
Homology
BLAST of SMED30009340 vs. Planmine SMEST
Match: SMESG000013579.1 (SMESG000013579.1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 283/298 (94.97%), Postives = 290/298 (97.32%), Query Frame = 3
Query:  153 IILQLALTETQVILSVTSSSIFPHFIGDSFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKFMDIKVWEKNPSSTAMNISIIFKRGAHNKYLETFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPPALAISVLPIKVDRKEKIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGS 1046
            IILQLALTETQVILSVTSSSIFPHFIG+SFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGK M+IKVWEKNPSSTAMNISIIFKRGAHNKYLE FYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPP LAISVLPIKVDRKE IINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFR+SLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQAN VIQCYAK+GY QPS HFQLI+GPSNAS YY+T+KNGS
Sbjct:    9 IILQLALTETQVILSVTSSSIFPHFIGNSFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKLMEIKVWEKNPSSTAMNISIIFKRGAHNKYLEIFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPPGLAISVLPIKVDRKEIIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRISLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANRVIQCYAKNGYAQPSGHFQLIEGPSNASLYYDTKKNGS 306          

HSP 2 Score: 278.1 bits (710), Expect = 9.349e-83
Identity = 160/286 (55.94%), Postives = 192/286 (67.13%), Query Frame = 1
Query: 1546 HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENV-----------CVILNRTIS-------------------FRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKGQQKTSRGMNASIK 2313
            HP+ I I P  + I++ N  I C   +GY      +++I GP +ASLYY+  +NG+  +L E    KS   I   ++   E             C + +R  S                   + IANHPTALYI+PIIKKRFRSNSTIKCFTKD YP+PEINWQLIE P NA++FYNI   GDQIHINSNSP GSKWT KCTMKS+LV   K LNKTISF+IAKNPM ICGEKCLNSRISEIEESV+EN +L +D+R ILNQVKEQM AMGK QQ+TSRG++AS+K
Sbjct:  251 HPSQIYIKPDINEILQANRVIQCYAKNGYAQPSGHFQLIEGPSNASLYYDTKKNGSP-NLYE---FKSSNFISVEIQMLNEKHDFELYKNHRKECFVQSRKPSDINPDQASARRDNGTEFHYYLIANHPTALYIKPIIKKRFRSNSTIKCFTKDRYPNPEINWQLIERPSNANQFYNISENGDQIHINSNSPTGSKWTFKCTMKSILVKNVKMLNKTISFAIAKNPMVICGEKCLNSRISEIEESVEENAKLHEDMRLILNQVKEQMTAMGKQQQETSRGLDASMK 532          

HSP 3 Score: 102.064 bits (253), Expect = 4.826e-22
Identity = 47/109 (43.12%), Postives = 69/109 (63.30%), Query Frame = 3
Query:  843 NVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIAR 1169
            N TE     I +HP+ +YIKP I +  ++N  I+C+ KD YP P +++QLI+ PSNA+ +Y   +NG +I+I SN+PT S W F+C MKS +        K I+F IA+
Sbjct:  362 NGTEFHYYLIANHPTALYIKPIIKKRFRSNSTIKCFTKDRYPNPEINWQLIERPSNANQFYNISENGDQIHINSNSPTGSKWTFKCTMKSILVKNVKMLNKTISFAIAK 470          

HSP 4 Score: 63.5438 bits (153), Expect = 4.088e-10
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1813 TISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKG 2001
            T + RI +HP+ +YI+P I +  ++N  I+C+ K+GY  P  ++QLIEGP NA  +Y+    G
Sbjct:  243 TFTIRIYHHPSQIYIKPDINEILQANRVIQCYAKNGYAQPSGHFQLIEGPSNASLYYDTKKNG 305          
BLAST of SMED30009340 vs. Planmine SMEST
Match: SMESG000013579.1 (SMESG000013579.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 283/298 (94.97%), Postives = 290/298 (97.32%), Query Frame = 3
Query:  153 IILQLALTETQVILSVTSSSIFPHFIGDSFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKFMDIKVWEKNPSSTAMNISIIFKRGAHNKYLETFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPPALAISVLPIKVDRKEKIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGS 1046
            IILQLALTETQVILSVTSSSIFPHFIG+SFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGK M+IKVWEKNPSSTAMNISIIFKRGAHNKYLE FYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPP LAISVLPIKVDRKE IINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFR+SLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQAN VIQCYAK+GY QPS HFQLI+GPSNAS YY+T+KNGS
Sbjct:    9 IILQLALTETQVILSVTSSSIFPHFIGNSFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKLMEIKVWEKNPSSTAMNISIIFKRGAHNKYLEIFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPPGLAISVLPIKVDRKEIIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRISLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANRVIQCYAKNGYAQPSGHFQLIEGPSNASLYYDTKKNGS 306          

HSP 2 Score: 63.5438 bits (153), Expect = 2.276e-10
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1813 TISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKG 2001
            T + RI +HP+ +YI+P I +  ++N  I+C+ K+GY  P  ++QLIEGP NA  +Y+    G
Sbjct:  243 TFTIRIYHHPSQIYIKPDINEILQANRVIQCYAKNGYAQPSGHFQLIEGPSNASLYYDTKKNG 305          
BLAST of SMED30009340 vs. Planmine SMEST
Match: SMESG000014544.1 (SMESG000014544.1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 262/269 (97.40%), Postives = 265/269 (98.51%), Query Frame = 1
Query: 1543 GHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKGQQKTSRGMNASIKQVKEQMIAMGKE 2349
             HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYN MRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPT LYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGK QQ+TSRG+NASIKQVK+QMIAMGKE
Sbjct:  349 SHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKEQQETSRGLNASIKQVKDQMIAMGKE 617          

HSP 2 Score: 532.332 bits (1370), Expect = 2.143e-178
Identity = 256/337 (75.96%), Postives = 284/337 (84.27%), Query Frame = 3
Query:  156 ILQLALTETQVILSVTSSSIFPHFIGDSFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKFMDIKVWEKNPSSTAMNISIIFKRGAHNKYLETFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPPALAISVLPIKVDRKEKIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIA 1166
            IL L   E ++ L V S S FPHFIGD+FS+ IQ     S LS+D  DTMVIRIVDLN TEI++ +L+YG    +D+E +G  MDIK+WEKN  ST ++ISIIFKR AHNKYLE  YFSA NKF RRKYLKNLSLAKRLFHELI+LFIP  LA++VLPIKVDRKE IINDMVMASCRAF GIPQEKPRFEDHA LNVTE IYN+TANEI MN R SL+DHLTNF CSAGNVTETF I I+HHPS+I+IKPDI +ILQAN  IQCYA+DGYPQPS+HFQLIKGPSNASHYYETRKNGSEIYIRS+AP  SAWMF+CLMKSTIAGVAMTKEKNITFRIA
Sbjct:   12 ILHLLFAEAEIALFVRSVSNFPHFIGDAFSLDIQSRSENSKLSSDPSDTMVIRIVDLNFTEIERAYLVYGALYFMDDEFKGNLMDIKIWEKNQMSTKIDISIIFKREAHNKYLEILYFSAPNKFVRRKYLKNLSLAKRLFHELIDLFIPSTLALTVLPIKVDRKEIIINDMVMASCRAFSGIPQEKPRFEDHAQLNVTEIIYNETANEISMNLRTSLDDHLTNFSCSAGNVTETFIICIHHHPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIA 348          

HSP 3 Score: 168.318 bits (425), Expect = 3.876e-43
Identity = 82/209 (39.23%), Postives = 119/209 (56.94%), Query Frame = 1
Query: 1546 HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRI 2172
            HP+ I I P    I++ N  I C   DGYP     +++I GP +AS YY   +NG++I+++ + P  S W  KC +KS +  V +   + I+FRIA+HPT++ I P+       NSTI C   DGYP     W++I GP +A  +YNI   G QIH+  N P  S+W +KC++KS L N    LN+TISF IA +P  +  +  +  R 
Sbjct:  253 HPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTTLYIQPIIKKRF 461          

HSP 4 Score: 117.087 bits (292), Expect = 1.042e-26
Identity = 85/268 (31.72%), Postives = 128/268 (47.76%), Query Frame = 1
Query: 1546 HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGE------KCLNSRISEIEESV----DENERLQKDIRSILNQVKEQMIAMGKGQQKTSRGMNASIKQV 2319
            HPT++ I P+       NSTI C   DGYP     W++I GP +A  +YN    G QIH+  N P  S+W +KC++KS L N    LN+TISF IA +P  +  +             KC          +N ++ E   + D       + +++  +  S +         M      T + LN +I     K+ M   G+      + LN+ I ++++ +     E +   + + + +NQVK QMIAMGK QQ TSRG+N SIKQV
Sbjct:  447 HPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGE-------------KC----------LNSRISEIEESVD-------ENERLQKDIRSILNQVKEQMIAMGKEQQETSRGLNASIK--QVKDQMIAMGKEQQETSRGLNASIKQVKDQMIAMGKEQQETSRGLNASINQVKGQMIAMGKEQQATSRGLNTSIKQV 682          

HSP 5 Score: 103.99 bits (258), Expect = 1.542e-22
Identity = 60/209 (28.71%), Postives = 101/209 (48.33%), Query Frame = 1
Query: 1534 MDLGHPTSILIMPVP------DGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEI 2142
            +DL  P+++ +  +P      + I+      +C    G P  +  +E  A      + YN   N   ++L+ +          CS  +  E   +         I +HP+ ++I+P IK   ++N  I+C+ +DGYP P +++QLI+GP NA  +Y     G +I+I S++P GS W  KC MKS +     +  K I+F IA +P  I
Sbjct:  155 IDLFIPSTLALTVLPIKVDRKEIIINDMVMASCRAFSGIPQEKPRFEDHAQLNVTEIIYNETANEISMNLRTSLDDHLT-NFSCSAGNVTETFIIC--------IHHHPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSI 354          

HSP 6 Score: 103.605 bits (257), Expect = 2.064e-22
Identity = 43/108 (39.81%), Postives = 67/108 (62.04%), Query Frame = 3
Query:  846 VTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIAR 1169
            +  T + RI +HP+ +YI+P I +  ++N  I+C+ KDGYP P +++QLI+GP NA  +Y     G +I+I SN+P  S W  +C MKS +     +  K I+F IA+
Sbjct:  436 LNRTISFRIANHPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAK 543          

HSP 7 Score: 90.5077 bits (223), Expect = 1.953e-18
Identity = 57/183 (31.15%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  657 INDMVMAS----CRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSL-NDHLTNFGC--------SAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIA 1166
            I D++ A+    C A  G PQ    F+     +     Y    N   +  R S  N     F C         A    +  T RI  HP+ I I P  + I++ N  I C   DGYP     +++I GP +AS YY   +NG++I+++ N PT+S W  +C +KS +  V +   + I+FRIA
Sbjct:  263 IKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIA 445          
BLAST of SMED30009340 vs. Planmine SMEST
Match: SMESG000014544.1 (SMESG000014544.1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 262/269 (97.40%), Postives = 265/269 (98.51%), Query Frame = 1
Query: 1543 GHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKGQQKTSRGMNASIKQVKEQMIAMGKE 2349
             HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYN MRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPT LYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGK QQ+TSRG+NASIKQVK+QMIAMGKE
Sbjct:  347 SHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKEQQETSRGLNASIKQVKDQMIAMGKE 615          

HSP 2 Score: 532.332 bits (1370), Expect = 2.450e-178
Identity = 256/337 (75.96%), Postives = 284/337 (84.27%), Query Frame = 3
Query:  156 ILQLALTETQVILSVTSSSIFPHFIGDSFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKFMDIKVWEKNPSSTAMNISIIFKRGAHNKYLETFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPPALAISVLPIKVDRKEKIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIA 1166
            IL L   E ++ L V S S FPHFIGD+FS+ IQ     S LS+D  DTMVIRIVDLN TEI++ +L+YG    +D+E +G  MDIK+WEKN  ST ++ISIIFKR AHNKYLE  YFSA NKF RRKYLKNLSLAKRLFHELI+LFIP  LA++VLPIKVDRKE IINDMVMASCRAF GIPQEKPRFEDHA LNVTE IYN+TANEI MN R SL+DHLTNF CSAGNVTETF I I+HHPS+I+IKPDI +ILQAN  IQCYA+DGYPQPS+HFQLIKGPSNASHYYETRKNGSEIYIRS+AP  SAWMF+CLMKSTIAGVAMTKEKNITFRIA
Sbjct:   10 ILHLLFAEAEIALFVRSVSNFPHFIGDAFSLDIQSRSENSKLSSDPSDTMVIRIVDLNFTEIERAYLVYGALYFMDDEFKGNLMDIKIWEKNQMSTKIDISIIFKREAHNKYLEILYFSAPNKFVRRKYLKNLSLAKRLFHELIDLFIPSTLALTVLPIKVDRKEIIINDMVMASCRAFSGIPQEKPRFEDHAQLNVTEIIYNETANEISMNLRTSLDDHLTNFSCSAGNVTETFIICIHHHPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIA 346          

HSP 3 Score: 168.318 bits (425), Expect = 3.871e-43
Identity = 82/209 (39.23%), Postives = 119/209 (56.94%), Query Frame = 1
Query: 1546 HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRI 2172
            HP+ I I P    I++ N  I C   DGYP     +++I GP +AS YY   +NG++I+++ + P  S W  KC +KS +  V +   + I+FRIA+HPT++ I P+       NSTI C   DGYP     W++I GP +A  +YNI   G QIH+  N P  S+W +KC++KS L N    LN+TISF IA +P  +  +  +  R 
Sbjct:  251 HPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTTLYIQPIIKKRF 459          

HSP 4 Score: 117.087 bits (292), Expect = 1.084e-26
Identity = 85/268 (31.72%), Postives = 128/268 (47.76%), Query Frame = 1
Query: 1546 HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGE------KCLNSRISEIEESV----DENERLQKDIRSILNQVKEQMIAMGKGQQKTSRGMNASIKQV 2319
            HPT++ I P+       NSTI C   DGYP     W++I GP +A  +YN    G QIH+  N P  S+W +KC++KS L N    LN+TISF IA +P  +  +             KC          +N ++ E   + D       + +++  +  S +         M      T + LN +I     K+ M   G+      + LN+ I ++++ +     E +   + + + +NQVK QMIAMGK QQ TSRG+N SIKQV
Sbjct:  445 HPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGE-------------KC----------LNSRISEIEESVD-------ENERLQKDIRSILNQVKEQMIAMGKEQQETSRGLNASIK--QVKDQMIAMGKEQQETSRGLNASIKQVKDQMIAMGKEQQETSRGLNASINQVKGQMIAMGKEQQATSRGLNTSIKQV 680          

HSP 5 Score: 103.605 bits (257), Expect = 1.592e-22
Identity = 60/209 (28.71%), Postives = 101/209 (48.33%), Query Frame = 1
Query: 1534 MDLGHPTSILIMPVP------DGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEI 2142
            +DL  P+++ +  +P      + I+      +C    G P  +  +E  A      + YN   N   ++L+ +          CS  +  E   +         I +HP+ ++I+P IK   ++N  I+C+ +DGYP P +++QLI+GP NA  +Y     G +I+I S++P GS W  KC MKS +     +  K I+F IA +P  I
Sbjct:  153 IDLFIPSTLALTVLPIKVDRKEIIINDMVMASCRAFSGIPQEKPRFEDHAQLNVTEIIYNETANEISMNLRTSLDDHLT-NFSCSAGNVTETFIIC--------IHHHPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSI 352          

HSP 6 Score: 103.219 bits (256), Expect = 2.113e-22
Identity = 43/108 (39.81%), Postives = 67/108 (62.04%), Query Frame = 3
Query:  846 VTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIAR 1169
            +  T + RI +HP+ +YI+P I +  ++N  I+C+ KDGYP P +++QLI+GP NA  +Y     G +I+I SN+P  S W  +C MKS +     +  K I+F IA+
Sbjct:  434 LNRTISFRIANHPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAK 541          

HSP 7 Score: 90.5077 bits (223), Expect = 2.053e-18
Identity = 57/183 (31.15%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  657 INDMVMAS----CRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSL-NDHLTNFGC--------SAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIA 1166
            I D++ A+    C A  G PQ    F+     +     Y    N   +  R S  N     F C         A    +  T RI  HP+ I I P  + I++ N  I C   DGYP     +++I GP +AS YY   +NG++I+++ N PT+S W  +C +KS +  V +   + I+FRIA
Sbjct:  261 IKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIA 443          
BLAST of SMED30009340 vs. Planmine SMEST
Match: SMESG000014544.1 (SMESG000014544.1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 262/269 (97.40%), Postives = 265/269 (98.51%), Query Frame = 1
Query: 1543 GHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKGQQKTSRGMNASIKQVKEQMIAMGKE 2349
             HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYN MRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPT LYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGK QQ+TSRG+NASIKQVK+QMIAMGKE
Sbjct:  345 SHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKEQQETSRGLNASIKQVKDQMIAMGKE 613          

HSP 2 Score: 531.946 bits (1369), Expect = 2.711e-178
Identity = 256/337 (75.96%), Postives = 284/337 (84.27%), Query Frame = 3
Query:  156 ILQLALTETQVILSVTSSSIFPHFIGDSFSILIQPLVNESNLSADLLDTMVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKFMDIKVWEKNPSSTAMNISIIFKRGAHNKYLETFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIPPALAISVLPIKVDRKEKIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIA 1166
            IL L   E ++ L V S S FPHFIGD+FS+ IQ     S LS+D  DTMVIRIVDLN TEI++ +L+YG    +D+E +G  MDIK+WEKN  ST ++ISIIFKR AHNKYLE  YFSA NKF RRKYLKNLSLAKRLFHELI+LFIP  LA++VLPIKVDRKE IINDMVMASCRAF GIPQEKPRFEDHA LNVTE IYN+TANEI MN R SL+DHLTNF CSAGNVTETF I I+HHPS+I+IKPDI +ILQAN  IQCYA+DGYPQPS+HFQLIKGPSNASHYYETRKNGSEIYIRS+AP  SAWMF+CLMKSTIAGVAMTKEKNITFRIA
Sbjct:    8 ILHLLFAEAEIALFVRSVSNFPHFIGDAFSLDIQSRSENSKLSSDPSDTMVIRIVDLNFTEIERAYLVYGALYFMDDEFKGNLMDIKIWEKNQMSTKIDISIIFKREAHNKYLEILYFSAPNKFVRRKYLKNLSLAKRLFHELIDLFIPSTLALTVLPIKVDRKEIIINDMVMASCRAFSGIPQEKPRFEDHAQLNVTEIIYNETANEISMNLRTSLDDHLTNFSCSAGNVTETFIICIHHHPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIA 344          

HSP 3 Score: 168.318 bits (425), Expect = 4.195e-43
Identity = 82/209 (39.23%), Postives = 119/209 (56.94%), Query Frame = 1
Query: 1546 HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGEKCLNSRI 2172
            HP+ I I P    I++ N  I C   DGYP     +++I GP +AS YY   +NG++I+++ + P  S W  KC +KS +  V +   + I+FRIA+HPT++ I P+       NSTI C   DGYP     W++I GP +A  +YNI   G QIH+  N P  S+W +KC++KS L N    LN+TISF IA +P  +  +  +  R 
Sbjct:  249 HPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTTLYIQPIIKKRF 457          

HSP 4 Score: 117.087 bits (292), Expect = 1.148e-26
Identity = 85/268 (31.72%), Postives = 128/268 (47.76%), Query Frame = 1
Query: 1546 HPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGE------KCLNSRISEIEESV----DENERLQKDIRSILNQVKEQMIAMGKGQQKTSRGMNASIKQV 2319
            HPT++ I P+       NSTI C   DGYP     W++I GP +A  +YN    G QIH+  N P  S+W +KC++KS L N    LN+TISF IA +P  +  +             KC          +N ++ E   + D       + +++  +  S +         M      T + LN +I     K+ M   G+      + LN+ I ++++ +     E +   + + + +NQVK QMIAMGK QQ TSRG+N SIKQV
Sbjct:  443 HPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEICGE-------------KC----------LNSRISEIEESVD-------ENERLQKDIRSILNQVKEQMIAMGKEQQETSRGLNASIK--QVKDQMIAMGKEQQETSRGLNASIKQVKDQMIAMGKEQQETSRGLNASINQVKGQMIAMGKEQQATSRGLNTSIKQV 678          

HSP 5 Score: 103.605 bits (257), Expect = 1.746e-22
Identity = 60/209 (28.71%), Postives = 101/209 (48.33%), Query Frame = 1
Query: 1534 MDLGHPTSILIMPVP------DGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIANHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNPMEI 2142
            +DL  P+++ +  +P      + I+      +C    G P  +  +E  A      + YN   N   ++L+ +          CS  +  E   +         I +HP+ ++I+P IK   ++N  I+C+ +DGYP P +++QLI+GP NA  +Y     G +I+I S++P GS W  KC MKS +     +  K I+F IA +P  I
Sbjct:  151 IDLFIPSTLALTVLPIKVDRKEIIINDMVMASCRAFSGIPQEKPRFEDHAQLNVTEIIYNETANEISMNLRTSLDDHLT-NFSCSAGNVTETFIIC--------IHHHPSKIHIKPDIKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSI 350          

HSP 6 Score: 103.219 bits (256), Expect = 2.219e-22
Identity = 43/108 (39.81%), Postives = 67/108 (62.04%), Query Frame = 3
Query:  846 VTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIAR 1169
            +  T + RI +HP+ +YI+P I +  ++N  I+C+ KDGYP P +++QLI+GP NA  +Y     G +I+I SN+P  S W  +C MKS +     +  K I+F IA+
Sbjct:  432 LNRTISFRIANHPTTLYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFYNIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAK 539          

HSP 7 Score: 90.5077 bits (223), Expect = 2.157e-18
Identity = 57/183 (31.15%), Postives = 85/183 (46.45%), Query Frame = 3
Query:  657 INDMVMAS----CRAFGGIPQEKPRFEDHAHLNVTERIYNKTANEIRMNFRVSL-NDHLTNFGC--------SAGNVTETFTIRIYHHPSQIYIKPDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEIYIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIA 1166
            I D++ A+    C A  G PQ    F+     +     Y    N   +  R S  N     F C         A    +  T RI  HP+ I I P  + I++ N  I C   DGYP     +++I GP +AS YY   +NG++I+++ N PT+S W  +C +KS +  V +   + I+FRIA
Sbjct:  259 IKDILQANRAIQCYAQDGYPQPSLHFQLIKGPSNASHYYETRKNGSEIYIRSSAPNGSAWMFKCLMKSTIAGVAMTKEKNITFRIASHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESASLYYNIMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIA 441          
The following BLAST results are available for this feature:
BLAST of SMED30009340 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009340 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013579.19.349e-8394.97SMESG000013579.1[more]
SMESG000013579.12.276e-1094.97SMESG000013579.1[more]
SMESG000014544.12.143e-17897.40SMESG000014544.1[more]
SMESG000014544.12.450e-17897.40SMESG000014544.1[more]
SMESG000014544.12.711e-17897.40SMESG000014544.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009340 ID=SMED30009340|Name=SMED30009340|organism=Schmidtea mediterranea sexual|type=transcript|length=2349bp
ATCTCTTTGTTTCTCTGGGAGCCTAATGTAAATCATTTCAATTTGTGTTG
CTGGGGTCCTTGAACTTTGGTCCGTTCTACGCTGCATCCAATTTAATATA
TTGCGATAAACAAGCTGAATAATTCATTCTAAATGAAAATGAAAACTCCA
GCATAATTCTACAACTTGCATTGACAGAAACTCAAGTCATCTTGTCCGTC
ACGTCTAGTTCAATATTTCCACATTTTATTGGGGATTCCTTTTCCATCCT
AATCCAACCTCTGGTTAACGAGAGTAATTTGAGTGCTGATCTGTTAGATA
CGATGGTGATCCGTATTGTTGATTTGAATCTTACGGAGATTCAAAAAGAA
TTTCTTATTTATGGAGTGCAAGATTCTCTAGATGAAGAAATTCAAGGGAA
ATTTATGGACATTAAAGTATGGGAGAAGAATCCCTCATCAACGGCCATGA
ACATATCTATAATATTCAAGCGAGGGGCCCATAACAAATATTTAGAAACA
TTTTACTTTTCTGCTTCCAATAAATTTCAACGTAGAAAATATTTAAAGAA
TCTCTCCCTTGCCAAGCGGTTATTTCATGAACTGATTGAGTTGTTTATCC
CACCCGCATTGGCGATCTCGGTGCTCCCAATTAAGGTTGACAGAAAGGAG
AAAATAATAAATGATATGGTAATGGCGTCCTGTAGAGCTTTCGGTGGAAT
TCCACAAGAAAAACCAAGATTCGAGGATCACGCTCACTTGAATGTGACGG
AGAGAATATATAATAAAACGGCCAATGAGATCAGAATGAATTTTCGCGTA
TCTCTCAATGACCATCTCACTAATTTCGGCTGCAGTGCCGGAAATGTTAC
GGAAACTTTCACAATCCGTATTTATCATCACCCGTCCCAGATCTACATAA
AGCCAGATATTAATGAGATATTGCAAGCTAACATAGTCATTCAATGCTAT
GCCAAAGATGGATACCCTCAGCCTTCAGTTCATTTCCAGCTCATCAAAGG
TCCATCAAACGCATCTCACTATTATGAGACTAGGAAAAACGGATCCGAAA
TCTACATCCGTTCAAATGCCCCAACCAGATCAGCGTGGATGTTCAGATGC
TTAATGAAAAGCACAATTGCAGGGGTAGCAATGACCAAGGAAAAGAATAT
TACCTTTCGAATAGCCAGGCCAGGAATCCAGAATCCTGCAAACGGAGTCT
TCCGCATGTTTTGTTCAATTGAAATAATAATTTTGGAAGTTCTCAAATTT
TCAACCGTTTAACAGTCCACATGGATTGAATTGTGATTTCCACTGAATGA
TTAAAGAAGCTATAGAAGTGCCTCACTGGCCCGTGAAGGAAATATGGACT
AATGCCAGATCAAATATATAAACGCCATTGAATCAGATTGACAAACAATA
TTCTCCTTAGCTTGACCACTTGTAATGACATTTAAGATCAAATGTGAATT
TGTTCTTGACAGGGATTCAAGGTCAGTGATGGGATCAACATGATATGGAC
AGGTGGACCTGTCCCGAGTGACTGTGTAATTAAATGGACTTGGGCCATCC
GACATCAATCCTGATCATGCCAGTGCCAGATGGAATAATGGAACCGAATT
CAACAATTGCTTGTGGCCCAGCTGACGGATATCCTGTTGCCAGAGCAACA
TGGGAAGTTATTGCGGGCCCAGAAAGCGCTTCACTATATTATAATTTTAT
GCGCAATGGAACGCAAATTCATCTGAAAGAAAATTGCCCTACAAAATCTG
AATGGGAAATCAAATGCTCTGTTAAAAGTTGCTTGGAAAATGTTTGTGTA
ATCCTCAATCGGACAATTTCATTTAGAATAGCAAATCACCCGACCGCATT
ATATATTCAACCAATCATCAAAAAGAGATTCCGATCAAACTCAACAATAA
AATGCTTCACAAAAGATGGATATCCAGATCCAGAAATAAATTGGCAATTA
ATTGAAGGCCCCCCAAATGCTGACCGATTTTACAATATCCCTGGAAAGGG
TGACCAAATCCACATCAATAGCAACAGCCCGGTCGGTTCAAAATGGACAT
TAAAATGCACAATGAAAAGCGTTCTGGTCAATACCAAGAAAAGCCTGAAT
AAAACTATTTCATTTTCAATTGCTAAGAATCCGATGGAAATTTGCGGAGA
GAAATGTTTGAATTCAAGGATATCTGAAATTGAGGAATCTGTGGACGAGA
ACGAGAGGCTGCAAAAGGATATCCGGTCGATATTGAATCAGGTAAAGGAG
CAGATGATAGCAATGGGAAAGGGGCAACAAAAAACTTCCAGAGGAATGAA
TGCCAGCATTAAACAGGTGAAGGAACAAATGATAGCAATGGGAAAGGAG
back to top

protein sequence of SMED30009340-orf-1

>SMED30009340-orf-1 ID=SMED30009340-orf-1|Name=SMED30009340-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MDLGHPTSILIMPVPDGIMEPNSTIACGPADGYPVARATWEVIAGPESAS
LYYNFMRNGTQIHLKENCPTKSEWEIKCSVKSCLENVCVILNRTISFRIA
NHPTALYIQPIIKKRFRSNSTIKCFTKDGYPDPEINWQLIEGPPNADRFY
NIPGKGDQIHINSNSPVGSKWTLKCTMKSVLVNTKKSLNKTISFSIAKNP
MEICGEKCLNSRISEIEESVDENERLQKDIRSILNQVKEQMIAMGKGQQK
TSRGMNASIKQVKEQMIAMGKE
back to top

protein sequence of SMED30009340-orf-2

>SMED30009340-orf-2 ID=SMED30009340-orf-2|Name=SMED30009340-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MVIRIVDLNLTEIQKEFLIYGVQDSLDEEIQGKFMDIKVWEKNPSSTAMN
ISIIFKRGAHNKYLETFYFSASNKFQRRKYLKNLSLAKRLFHELIELFIP
PALAISVLPIKVDRKEKIINDMVMASCRAFGGIPQEKPRFEDHAHLNVTE
RIYNKTANEIRMNFRVSLNDHLTNFGCSAGNVTETFTIRIYHHPSQIYIK
PDINEILQANIVIQCYAKDGYPQPSVHFQLIKGPSNASHYYETRKNGSEI
YIRSNAPTRSAWMFRCLMKSTIAGVAMTKEKNITFRIARPGIQNPANGVF
RMFCSIEIIILEVLKFSTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 209..243