Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30009329
Length (bp)2701
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30009329) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30009329) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dimer_Tnp_hAT domain-containing protein (SMED30009329) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30009329) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: T1HS18 (Dimer_Tnp_hAT domain-containing protein OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.034e-33
Identity = 45/76 (59.21%), Postives = 61/76 (80.26%), Query Frame = 3
Query: 2013 RVENILSKLQKEISLFEISGKKRDFLQRVYNFLLTIKPTSVESERAFSTAGLICSKIRSRLNDDTIDELCFLRSHF 2240
            ++ ++  K++ EI+ FE +G K  +LQ VY+FL+TI PTSVESERAFS AG IC+KIRS L+D+TID LCFLR++F
Sbjct:  214 KIPSLEQKIKDEITFFEKTGTKGTYLQNVYDFLMTIVPTSVESERAFSAAGYICTKIRSSLDDETIDCLCFLRAYF 289          

HSP 2 Score: 76.2554 bits (186), Expect = 1.034e-33
Identity = 56/146 (38.36%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 1520 EYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRTKLISLVQYLHNGHNDSMKTTEAFAPSTNSKNKKLMLEILQRLNTTNLTDG----VIKEAATSDDIREISCNEDILHNEK 1945
            E+ ++  ++  L+ +K+TVDA+CR D NL+TAD  L FML  L QQ S I  E+  AL  RI  RRT+L  ++QYL  G  D     E F   +     K ++ + +RL   NL D     V++E  TS  I     NE IL ++K
Sbjct:   46 EFNLLSSIIAALTPVKLTVDALCRKDANLLTADASLTFMLNTLSQQKSTIALELLEALKSRILLRRTELSQILQYLQKGSQD---VVEVFKRISKFTIIKKIVSLTKRLTHENLEDTEDMEVVQE--TSLPIYFQISNETILESDK 186          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: T1HWC4 (Dimer_Tnp_hAT domain-containing protein OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.927e-33
Identity = 44/76 (57.89%), Postives = 60/76 (78.95%), Query Frame = 3
Query: 2013 RVENILSKLQKEISLFEISGKKRDFLQRVYNFLLTIKPTSVESERAFSTAGLICSKIRSRLNDDTIDELCFLRSHF 2240
            ++ ++  K++ EI+ FE +G K  +LQ VY+FL+TI PTSVESERAFS AG IC+KIRS L+D+ ID LCFLR++F
Sbjct:  181 KIPSLEQKIKDEITFFEKTGTKGTYLQNVYDFLMTIVPTSVESERAFSAAGYICTKIRSSLDDEMIDCLCFLRAYF 256          

HSP 2 Score: 77.7962 bits (190), Expect = 1.927e-33
Identity = 57/151 (37.75%), Postives = 81/151 (53.64%), Query Frame = 2
Query: 1505 KMDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRTKLISLVQYLHNGHNDSMKTTEAFAPSTNSKNKKLMLEILQRLNTTNLTDG----VIKEAATSDDIREISCNEDILHNEK 1945
            KM + E+ ++  ++  L+ +K+TVDA+CR D NL+TAD  L FML  L QQ S I  E+   L  RI  RRT+L  ++QYL  G  D     E F   +     K ++ + +RL   NL D     V++E  TS  I     NE IL ++K
Sbjct:    8 KMTDKEFNLLSSIIAALTPVKLTVDALCRKDANLLTADASLTFMLNTLSQQKSTIALELLEVLKSRILLRRTELSQILQYLQKGSKD---VVEVFKRISKFTIIKKIVSLTKRLTHENLEDTEDMEVVQE--TSLPISFQISNETILESDK 153          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: H9JJ88 (BED-type domain-containing protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.187e-33
Identity = 58/163 (35.58%), Postives = 96/163 (58.90%), Query Frame = 2
Query: 1451 VKKLSTKALVDFHIDDSLKMDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRTKLISLVQYLHNG--HNDSMKTTE-AFAPSTNSKNKKLMLEILQRLNTTNLTDGVIKEAATSDDIREISCNEDI 1930
            +K  +TKAL+D  ++  +   E E+  + DL+  L  +K+ V+ +CR D+ L+TAD  L F+L+KL++Q S ++ +++ AL +RIKERRT L  +V YLHN   +  S+K+ E  F     ++ +  +++I +RL T     G   E    DD  + S +EDI
Sbjct:  384 LKGCTTKALID--VESEITFTEDEWADIKDLLLSLQPLKLGVEVLCRRDSTLLTADTTLRFILEKLDKQQSRVSGDLATALRMRIKERRTDLSGIVLYLHNPKKYEKSVKSPEDTFLLPKKNRIRLELIKICERLLTVKEDTGRA-EGEHFDDEEDNSSDEDI 543          

HSP 2 Score: 76.2554 bits (186), Expect = 4.187e-33
Identity = 35/78 (44.87%), Postives = 51/78 (65.38%), Query Frame = 3
Query: 2007 PTRVENILSKLQKEISLFEISGKKRDFLQRVYNFLLTIKPTSVESERAFSTAGLICSKIRSRLNDDTIDELCFLRSHF 2240
            P + +N    ++ E+  +E  G K   L  V+ +L TI PTSVE+ERAFS  G +CS IR+++ D T+D +CFLRS+F
Sbjct:  566 PIKSQNFEKTIKAEMVEYENKGIKGKHLTMVHKYLNTISPTSVEAERAFSVTGYVCSPIRNKMTDRTLDTICFLRSYF 643          

HSP 3 Score: 39.2762 bits (90), Expect = 4.187e-33
Identity = 18/36 (50.00%), Postives = 24/36 (66.67%), Query Frame = 3
Query: 1356 YVKIDFGKDIRLKNDCKTRRSSLLCMLERFNMLKNC 1463
            Y + D GK+  L  DC+T+ S+L  MLERF +LK C
Sbjct:  352 YAREDLGKEYGLILDCRTKWSTLYDMLERFKVLKGC 387          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A4C1XQA5 (Uncharacterized protein OS=Eumeta variegata OX=151549 GN=EVAR_98391_1 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.447e-23
Identity = 50/141 (35.46%), Postives = 85/141 (60.28%), Query Frame = 2
Query: 1469 KALVDFHIDDSLKMDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRT-KLISLVQYLHNGHND-------SMKTTEAFAPSTNSKNKKLMLEILQRLNTTNLTD 1867
            KAL+D  ++  + +++ E+++V  +V+VL+ IK+TV+AICR D NL TAD  L F++K+L  +NS +  +I   LV RIK+RR+  L  ++ YL N   D        ++    F   T +  +K +  I++RLN+ + T+
Sbjct:  186 KALID--LNHPICLEDVEFELVNKIVDVLTPIKLTVEAICRRDANLCTADAALNFLIKQLSSKNSALAKKIKTCLVDRIKQRRSDNLTGVLNYLQNPRKDEENQLLSELEWHNLFPVPTQALLRKQIKSIVKRLNSRDDTE 324          

HSP 2 Score: 59.6918 bits (143), Expect = 7.447e-23
Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 3
Query: 1314 FK*LPTKNDNYL*NYVKIDFGKDIRLKNDCKTRRSSLLCMLERFNMLKNCLQR 1472
            FK  P KN+  L  YVKI+ GK++ L  DCKTR +SLL MLERF +LK+C+Q+
Sbjct:  134 FKRSPLKNETVLQKYVKIEHGKELSLLLDCKTRWNSLLTMLERFYLLKSCIQK 186          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A4C1V2H5 (Uncharacterized protein OS=Eumeta variegata OX=151549 GN=EVAR_82851_1 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.613e-22
Identity = 50/141 (35.46%), Postives = 85/141 (60.28%), Query Frame = 2
Query: 1469 KALVDFHIDDSLKMDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRT-KLISLVQYLHNGHND-------SMKTTEAFAPSTNSKNKKLMLEILQRLNTTNLTD 1867
            KAL+D  ++  + +++ E+++V  +V+VL+ IK+TV+AICR D NL TAD  L F++K+L  +NS +  +I   LV RIK+RR+  L  ++ YL N   D        ++    F   T +  +K +  I++RLN+ + T+
Sbjct:  253 KALID--LNHPICLEDVEFELVNKIVDVLTPIKLTVEAICRRDANLCTADAALNFLIKQLSSKNSALAKKIKTCLVDRIKQRRSDNLTGVLNYLQNPRKDEENQLLSELEWHNLFPVLTQALLRKQIKSIVKRLNSRDDTE 391          

HSP 2 Score: 59.6918 bits (143), Expect = 2.613e-22
Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 3
Query: 1314 FK*LPTKNDNYL*NYVKIDFGKDIRLKNDCKTRRSSLLCMLERFNMLKNCLQR 1472
            FK  P KN+  L  YVKI+ GK++ L  DCKTR +SLL MLERF +LK+C+Q+
Sbjct:  201 FKRSPLKNETVLQKYVKIEHGKELSLLLDCKTRWNSLLTMLERFYLLKSCIQK 253          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000055071.1 (SMESG000055071.1)

HSP 1 Score: 244.973 bits (624), Expect = 9.165e-76
Identity = 126/169 (74.56%), Postives = 141/169 (83.43%), Query Frame = 2
Query: 1508 MDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRTKLISLVQYLHNGHNDSMKTTEAFAPSTNSKNKKLMLEILQRLNTTNLTDGVIKEAATSDDIREISCNEDILHNEKSIGEQLNQVLENDFISA*KPPNK 2014
            MD+Y+YKIVLDLVNVLS  K+TVD IC CD NLITA    +FMLKKLE+QNSNI+N+IS ALVIR KER T+L SL QYLHNGH DS + TEAF PSTNSK+KK +LE+LQRLN T+LT GVIKE ATSDDIREISCNEDIL+NEKSIGEQLNQ LE   ISA KPP +
Sbjct:    1 MDKYKYKIVLDLVNVLSPFKLTVDTICLCDANLITA----KFMLKKLEKQNSNISNDISSALVIRNKERITQLSSLAQYLHNGHYDSTEMTEAFVPSTNSKSKKRILELLQRLNATDLTAGVIKEVATSDDIREISCNEDILYNEKSIGEQLNQALEKYLISARKPPTR 165          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000009273.1 (SMESG000009273.1)

HSP 1 Score: 192.586 bits (488), Expect = 4.704e-66
Identity = 100/129 (77.52%), Postives = 108/129 (83.72%), Query Frame = 2
Query: 1451 VKKLSTKALVDFHIDDSLKMDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRTKLISLVQYLHNGHNDSMKTTEAFAPSTNSKNKKLMLEIL 1837
            VK    KALVDFHID+SLKMDEYEY IVLDLVNVLS IK+TVD ICR D NLI  DI +EFMLKKLEQ+ SNI+NEIS ALVIRIK RRT+L SL QYLHNGHNDSMK T+ F PSTNSKNKKLMLE+ 
Sbjct:  163 VKSCIKKALVDFHIDESLKMDEYEYTIVLDLVNVLSTIKLTVDEICRRDANLIIVDIAIEFMLKKLEQKISNISNEIS-ALVIRIKGRRTQLSSLAQYLHNGHNDSMKMTKVFVPSTNSKNKKLMLELF 290          

HSP 2 Score: 80.1073 bits (196), Expect = 4.704e-66
Identity = 38/55 (69.09%), Postives = 47/55 (85.45%), Query Frame = 3
Query: 1308 NIFK*LPTKNDNYL*NYVKIDFGKDIRLKNDCKTRRSSLLCMLERFNMLKNCLQR 1472
            +IFK   TKNDNYL  YVKIDF K I LK+DCKTRRSSLLCMLE+F+M+K+C+++
Sbjct:  115 HIFKRSQTKNDNYLQKYVKIDFWKVIHLKSDCKTRRSSLLCMLEKFHMVKSCIKK 169          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000077237.1 (SMESG000077237.1)

HSP 1 Score: 150.599 bits (379), Expect = 1.581e-42
Identity = 78/112 (69.64%), Postives = 91/112 (81.25%), Query Frame = 2
Query: 1508 MDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRTKLISLVQYLHNGHNDSMKTTEAFAPSTNSKNKKLMLEILQR 1843
            MDEYEYKIVLD VNVLS  K+T+DAI RCD NL+T DI LEF LKKLE QNS  +N+ISLA+VI IK+ RT+L SL QY HNGH+DS+  TEA  PSTNSKN KLML++L+R
Sbjct:    1 MDEYEYKIVLDRVNVLSTFKLTLDAISRCDANLVTTDIALEFRLKKLE-QNSTTSNKISLAVVILIKD-RTQLSSLAQYFHNGHSDSINMTEASVPSTNSKNTKLMLDLLRR 110          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000049212.1 (SMESG000049212.1)

HSP 1 Score: 124.79 bits (312), Expect = 3.083e-33
Identity = 59/79 (74.68%), Postives = 65/79 (82.28%), Query Frame = 3
Query: 2004 PPTRVENILSKLQKEISLFEISGKKRDFLQRVYNFLLTIKPTSVESERAFSTAGLICSKIRSRLNDDTIDELCFLRSHF 2240
            P TRVEN LSKLQKE+ LF+  G K D+LQ+ YNFLL I+PT VESER FS AGL+CSKIRSRLND TID LCFLRSHF
Sbjct:   37 PSTRVENTLSKLQKEMPLFKSGGTKGDYLQKFYNFLLAIRPTIVESERVFSAAGLMCSKIRSRLNDITIDALCFLRSHF 115          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000081985.1 (SMESG000081985.1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.447e-31
Identity = 46/144 (31.94%), Postives = 84/144 (58.33%), Query Frame = 2
Query: 1469 KALVDFHIDDSLKMDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQNSNINNEISLALVIRIKERRTKLISLVQYLHNGHNDSMKTTEAFAPSTNSKNKKLMLEILQRLNTTNLTDGVIKE-AATSD 1897
            K+L+D  I   + + ++E++    L++ L  IK+TV+A+CR D NL+T D  L+FML KLE+ ++++  E+  AL   I++RRT++   +QYLH G +  +  +E F+  T +  K  +++         + D  ++   ATS+
Sbjct:    8 KSLID--IKSKITICDHEFEQASTLLSTLHPIKITVEALCRKDANLLTCDAALKFMLNKLEKLDNSLAKELLKALNTCIRQRRTEISGPLQYLHRGKDTFIDDSEVFSVPTRNFVKTFIVDYWTSFGLEEVADSAVQTLTATSN 149          

HSP 2 Score: 77.7962 bits (190), Expect = 3.447e-31
Identity = 41/85 (48.24%), Postives = 57/85 (67.06%), Query Frame = 3
Query: 1986 LYQLENPPTRVENILSKLQKEISLFEISGKKRDFLQRVYNFLLTIKPTSVESERAFSTAGLICSKIRSRLNDDTIDELCFLRSHF 2240
            L  +EN P+     ++ + +E+ +FE S  +   LQRVYN LL I PTSV S+RAFS AG I S +R+RL++ +ID LCFLR +F
Sbjct:  188 LVSIENCPSL--KFITVVGREMKIFEESSHRGPHLQRVYNDLLIIPPTSVVSDRAFSAAGTIISNLRTRLDNKSIDSLCFLRCYF 270          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1HS181.034e-3359.21Dimer_Tnp_hAT domain-containing protein OS=Rhodniu... [more]
T1HWC41.927e-3357.89Dimer_Tnp_hAT domain-containing protein OS=Rhodniu... [more]
H9JJ884.187e-3335.58BED-type domain-containing protein OS=Bombyx mori ... [more]
A0A4C1XQA57.447e-2335.46Uncharacterized protein OS=Eumeta variegata OX=151... [more]
A0A4C1V2H52.613e-2235.46Uncharacterized protein OS=Eumeta variegata OX=151... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055071.19.165e-7674.56SMESG000055071.1[more]
SMESG000009273.14.704e-6677.52SMESG000009273.1[more]
SMESG000077237.11.581e-4269.64SMESG000077237.1[more]
SMESG000049212.13.083e-3374.68SMESG000049212.1[more]
SMESG000081985.13.447e-3131.94SMESG000081985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009329 ID=SMED30009329|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2701bp
ATCAAAAATTTATTTATATTTTGTTGAGAGATTTTGAAAAATTTAACAAA
AAATTACCTTTTAATTTAATTATTGACAATTTAATTTAATTATTAAAATT
ATATTAAATGTAAACCGATTCGAATAAACAGATGAGTTTTAAATAAAATT
ATCTCTAGTGGAAATGAACATATCAAAAACTCATTTATTTGAAGAAAAGT
TTGAGAAATATCTGTTGTCTCTCAACCTAATAAAATTTCGAAGGTAAACT
CTTTGAGCTCGCTAATTAATTTTCCATCCAGTCCTATCAACTCAGCTCAC
CAATGTGTGATAAATTTTAAAAACAATTATATTGTTAAGCTAAAGGCTTC
CTTTCATAGGTCTTTATACAAGCAACTTGTTTCCTTTCAGGAATATTAAG
GTAAAACGGTTAAGCAAGTATTCTTATCGTACCCGACTTCAGAATGAAAA
CAATAAAATTTAACATAAAATTTGTCATGAATGAAAACCTATCATATATA
GGTACTAAATGTCATGGTGGTCAACATATTTTGGCCAGTGTGAAACCAGT
TCAGAAAAAGTATTTGTAAAGAAATCGGAGAAACATTGGTTAAAGAAATT
CTTTACAGCAGCCTTTATATTCTCTATTGAAAACGTTGTCCTTCGTAAAT
TCTTCTTGAGGTGTCGGAAAAGCCAAAAAATATTTGGTGCCAGTTTGGGC
TGTATGGGGGGTGATCCACGAGCGTCTAACTAATAGCTTCAATTGTGTTT
CGAGAAATACTTCATGTGTCCACATGTATATTCTTTTGTTAGAACCAAAA
TGGCGTCTTCCTTGTTTATCTCTTTTTGGGCCTTTGCACAAGCTGACTAT
AATAGGCCGAATTAATTGTCACACATTTGTTTGCGAAATCACCGAGAAAT
TTCTTCTTGATACCAAAAATTCTAAAGCATCATCCCGCATCATGGCTTGA
CATTTATAAAATTATTAATTGATTAATAAAATTTTGCGATGCAATCTATT
ATTTTCCAACGACGCAACGCAAAAAATATACATAACCATGAAAGTTTTAT
TTTTTTCTAAATATCTTTCAACTAGGGTTTACAATCCCGGGCTTCCGTAT
AATTTCCCCCATCTCGAAATCCCGGCATTTCGGGATTTAAGTAATTTGGG
TATGATTTGAAGCAATGAGATATATGCATATCAACTCCATAATTGTTGTT
GGTACAACTATTTTGATTATTATTGATTTGGGTTAGATTTGTATTTTTCT
TCAATAATTTAAACTATAGTGATATCAGAATTTAAAATTTTCTTTTTAAC
AAAAAGCAATATCTTTAAATGATTACCTACAAAAAACGACAATTATTTAT
AAAATTATGTAAAAATTGATTTTGGGAAGGACATTCGTTTGAAAAACGAT
TGTAAAACACGACGGAGTAGCCTACTCTGTATGCTGGAAAGATTTAATAT
GTTAAAAAATTGTCTACAAAGGCATTGGTTGACTTCCACATTGATGATTC
GTTAAAAATGGACGAATATGAGTATAAAATTGTTTTGGATTTAGTTAATG
TTTTGAGTCTAATTAAAGTAACGGTTGATGCGATTTGTCGATGCGATACT
AATTTAATAACCGCAGATATTGGATTAGAATTTATGTTGAAAAAGTTGGA
ACAACAAAATTCTAACATCAATAACGAAATTTCTTTAGCTTTAGTTATTC
GAATTAAAGAGAGAAGAACAAAATTAATCAGCTTAGTTCAATATTTGCAC
AACGGTCATAATGATTCAATGAAAACGACTGAAGCTTTTGCACCATCCAC
AAATTCTAAAAACAAAAAACTTATGTTGGAGATTCTTCAGCGATTGAATA
CAACAAATTTAACAGACGGAGTTATTAAGGAAGCCGCTACCTCTGATGAT
ATTAGGGAAATTTCATGCAATGAAGATATACTTCATAATGAGAAGTCTAT
TGGTGAACAATTGAATCAAGTCCTTGAAAACGATTTTATATCAGCTTGAA
AACCCCCCAACAAGAGTTGAAAATATATTATCTAAACTACAAAAAGAAAT
TTCGTTATTCGAAATTAGTGGTAAAAAAAGGGACTTTCTTCAAAGAGTTT
ACAATTTTTTACTGACGATTAAGCCCACAAGTGTAGAGTCTGAACGGGCG
TTTTCAACTGCTGGTTTGATATGCTCAAAAATTCGGAGTAGGTTAAATGA
TGACACGATTGATGAATTATGCTTTTTAAGATCGCATTTTTAAAAAAATA
AATAACTGATCCTTTAATTTTTGAAATTATGAGATATATTTTGAGCACAA
TGTGTGAATGTTCCTTTCTAAATGAAATATTATTTATTATGTAAGAGTAT
TTGTTTATACTATTTTATAAAGCAAAATAAATCAATGCATTTTTTATTTT
TTATTAACCTATACCAAGAAATATTAATTTTGTTTATAAAAATCTAATAC
CACTCATATTTATGTGCGTATTTTCTATTGATTTAAAGAGAAAAAAATCC
AGAGTTTCCACGGAATTAAAATTTTCGGGATTTTTGCAATTCATAGTTGT
AATAGATATTTTATTCAGCTCAATAAATATTTTAAACAGATATCGTTCTC
TTAGTGAATTATTCTATCGTATCTATATCAATTAATTAAACGCGTAATTC
ACGGATAGGGTTGTAGTCTATCACCCAGCCAGAGGAGCCAGATCGGAAGA
G
back to top

protein sequence of SMED30009329-orf-1

>SMED30009329-orf-1 ID=SMED30009329-orf-1|Name=SMED30009329-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MDEYEYKIVLDLVNVLSLIKVTVDAICRCDTNLITADIGLEFMLKKLEQQ
NSNINNEISLALVIRIKERRTKLISLVQYLHNGHNDSMKTTEAFAPSTNS
KNKKLMLEILQRLNTTNLTDGVIKEAATSDDIREISCNEDILHNEKSIGE
QLNQVLENDFISA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR008906HATC_C_dom
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation