Peptidyl-tRNA hydrolase

Overview
NamePeptidyl-tRNA hydrolase
Smed IDSMED30009319
Length (bp)666
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-tRNA hydrolase (SMED30009319) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-tRNA hydrolase (SMED30009319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidyl-tRNA hydrolase (SMED30009319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidyl-tRNA hydrolase (SMED30009319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30009319SMESG000050574.1 dd_Smed_v4_2074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009319SMESG000050574.1 dd_Smed_v4_2074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009319SMESG000050574.1 dd_Smed_v4_2074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30009319SMESG000050574.1 dd_Smed_v4_2074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Human
Match: PTRH2 (peptidyl-tRNA hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:24265])

HSP 1 Score: 142.895 bits (359), Expect = 1.754e-42
Identity = 72/118 (61.02%), Postives = 86/118 (72.88%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            S + KM+LVVR DL MGKGK+AAQC HA++  YK  +++ PEM+K WE  GQ KVV+K   EE+L  L A A  LGL   +I DAGRTQIA GS TV+GIGPGP  LID+VTG LKLY
Sbjct:   62 SGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY 179          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Human
Match: PTRH2 (peptidyl-tRNA hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:24265])

HSP 1 Score: 142.895 bits (359), Expect = 1.754e-42
Identity = 72/118 (61.02%), Postives = 86/118 (72.88%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            S + KM+LVVR DL MGKGK+AAQC HA++  YK  +++ PEM+K WE  GQ KVV+K   EE+L  L A A  LGL   +I DAGRTQIA GS TV+GIGPGP  LID+VTG LKLY
Sbjct:   62 SGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY 179          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Human
Match: PTRH2 (peptidyl-tRNA hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:24265])

HSP 1 Score: 142.895 bits (359), Expect = 1.867e-42
Identity = 72/118 (61.02%), Postives = 86/118 (72.88%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            S + KM+LVVR DL MGKGK+AAQC HA++  YK  +++ PEM+K WE  GQ KVV+K   EE+L  L A A  LGL   +I DAGRTQIA GS TV+GIGPGP  LID+VTG LKLY
Sbjct:   63 SGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY 180          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Celegans
Match: cox-16 (Probable peptidyl-tRNA hydrolase 2 [Source:UniProtKB/Swiss-Prot;Acc:O76387])

HSP 1 Score: 86.6557 bits (213), Expect = 4.204e-20
Identity = 52/115 (45.22%), Postives = 66/115 (57.39%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKS--GKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            KMVLV    L MG GKIAAQ  HA+LG Y+     +     I  W   GQ K+V+K ++ E L +L  +A   G    ++ DAG TQI AGS TV+GI  G +  +D VTG LKL
Sbjct:  202 KMVLVANMSLKMGTGKIAAQVGHATLGVYRQAMNSENGQNAIAAWTRHGQVKIVVKGQSTEQLMDLCKVAKDAGCYYYLVQDAGYTQIPAGSRTVLGIF-GTVEQVDSVTGGLKL 315          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Fly
Match: CG1307 (gene:FBgn0026566 transcript:FBtr0346140)

HSP 1 Score: 117.472 bits (293), Expect = 9.946e-33
Identity = 57/118 (48.31%), Postives = 80/118 (67.80%), Query Frame = 3
Query:  201 VSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            +++  KMVLVVR DL MGKGKIAAQC H ++G Y+    +TP ++++WEN G AK+ ++ E+E  L  ++  A    L + +I DAGRTQI A S TV+ +GP   + ID+VTG LKL
Sbjct:   68 LNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTPRLLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKL 185          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Fly
Match: CG1307 (gene:FBgn0026566 transcript:FBtr0301623)

HSP 1 Score: 117.472 bits (293), Expect = 9.946e-33
Identity = 57/118 (48.31%), Postives = 80/118 (67.80%), Query Frame = 3
Query:  201 VSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            +++  KMVLVVR DL MGKGKIAAQC H ++G Y+    +TP ++++WEN G AK+ ++ E+E  L  ++  A    L + +I DAGRTQI A S TV+ +GP   + ID+VTG LKL
Sbjct:   68 LNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTPRLLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKL 185          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Fly
Match: CG17327 (gene:FBgn0038107 transcript:FBtr0082721)

HSP 1 Score: 105.916 bits (263), Expect = 7.548e-29
Identity = 52/116 (44.83%), Postives = 75/116 (64.66%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKS---GKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            K+ LVVRTDL M KGK AAQC HA++ CY+S   G K    +++ W   GQ K+VL+ +  E L  L+  A    +V+ ++ DAGRTQ+ +G+ATV+G+GP P   +D++   LKL
Sbjct:   23 KLALVVRTDLKMSKGKTAAQCAHAAVMCYQSSVQGTKLQNAILQRWCRLGQPKIVLRVDNFEQLNSLERQAQESNVVAALVRDAGRTQLESGTATVLGLGPAPAEDLDKLVAHLKL 138          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Fly
Match: CG17327 (gene:FBgn0038107 transcript:FBtr0336813)

HSP 1 Score: 105.916 bits (263), Expect = 7.548e-29
Identity = 52/116 (44.83%), Postives = 75/116 (64.66%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKS---GKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            K+ LVVRTDL M KGK AAQC HA++ CY+S   G K    +++ W   GQ K+VL+ +  E L  L+  A    +V+ ++ DAGRTQ+ +G+ATV+G+GP P   +D++   LKL
Sbjct:   23 KLALVVRTDLKMSKGKTAAQCAHAAVMCYQSSVQGTKLQNAILQRWCRLGQPKIVLRVDNFEQLNSLERQAQESNVVAALVRDAGRTQLESGTATVLGLGPAPAEDLDKLVAHLKL 138          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Zebrafish
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-050522-163])

HSP 1 Score: 144.436 bits (363), Expect = 2.813e-43
Identity = 84/175 (48.00%), Postives = 106/175 (60.57%), Query Frame = 3
Query:   60 DLFYSQLYPIVSAGLGVLLGIIVTWKFGPKPFKSTE-FSVPLPKMSYKVSEKA--------KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            D  Y      V AGLG   G+ V W    +  +S+      L   +   SE +        KM+LVVRTDL MGKGK+AAQC HA++  YK  +++ PE++K WENSGQ KVV+K   E+ L +L A A  +GL   +I DAGRTQIA GS TV+GIGPG   LID+VTG LKLY
Sbjct:    4 DSLYGPFGLGVLAGLGC--GLCVGWHLSGRFGRSSRSMMTALGNSASNGSETSVMGESGEFKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQVQRRNPELLKQWENSGQPKVVVKAPDEDCLLDLLAHAKEVGLPVSLIQDAGRTQIAPGSRTVLGIGPGQADLIDKVTGHLKLY 176          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Zebrafish
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-050522-163])

HSP 1 Score: 144.436 bits (363), Expect = 2.813e-43
Identity = 84/175 (48.00%), Postives = 106/175 (60.57%), Query Frame = 3
Query:   60 DLFYSQLYPIVSAGLGVLLGIIVTWKFGPKPFKSTE-FSVPLPKMSYKVSEKA--------KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            D  Y      V AGLG   G+ V W    +  +S+      L   +   SE +        KM+LVVRTDL MGKGK+AAQC HA++  YK  +++ PE++K WENSGQ KVV+K   E+ L +L A A  +GL   +I DAGRTQIA GS TV+GIGPG   LID+VTG LKLY
Sbjct:    4 DSLYGPFGLGVLAGLGC--GLCVGWHLSGRFGRSSRSMMTALGNSASNGSETSVMGESGEFKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQVQRRNPELLKQWENSGQPKVVVKAPDEDCLLDLLAHAKEVGLPVSLIQDAGRTQIAPGSRTVLGIGPGQADLIDKVTGHLKLY 176          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Zebrafish
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-050522-163])

HSP 1 Score: 144.436 bits (363), Expect = 2.813e-43
Identity = 84/175 (48.00%), Postives = 106/175 (60.57%), Query Frame = 3
Query:   60 DLFYSQLYPIVSAGLGVLLGIIVTWKFGPKPFKSTE-FSVPLPKMSYKVSEKA--------KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            D  Y      V AGLG   G+ V W    +  +S+      L   +   SE +        KM+LVVRTDL MGKGK+AAQC HA++  YK  +++ PE++K WENSGQ KVV+K   E+ L +L A A  +GL   +I DAGRTQIA GS TV+GIGPG   LID+VTG LKLY
Sbjct:    4 DSLYGPFGLGVLAGLGC--GLCVGWHLSGRFGRSSRSMMTALGNSASNGSETSVMGESGEFKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQVQRRNPELLKQWENSGQPKVVVKAPDEDCLLDLLAHAKEVGLPVSLIQDAGRTQIAPGSRTVLGIGPGQADLIDKVTGHLKLY 176          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Zebrafish
Match: si:dkey-19e4.5 (si:dkey-19e4.5 [Source:ZFIN;Acc:ZDB-GENE-030131-1852])

HSP 1 Score: 95.1301 bits (235), Expect = 3.810e-24
Identity = 53/115 (46.09%), Postives = 75/115 (65.22%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTP--EMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            KMV VV  +L MG GK+AAQ  HA++G Y++ ++K    EM   W+++G  K+VL+      L ELQA+AMSL L +K++ DAG TQ+  GS TV+ I  G   +++ VTG LKL
Sbjct:   61 KMVFVVNMELSMGVGKVAAQVGHAAVGLYQALQEKNSWREMAWKWDHAGAKKIVLQGTNMAHLLELQALAMSLSLPTKLVQDAGLTQVEPGSCTVLAI-IGEEEMVNNVTGSLKL 174          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Zebrafish
Match: si:dkey-19e4.5 (si:dkey-19e4.5 [Source:ZFIN;Acc:ZDB-GENE-030131-1852])

HSP 1 Score: 94.7449 bits (234), Expect = 6.906e-24
Identity = 53/115 (46.09%), Postives = 75/115 (65.22%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTP--EMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            KMV VV  +L MG GK+AAQ  HA++G Y++ ++K    EM   W+++G  K+VL+      L ELQA+AMSL L +K++ DAG TQ+  GS TV+ I  G   +++ VTG LKL
Sbjct:   75 KMVFVVNMELSMGVGKVAAQVGHAAVGLYQALQEKNSWREMAWKWDHAGAKKIVLQGTNMAHLLELQALAMSLSLPTKLVQDAGLTQVEPGSCTVLAI-IGEEEMVNNVTGSLKL 188          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Xenopus
Match: has-rs (hyaluronan synthase related sequence protein [Source:Xenbase;Acc:XB-GENE-12450674])

HSP 1 Score: 141.739 bits (356), Expect = 4.177e-42
Identity = 81/160 (50.62%), Postives = 103/160 (64.38%), Query Frame = 3
Query:   90 VSAGL--GVLLGIIVTWKFGPKPFKSTEFSVPLPKMSYKVSE--KAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            ++AGL  G+ LG  +  +FG     ST  +  +   +  + E  + KMVLVVR DL MGKGK+ AQC HA++  YK   K+ PE++K WE  GQ KVVLK   E+S  EL + A  LGL   +I DAGRTQIA GS TV+G+GPGP  LID+VTG LKLY
Sbjct:   12 LTAGLACGLFLGWSLRGRFGYFRSFSTLATNEVGTEASTMGETGEFKMVLVVRNDLKMGKGKVTAQCSHAAVSAYKQLLKRNPELLKQWEYCGQPKVVLKAPDEDSFVELLSHAKQLGLTVSLIQDAGRTQIAPGSRTVLGVGPGPADLIDKVTGHLKLY 171          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000025893.1 (probable peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:100497652])

HSP 1 Score: 100.138 bits (248), Expect = 9.008e-26
Identity = 59/115 (51.30%), Postives = 77/115 (66.96%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKK--KTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            KMV VV  +L MG GKIAAQ  HA++G Y++  K  KT EM   W+  G  KVVL+  +   L ELQA+A+S+ L + ++ DAGRTQIAAGS TV+ I  G    +++VTGKLKL
Sbjct:   74 KMVFVVNMELPMGVGKIAAQVGHAAVGLYQNLIKEPKTREMAYKWDEYGAKKVVLQGSSTAHLLELQALALSMNLPNYLVQDAGRTQIAAGSYTVLSI-MGEEESVNKVTGKLKL 187          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Xenopus
Match: ENSXETT00000025895.1 (probable peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:100497652])

HSP 1 Score: 100.523 bits (249), Expect = 1.019e-25
Identity = 59/115 (51.30%), Postives = 77/115 (66.96%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKK--KTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            KMV VV  +L MG GKIAAQ  HA++G Y++  K  KT EM   W+  G  KVVL+  +   L ELQA+A+S+ L + ++ DAGRTQIAAGS TV+ I  G    +++VTGKLKL
Sbjct:   87 KMVFVVNMELPMGVGKIAAQVGHAAVGLYQNLIKEPKTREMAYKWDEYGAKKVVLQGSSTAHLLELQALALSMNLPNYLVQDAGRTQIAAGSYTVLSI-MGEEESVNKVTGKLKL 200          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Mouse
Match: Ptrh2 (peptidyl-tRNA hydrolase 2 [Source:MGI Symbol;Acc:MGI:2444848])

HSP 1 Score: 142.124 bits (357), Expect = 3.105e-42
Identity = 68/118 (57.63%), Postives = 89/118 (75.42%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            S + KM+LVVRTDL MGKGK+AAQC HA++  YK  ++++P+++K WE  GQ KVV+K   E++L +L   A +LGL   +I DAGRTQI  GS TV+GIGPGP+ LID+VTG LKLY
Sbjct:   64 SGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRSPQVLKEWEYCGQPKVVVKAPDEDTLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLGIGPGPVELIDEVTGHLKLY 181          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Mouse
Match: Ptrh2 (peptidyl-tRNA hydrolase 2 [Source:MGI Symbol;Acc:MGI:2444848])

HSP 1 Score: 142.124 bits (357), Expect = 3.105e-42
Identity = 68/118 (57.63%), Postives = 89/118 (75.42%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            S + KM+LVVRTDL MGKGK+AAQC HA++  YK  ++++P+++K WE  GQ KVV+K   E++L +L   A +LGL   +I DAGRTQI  GS TV+GIGPGP+ LID+VTG LKLY
Sbjct:   64 SGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRSPQVLKEWEYCGQPKVVVKAPDEDTLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLGIGPGPVELIDEVTGHLKLY 181          
BLAST of Peptidyl-tRNA hydrolase vs. UniProt/SwissProt
Match: sp|O13830|PTH2_SCHPO (Probable peptidyl-tRNA hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19A8.14 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.966e-44
Identity = 78/116 (67.24%), Postives = 98/116 (84.48%), Query Frame = 3
Query:  210 KAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            + KMVLVVRTDLGM KGKIAAQC HA+L CYK      P++++ WEN+GQAK+ L+ +TEE+L  LQA AMSLGL ++VIHDAGRTQIA+GSATV+GIGPGP+S+I++VTG LKL+
Sbjct:   90 QTKMVLVVRTDLGMTKGKIAAQCAHAALACYKIASAVDPDLVRIWENAGQAKITLQAQTEETLELLQAQAMSLGLCARVIHDAGRTQIASGSATVLGIGPGPVSVINEVTGSLKLF 205          
BLAST of Peptidyl-tRNA hydrolase vs. UniProt/SwissProt
Match: sp|Q3ZBL5|PTH2_BOVIN (Peptidyl-tRNA hydrolase 2, mitochondrial OS=Bos taurus OX=9913 GN=PTRH2 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 6.927e-44
Identity = 81/163 (49.69%), Postives = 103/163 (63.19%), Query Frame = 3
Query:   90 VSAGLGVLLGIIVTW----KFGPKPFKSTEFSVPLPKMSYKV---SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            +S   GV  G+ + W    +FG  P  S   + P  +    +   S + KM+LVVR DL MGKGK+AAQC HA++  YK  +++ PE++K WE  GQ KVV+K   EE+L EL   A  LGL   +I DAGRTQIA GS TV+GIGPGP  LID+VTG LKLY
Sbjct:   17 LSLAAGVACGVCLGWGLRMRFGMLPKSSVRETNPDTETEASILGESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPELLKEWEYCGQPKVVVKAPDEETLVELLTHAKVLGLTVSLIQDAGRTQIAPGSRTVLGIGPGPADLIDKVTGHLKLY 179          
BLAST of Peptidyl-tRNA hydrolase vs. UniProt/SwissProt
Match: sp|Q9Y3E5|PTH2_HUMAN (Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTRH2 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.425e-42
Identity = 72/118 (61.02%), Postives = 86/118 (72.88%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            S + KM+LVVR DL MGKGK+AAQC HA++  YK  +++ PEM+K WE  GQ KVV+K   EE+L  L A A  LGL   +I DAGRTQIA GS TV+GIGPGP  LID+VTG LKLY
Sbjct:   62 SGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY 179          
BLAST of Peptidyl-tRNA hydrolase vs. UniProt/SwissProt
Match: sp|Q8R2Y8|PTH2_MOUSE (Peptidyl-tRNA hydrolase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ptrh2 PE=1 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.172e-41
Identity = 68/118 (57.63%), Postives = 89/118 (75.42%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            S + KM+LVVRTDL MGKGK+AAQC HA++  YK  ++++P+++K WE  GQ KVV+K   E++L +L   A +LGL   +I DAGRTQI  GS TV+GIGPGP+ LID+VTG LKLY
Sbjct:   64 SGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRSPQVLKEWEYCGQPKVVVKAPDEDTLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLGIGPGPVELIDEVTGHLKLY 181          
BLAST of Peptidyl-tRNA hydrolase vs. UniProt/SwissProt
Match: sp|P34222|PTH2_YEAST (Peptidyl-tRNA hydrolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PTH2 PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 1.749e-40
Identity = 67/120 (55.83%), Postives = 88/120 (73.33%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYK------SGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            +M LV+R DLGM KGKIAAQCCHA+L C++      +     P M + W N+GQAK+ LK   + ++ EL A A+SLG+ + VIHDAGRTQIAAGSATV+G+GP P +++DQ+TG LKLY
Sbjct:   89 RMALVIRQDLGMTKGKIAAQCCHAALSCFRHIATNPARASYNPIMTQRWLNAGQAKITLKCPDKFTMDELYAKAISLGVNAAVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGDLKLY 208          
BLAST of Peptidyl-tRNA hydrolase vs. TrEMBL
Match: A0A1X0RBU3 (PTH2-domain-containing protein OS=Rhizopus microsporus var. microsporus OX=86635 GN=BCV72DRAFT_302871 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 8.657e-49
Identity = 83/130 (63.85%), Postives = 99/130 (76.15%), Query Frame = 3
Query:  165 EFSVPLPKMSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
              +VP  K+     +  K+ LVVRTDLGM KGKIAAQC HA+L CYK+ KK  PE+++ WE SGQAKV LK ++EE L ELQAIA+SLGL ++ I DAGRTQIAAGS TV+G+GPGP  LIDQVTG LKL
Sbjct:   53 RIAVPEGKIDPSKFDNFKLTLVVRTDLGMTKGKIAAQCGHATLACYKAAKKVNPEILRAWEYSGQAKVALKCDSEEKLLELQAIALSLGLPAQSIRDAGRTQIAAGSRTVLGVGPGPAELIDQVTGHLKL 182          
BLAST of Peptidyl-tRNA hydrolase vs. TrEMBL
Match: A0A1X0RXW7 (PTH2-domain-containing protein OS=Rhizopus microsporus OX=58291 GN=BCV71DRAFT_12586 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 8.815e-49
Identity = 83/130 (63.85%), Postives = 99/130 (76.15%), Query Frame = 3
Query:  165 EFSVPLPKMSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
              +VP  K+     +  K+ LVVRTDLGM KGKIAAQC HA+L CYK+ KK  PE+++ WE SGQAKV LK ++EE L ELQAIA+SLGL ++ I DAGRTQIAAGS TV+G+GPGP  LIDQVTG LKL
Sbjct:   55 RIAVPEGKIDPSKFDNFKLTLVVRTDLGMTKGKIAAQCGHATLACYKAAKKVNPEILRAWEYSGQAKVALKCDSEEKLLELQAIALSLGLPAQSIRDAGRTQIAAGSRTVLGVGPGPAELIDQVTGHLKL 184          
BLAST of Peptidyl-tRNA hydrolase vs. TrEMBL
Match: A0A0C7B9T9 (Putative PTH2 family peptidyl-tRNA hydrolase OS=Rhizopus microsporus OX=58291 GN=RMATCC62417_04382 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 9.240e-49
Identity = 83/130 (63.85%), Postives = 99/130 (76.15%), Query Frame = 3
Query:  165 EFSVPLPKMSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
              +VP  K+     +  K+ LVVRTDLGM KGKIAAQC HA+L CYK+ KK  PE+++ WE SGQAKV LK ++EE L ELQAIA+SLGL ++ I DAGRTQIAAGS TV+G+GPGP  LIDQVTG LKL
Sbjct:   53 RIAVPEGKIDPSKFDNFKLTLVVRTDLGMTKGKIAAQCGHATLACYKAAKKVNPEILRAWEYSGQAKVALKCDSEEKLLELQAIALSLGLPAQSIRDAGRTQIAAGSRTVLGVGPGPAELIDQVTGHLKL 182          
BLAST of Peptidyl-tRNA hydrolase vs. TrEMBL
Match: A0A0C7C156 (Putative PTH2 family peptidyl-tRNA hydrolase OS=Rhizopus microsporus OX=58291 GN=RMATCC62417_11905 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.349e-48
Identity = 82/130 (63.08%), Postives = 99/130 (76.15%), Query Frame = 3
Query:  165 EFSVPLPKMSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
              +VP  K+     +  K+ LVVRTDLGM KGKIAAQC HA+L CYK+ KK  PE+++ WE SGQAKV LK ++E+ L ELQAIA+SLGL ++ I DAGRTQIAAGS TV+G+GPGP  LIDQVTG LKL
Sbjct:   54 RIAVPEGKIDPSKFDNFKLTLVVRTDLGMTKGKIAAQCGHATLACYKAAKKVNPEILRAWEYSGQAKVALKCDSEDKLLELQAIALSLGLPAQSIRDAGRTQIAAGSRTVLGVGPGPAELIDQVTGHLKL 183          
BLAST of Peptidyl-tRNA hydrolase vs. TrEMBL
Match: A0A1C7N5G5 (Peptidyl-tRNA hydrolase 2, mitochondrial OS=Choanephora cucurbitarum OX=101091 GN=PTRH2 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 6.205e-48
Identity = 76/128 (59.38%), Postives = 99/128 (77.34%), Query Frame = 3
Query:  171 SVPLPKMSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            ++P  ++  +  +  KM L+VR+DLGM KGKIAAQC HA+L CYK+ KK  P++++ WE SGQAKV LK + E+ LYE QA+A+SLGL ++VI DAGRTQ A G+ TV+G+GPGP  LIDQVTGKLKL
Sbjct:   54 ALPDTQIDVEKYDNFKMTLIVRSDLGMTKGKIAAQCGHATLACYKAAKKSNPKLLRAWEYSGQAKVALKCDNEDKLYEFQAVALSLGLPAQVIQDAGRTQTAPGTRTVLGVGPGPAELIDQVTGKLKL 181          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Cavefish
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:103038752])

HSP 1 Score: 137.502 bits (345), Expect = 1.156e-40
Identity = 66/114 (57.89%), Postives = 84/114 (73.68%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            KM+LVVRTDL MGKGK+AAQC HA++  YK  +++ P+++K WE  GQ KVV+K   EE L EL   A  +GL   +I DAGRTQIA GS TV+G+GPGP  L+D+VTG LKL+
Sbjct:   56 KMILVVRTDLKMGKGKVAAQCSHAAVSAYKQVQRRNPDLLKQWEYCGQPKVVVKAPDEECLLELLTHAKEVGLPVSLIQDAGRTQIAPGSRTVLGVGPGPADLVDKVTGHLKLF 169          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Cavefish
Match: si:dkey-19e4.5 (probable peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:103025619])

HSP 1 Score: 97.4413 bits (241), Expect = 6.145e-25
Identity = 54/115 (46.96%), Postives = 76/115 (66.09%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTP--EMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            KMV VV  +L MG GK+AAQ  HA++G Y++ ++K    EM   W+++G  K+VL+      L ELQA+AMSL L +K+I DAG TQ+  GS+TV+ I  G   +++ VTG LKL
Sbjct:   70 KMVFVVNMELSMGVGKVAAQVGHAAVGLYQAMQEKNTWREMAWKWDHAGAKKIVLQGTNMAHLLELQALAMSLSLPTKLIQDAGLTQVEPGSSTVLAI-MGEEEMVNNVTGSLKL 183          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Sea Lamprey
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-050522-163])

HSP 1 Score: 125.946 bits (315), Expect = 8.624e-37
Identity = 59/114 (51.75%), Postives = 81/114 (71.05%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            K+VLVVR+DL MGKGK+AAQC HA++  ++    +  + +++WE  GQAKVV +   E  L EL A A +LGL   ++ DAGRTQ+A G+ TV+G+GPGP   +D+VTG LKLY
Sbjct:   68 KLVLVVRSDLKMGKGKVAAQCAHAAVSAFRQAGARHADALRHWELGGQAKVVTRVPDEAGLAELLAHARALGLPVSLVRDAGRTQVAPGTCTVLGVGPGPAGAVDRVTGHLKLY 181          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Sea Lamprey
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-050522-163])

HSP 1 Score: 110.538 bits (275), Expect = 5.826e-31
Identity = 62/118 (52.54%), Postives = 83/118 (70.34%), Query Frame = 3
Query:  204 SEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            + + KMVLVVR DL MGKGK AAQC HA++  Y+    + P  ++ W   GQAK+V + E E +L ELQ  A +LGL + V+ DAGRTQ+AAGS TV+ +GPGP+ ++ +VTG LKLY
Sbjct:   53 AREHKMVLVVRADLKMGKGKAAAQCAHAAVAAYRLAAARQPGALRRWRRGGQAKIVTRVEDEAALLELQERARALGLGAPVVCDAGRTQVAAGSCTVLAVGPGPVRMVGEVTGHLKLY 170          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Yeast
Match: PTH2 (One of two mitochondrially-localized peptidyl-tRNA hydrolases; negatively regulates the ubiquitin-proteasome pathway via interactions with ubiquitin-like ubiquitin-associated proteins; dispensable for cell growth; see also PTH1 [Source:SGD;Acc:S000000153])

HSP 1 Score: 140.584 bits (353), Expect = 2.519e-42
Identity = 67/120 (55.83%), Postives = 88/120 (73.33%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYK------SGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            +M LV+R DLGM KGKIAAQCCHA+L C++      +     P M + W N+GQAK+ LK   + ++ EL A A+SLG+ + VIHDAGRTQIAAGSATV+G+GP P +++DQ+TG LKLY
Sbjct:   89 RMALVIRQDLGMTKGKIAAQCCHAALSCFRHIATNPARASYNPIMTQRWLNAGQAKITLKCPDKFTMDELYAKAISLGVNAAVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGDLKLY 208          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Nematostella
Match: EDO41127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S519])

HSP 1 Score: 143.28 bits (360), Expect = 5.777e-44
Identity = 68/114 (59.65%), Postives = 87/114 (76.32%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            KM+LVVR DLGMGKGK+AAQCCHA++G  +   K  P++++ WEN+ Q KVV+K   E++L  L   A SLGL + +I DAGRTQIA GS TV+G+GPGP+ L+DQVTG LKLY
Sbjct:    8 KMILVVRQDLGMGKGKVAAQCCHAAVGLCRQLLKNNPKVLRMWENAAQPKVVVKAPDEDALVSLSKKARSLGLETCLIRDAGRTQIAPGSKTVLGVGPGPLELVDQVTGHLKLY 121          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Nematostella
Match: EDO33770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR90])

HSP 1 Score: 93.5893 bits (231), Expect = 1.064e-23
Identity = 52/121 (42.98%), Postives = 76/121 (62.81%), Query Frame = 3
Query:  201 VSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKS---GKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
             S+  KM  VV ++L MG GK+AAQ  HA++G Y++    +     M+ +WE+SG  KVVLK E    L +++  A  L L   ++ DAGRTQIA+GS TV+GI  G    ++++TGKL+L
Sbjct:   95 FSDPYKMAFVVNSELNMGVGKVAAQVGHAAVGLYRALLQDQDDLGHMLMSWEDSGGMKVVLKGENTAHLLDMETQAKRLQLPFYLVQDAGRTQIASGSVTVLGI-FGATEEVNKITGKLRL 214          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Medaka
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:101173730])

HSP 1 Score: 141.354 bits (355), Expect = 3.454e-42
Identity = 67/114 (58.77%), Postives = 84/114 (73.68%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            KMVLVVR DL MGKGK+AAQC HA++  YK  +++ PE++K WE  GQ KVV+K   EE+L EL + A + GL   +I DAGRTQIA GS TV+G+GPGP  L+D +TG LKLY
Sbjct:   58 KMVLVVRNDLKMGKGKVAAQCSHAAVSAYKQVQRRDPELLKQWEYCGQPKVVVKAPDEETLVELLSRARAAGLTVSLIQDAGRTQIAPGSRTVLGVGPGPAHLVDSITGDLKLY 171          
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Medaka
Match: si:dkey-19e4.5 (probable peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:101156005])

HSP 1 Score: 103.99 bits (258), Expect = 1.487e-27
Identity = 57/115 (49.57%), Postives = 78/115 (67.83%), Query Frame = 3
Query:  216 KMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTP--EMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKL 554
            KMV VV  DLGMG GK+AAQ  HA++G Y++ ++K    EM   W++SG  KVVL+      L ELQA+A SLGL + ++ DAG TQ+A+GS TV+GI  G   +++ VTG L+L
Sbjct:   70 KMVFVVNMDLGMGIGKVAAQVGHAAVGLYQTLQEKNSWREMAWKWDHSGAKKVVLQGTNAAHLLELQALASSLGLPTHLVQDAGHTQVASGSRTVLGI-MGEEQMVNNVTGSLQL 183          
BLAST of Peptidyl-tRNA hydrolase vs. Planmine SMEST
Match: SMESG000050574.1 (SMESG000050574.1)

HSP 1 Score: 343.584 bits (880), Expect = 5.553e-122
Identity = 169/173 (97.69%), Postives = 172/173 (99.42%), Query Frame = 3
Query:   39 MITSLLTDLFYSQLYPIVSAGLGVLLGIIVTWKFGPKPFKSTEFSVPLPKMSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            MITSLLTDLFYSQLYPIVSAGLG+LLGIIVTWKFGPKPFKSTEFSVPLPKMSYK SE+AKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQA+AMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY
Sbjct:    1 MITSLLTDLFYSQLYPIVSAGLGILLGIIVTWKFGPKPFKSTEFSVPLPKMSYKGSEEAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAVAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 173          
BLAST of Peptidyl-tRNA hydrolase vs. Planmine SMEST
Match: SMESG000050572.1 (SMESG000050572.1)

HSP 1 Score: 139.813 bits (351), Expect = 4.998e-42
Identity = 64/124 (51.61%), Postives = 96/124 (77.42%), Query Frame = 3
Query:  186 KMSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            K+S+    + K+ ++VR+DLGM KGKI AQC HA++GCYK G  +TP++IK+WEN GQ KVVLK ++E+SL+EL+  A S G+V+ +I D+GR+Q+  G+ TV+GIGP   + +++VTG+LKL+
Sbjct:   27 KLSFINFPQIKLAIIVRSDLGMSKGKIGAQCAHAAVGCYKRGLIETPKLIKSWENCGQPKVVLKVDSEQSLFELKREADSFGIVTSLICDSGRSQVTPGTYTVLGIGPDLETRVNKVTGELKLF 150          
BLAST of Peptidyl-tRNA hydrolase vs. Planmine SMEST
Match: SMESG000050572.1 (SMESG000050572.1)

HSP 1 Score: 122.094 bits (305), Expect = 1.183e-35
Identity = 56/103 (54.37%), Postives = 81/103 (78.64%), Query Frame = 3
Query:  249 MGKGKIAAQCCHASLGCYKSGKKKTPEMIKNWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSATVVGIGPGPISLIDQVTGKLKLY 557
            M KGKI AQC HA++GCYK G  +TP++IK+WEN GQ KVVLK ++E+SL+EL+  A S G+V+ +I D+GR+Q+  G+ TV+GIGP   + +++VTG+LKL+
Sbjct:    1 MSKGKIGAQCAHAAVGCYKRGLIETPKLIKSWENCGQPKVVLKVDSEQSLFELKREADSFGIVTSLICDSGRSQVTPGTYTVLGIGPDLETRVNKVTGELKLF 103          
The following BLAST results are available for this feature:
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PTRH21.754e-4261.02peptidyl-tRNA hydrolase 2 [Source:HGNC Symbol;Acc:... [more]
PTRH21.754e-4261.02peptidyl-tRNA hydrolase 2 [Source:HGNC Symbol;Acc:... [more]
PTRH21.867e-4261.02peptidyl-tRNA hydrolase 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cox-164.204e-2045.22Probable peptidyl-tRNA hydrolase 2 [Source:UniPro... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG13079.946e-3348.31gene:FBgn0026566 transcript:FBtr0346140[more]
CG13079.946e-3348.31gene:FBgn0026566 transcript:FBtr0301623[more]
CG173277.548e-2944.83gene:FBgn0038107 transcript:FBtr0082721[more]
CG173277.548e-2944.83gene:FBgn0038107 transcript:FBtr0336813[more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptrh22.813e-4348.00peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ptrh22.813e-4348.00peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ptrh22.813e-4348.00peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
si:dkey-19e4.53.810e-2446.09si:dkey-19e4.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18... [more]
si:dkey-19e4.56.906e-2446.09si:dkey-19e4.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
has-rs4.177e-4250.63hyaluronan synthase related sequence protein [Sour... [more]
ENSXETT00000025893.19.008e-2651.30probable peptidyl-tRNA hydrolase 2 [Source:NCBI ge... [more]
ENSXETT00000025895.11.019e-2551.30probable peptidyl-tRNA hydrolase 2 [Source:NCBI ge... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ptrh23.105e-4257.63peptidyl-tRNA hydrolase 2 [Source:MGI Symbol;Acc:M... [more]
Ptrh23.105e-4257.63peptidyl-tRNA hydrolase 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O13830|PTH2_SCHPO1.966e-4467.24Probable peptidyl-tRNA hydrolase 2 OS=Schizosaccha... [more]
sp|Q3ZBL5|PTH2_BOVIN6.927e-4449.69Peptidyl-tRNA hydrolase 2, mitochondrial OS=Bos ta... [more]
sp|Q9Y3E5|PTH2_HUMAN8.425e-4261.02Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo s... [more]
sp|Q8R2Y8|PTH2_MOUSE2.172e-4157.63Peptidyl-tRNA hydrolase 2, mitochondrial OS=Mus mu... [more]
sp|P34222|PTH2_YEAST1.749e-4055.83Peptidyl-tRNA hydrolase 2 OS=Saccharomyces cerevis... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X0RBU38.657e-4963.85PTH2-domain-containing protein OS=Rhizopus microsp... [more]
A0A1X0RXW78.815e-4963.85PTH2-domain-containing protein OS=Rhizopus microsp... [more]
A0A0C7B9T99.240e-4963.85Putative PTH2 family peptidyl-tRNA hydrolase OS=Rh... [more]
A0A0C7C1562.349e-4863.08Putative PTH2 family peptidyl-tRNA hydrolase OS=Rh... [more]
A0A1C7N5G56.205e-4859.38Peptidyl-tRNA hydrolase 2, mitochondrial OS=Choane... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptrh21.156e-4057.89peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:10... [more]
si:dkey-19e4.56.145e-2546.96probable peptidyl-tRNA hydrolase 2 [Source:NCBI ge... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptrh28.624e-3751.75peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ptrh25.826e-3152.54peptidyl-tRNA hydrolase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PTH22.519e-4255.83One of two mitochondrially-localized peptidyl-tRNA... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO411275.777e-4459.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337701.064e-2342.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptrh23.454e-4258.77peptidyl-tRNA hydrolase 2 [Source:NCBI gene;Acc:10... [more]
si:dkey-19e4.51.487e-2749.57probable peptidyl-tRNA hydrolase 2 [Source:NCBI ge... [more]
back to top
BLAST of Peptidyl-tRNA hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000050574.15.553e-12297.69SMESG000050574.1[more]
SMESG000050572.14.998e-4251.61SMESG000050572.1[more]
SMESG000050572.11.183e-3554.37SMESG000050572.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009319 ID=SMED30009319|Name=Peptidyl-tRNA hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=666bp
CCGTGTTTTAATATTCACAAACTAACATTGTTTTCAAAATGATAACATCA
TTACTAACTGATCTTTTTTATTCTCAATTATATCCCATTGTTTCTGCTGG
ACTTGGAGTTCTTTTGGGTATTATTGTTACGTGGAAATTTGGACCTAAGC
CATTTAAAAGTACAGAATTCTCAGTTCCGTTACCAAAAATGTCTTATAAA
GTATCAGAGAAAGCAAAAATGGTTTTAGTTGTTAGAACGGATTTGGGTAT
GGGTAAAGGTAAAATTGCTGCTCAATGTTGCCATGCTTCACTCGGTTGCT
ACAAAAGTGGTAAGAAAAAAACTCCTGAAATGATTAAAAATTGGGAAAAT
AGTGGTCAAGCCAAAGTTGTTTTAAAAACTGAAACAGAAGAATCATTGTA
TGAATTGCAGGCTATTGCTATGTCGTTAGGTTTGGTAAGTAAGGTTATTC
ATGATGCTGGACGAACACAGATCGCGGCAGGTTCCGCCACAGTTGTTGGA
ATTGGTCCAGGTCCAATTTCTCTCATCGATCAAGTTACAGGAAAATTAAA
ATTATATTAAATAAATATTTTCATTTTTTTAAGTGTGCTAATTTATTTTG
TTCATTTAAATCGCTTACGTATTATACATTCACTGAAGATGCTTGGAATT
TAAGTCACTGTTCCAC
back to top

protein sequence of SMED30009319-orf-1

>SMED30009319-orf-1 ID=SMED30009319-orf-1|Name=SMED30009319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=174bp
MITSLLTDLFYSQLYPIVSAGLGVLLGIIVTWKFGPKPFKSTEFSVPLPK
MSYKVSEKAKMVLVVRTDLGMGKGKIAAQCCHASLGCYKSGKKKTPEMIK
NWENSGQAKVVLKTETEESLYELQAIAMSLGLVSKVIHDAGRTQIAAGSA
TVVGIGPGPISLIDQVTGKLKLY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002833PTH2
IPR023476Pep_tRNA_hydro_II_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004045aminoacyl-tRNA hydrolase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002833Peptidyl-tRNA hydrolase, PTH2PFAMPF01981PTH2coord: 60..173
e-value: 1.8E-47
score: 160.4
IPR002833Peptidyl-tRNA hydrolase, PTH2TIGRFAMTIGR00283TIGR00283coord: 60..173
e-value: 2.8E-46
score: 154.5
IPR002833Peptidyl-tRNA hydrolase, PTH2PANTHERPTHR12649PEPTIDYL-TRNA HYDROLASE 2coord: 54..173
IPR002833Peptidyl-tRNA hydrolase, PTH2CDDcd02430PTH2coord: 60..173
e-value: 1.50818E-66
score: 196.976
IPR023476Peptidyl-tRNA hydrolase II domain superfamilyGENE3DG3DSA:3.40.1490.10coord: 57..173
e-value: 6.9E-51
score: 173.0
IPR023476Peptidyl-tRNA hydrolase II domain superfamilySUPERFAMILYSSF102462Peptidyl-tRNA hydrolase IIcoord: 58..173
NoneNo IPR availablePANTHERPTHR12649:SF11PEPTIDYL-TRNA HYDROLASE 2, MITOCHONDRIALcoord: 54..173
NoneNo IPR availableTMHMMTMhelixcoord: 10..32