Aamy domain-containing protein

Overview
NameAamy domain-containing protein
Smed IDSMED30009301
Length (bp)1825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aamy domain-containing protein (SMED30009301) t-SNE clustered cells

Violin plots show distribution of expression levels for Aamy domain-containing protein (SMED30009301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aamy domain-containing protein (SMED30009301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aamy domain-containing protein (SMED30009301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009301SMESG000055799.1 SmedASXL_003055SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30009301SMESG000055799.1 dd_Smed_v4_7278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009301SMESG000055799.1 dd_Smed_v4_7278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30009301SMESG000055799.1 dd_Smed_v6_7278_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30009301SMESG000055799.1 SMESG000038209.1 OX_Smed_1.0.06917ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aamy domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 78.5666 bits (192), Expect = 2.307e-15
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            R+F+  +V  I+  G  L+ EE   KF +Y  S++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   96 RDFMRGYVEKIFSGGEDLDQEEK-AKFGEYCSSENGKGREWFARYVSA-QRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHIGKPQL 196          
BLAST of Aamy domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 78.1814 bits (191), Expect = 9.891e-15
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            R+F+  +V  I+  G  L+ EE   KF +Y  S++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   96 RDFMRGYVEKIFSGGEDLDQEEK-AKFGEYCSSENGKGREWFARYVSA-QRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHIGKPQL 196          

HSP 2 Score: 63.1586 bits (152), Expect = 6.169e-10
Identity = 34/121 (28.10%), Postives = 56/121 (46.28%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDA--------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R+KR+   R  A   +                     + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:  286 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIE 406          
BLAST of Aamy domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 78.1814 bits (191), Expect = 9.891e-15
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            R+F+  +V  I+  G  L+ EE   KF +Y  S++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   96 RDFMRGYVEKIFSGGEDLDQEEK-AKFGEYCSSENGKGREWFARYVSA-QRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHIGKPQL 196          

HSP 2 Score: 63.1586 bits (152), Expect = 6.169e-10
Identity = 34/121 (28.10%), Postives = 56/121 (46.28%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDA--------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R+KR+   R  A   +                     + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:  286 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIE 406          
BLAST of Aamy domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 78.1814 bits (191), Expect = 1.007e-14
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            R+F+  +V  I+  G  L+ EE   KF +Y  S++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   96 RDFMRGYVEKIFSGGEDLDQEEK-AKFGEYCSSENGKGREWFARYVSA-QRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHIGKPQL 196          

HSP 2 Score: 63.929 bits (154), Expect = 3.527e-10
Identity = 35/111 (31.53%), Postives = 57/111 (51.35%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA---------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R+KR+ T R    + T           + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:  286 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIE 396          
BLAST of Aamy domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 62.3882 bits (150), Expect = 1.740e-10
Identity = 35/107 (32.71%), Postives = 57/107 (53.27%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA---------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R+KR+ T R    + T           + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:   87 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIE 193          
BLAST of Aamy domain-containing protein vs. Ensembl Fly
Match: CG17378 (gene:FBgn0031858 transcript:FBtr0079336)

HSP 1 Score: 70.8626 bits (172), Expect = 1.716e-12
Identity = 42/142 (29.58%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA 1401
            +EF++ F A ++       D E  ++F   ++ + G+ W  + + + Q   SK++  V F  L Q F   L EC E E++ PA  LM + F  Y  V        +  YL S +   PIW+  +FWN  F + +Q  R  R 
Sbjct:  318 KEFMKHFTALLFGGSPGAVDLELKSEFGVLLRLEIGRLWFTRFLTE-QRHKSKRLDSVTFGSLAQYFALALFECSECEDYGPAAVLMNLCFLFYHEVEVPGCD-PYREYLFSSLRQQPIWQQARFWNAIFHDGMQAEREHRG 457          
BLAST of Aamy domain-containing protein vs. Ensembl Fly
Match: CG17378 (gene:FBgn0031858 transcript:FBtr0332335)

HSP 1 Score: 70.0922 bits (170), Expect = 2.682e-12
Identity = 42/142 (29.58%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA 1401
            +EF++ F A ++       D E  ++F   ++ + G+ W  + + + Q   SK++  V F  L Q F   L EC E E++ PA  LM + F  Y  V        +  YL S +   PIW+  +FWN  F + +Q  R  R 
Sbjct:  269 KEFMKHFTALLFGGSPGAVDLELKSEFGVLLRLEIGRLWFTRFLTE-QRHKSKRLDSVTFGSLAQYFALALFECSECEDYGPAAVLMNLCFLFYHEVEVPGCD-PYREYLFSSLRQQPIWQQARFWNAIFHDGMQAEREHRG 408          
BLAST of Aamy domain-containing protein vs. Ensembl Fly
Match: CG17378 (gene:FBgn0031858 transcript:FBtr0079337)

HSP 1 Score: 70.0922 bits (170), Expect = 2.682e-12
Identity = 42/142 (29.58%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA 1401
            +EF++ F A ++       D E  ++F   ++ + G+ W  + + + Q   SK++  V F  L Q F   L EC E E++ PA  LM + F  Y  V        +  YL S +   PIW+  +FWN  F + +Q  R  R 
Sbjct:  269 KEFMKHFTALLFGGSPGAVDLELKSEFGVLLRLEIGRLWFTRFLTE-QRHKSKRLDSVTFGSLAQYFALALFECSECEDYGPAAVLMNLCFLFYHEVEVPGCD-PYREYLFSSLRQQPIWQQARFWNAIFHDGMQAEREHRG 408          
BLAST of Aamy domain-containing protein vs. Ensembl Zebrafish
Match: zgc:91860 (zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34])

HSP 1 Score: 69.3218 bits (168), Expect = 4.666e-12
Identity = 38/107 (35.51%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIA 1290
            R F++ +VA ++  G   + EE   +F +     +GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA+ LM +   C+T  + G +Q++
Sbjct:  110 RAFMKTYVAKLFHGGEDFDHEEK-ARFGELCTGDNGKGREWFSKYVSA-QRCHSKCVSEQTFYRLVQSFAVVLFECHQVDDYCPAKHLMTM---CFTYYYMGKSQLS 211          

HSP 2 Score: 64.3142 bits (155), Expect = 1.699e-10
Identity = 35/107 (32.71%), Postives = 57/107 (53.27%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA---------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R+KR+ T R    + T           + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:  303 YLYTHLKQQPIWHTLRFWNAAFFDAVHSERNKRSPTTREKWCHMTQEEKDDSSRFNENITFGQLGTFTHNMVAFGLSKKLCNDFLKKQAVIGNLNEEQYKLLCDHIE 409          
BLAST of Aamy domain-containing protein vs. Ensembl Zebrafish
Match: zgc:91860 (zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34])

HSP 1 Score: 69.3218 bits (168), Expect = 4.697e-12
Identity = 38/107 (35.51%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIA 1290
            R F++ +VA ++  G   + EE   +F +     +GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA+ LM +   C+T  + G +Q++
Sbjct:  110 RAFMKTYVAKLFHGGEDFDHEEK-ARFGELCTGDNGKGREWFSKYVSA-QRCHSKCVSEQTFYRLVQSFAVVLFECHQVDDYCPAKHLMTM---CFTYYYMGKSQLS 211          

HSP 2 Score: 63.929 bits (154), Expect = 2.375e-10
Identity = 36/117 (30.77%), Postives = 58/117 (49.57%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA-------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R+KR+ T RR +    D                    + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:  303 YLYTHLKQQPIWHTLRFWNAAFFDAVHSERNKRSPTTRRTAEEEKDEREKWCHMTQEEKDDSSRFNENITFGQLGTFTHNMVAFGLSKKLCNDFLKKQAVIGNLNEEQYKLLCDHIE 419          
BLAST of Aamy domain-containing protein vs. Ensembl Zebrafish
Match: zgc:91860 (zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34])

HSP 1 Score: 69.3218 bits (168), Expect = 4.697e-12
Identity = 38/107 (35.51%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIA 1290
            R F++ +VA ++  G   + EE   +F +     +GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA+ LM +   C+T  + G +Q++
Sbjct:  110 RAFMKTYVAKLFHGGEDFDHEEK-ARFGELCTGDNGKGREWFSKYVSA-QRCHSKCVSEQTFYRLVQSFAVVLFECHQVDDYCPAKHLMTM---CFTYYYMGKSQLS 211          

HSP 2 Score: 63.929 bits (154), Expect = 2.375e-10
Identity = 36/117 (30.77%), Postives = 58/117 (49.57%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA-------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R+KR+ T RR +    D                    + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:  303 YLYTHLKQQPIWHTLRFWNAAFFDAVHSERNKRSPTTRRTAEEEKDEREKWCHMTQEEKDDSSRFNENITFGQLGTFTHNMVAFGLSKKLCNDFLKKQAVIGNLNEEQYKLLCDHIE 419          
BLAST of Aamy domain-containing protein vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:NCBI gene;Acc:100125070])

HSP 1 Score: 71.633 bits (174), Expect = 9.683e-13
Identity = 41/112 (36.61%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHA 1272
            +S  +EL S  REF+  +V  I+  G  ++ EE   +F +   +++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA+ LM + F+ Y    A
Sbjct:   92 ESARDELMSEQREFVRKYVEKIFEGGEDMDQEEK-ARFGELCSTENGKGREWFARFVSA-QRCNSKCVSEQTFYRLVQSFAVVLFECHQMDDFGPAKSLMTMCFTYYYTGRA 201          

HSP 2 Score: 61.6178 bits (148), Expect = 1.703e-9
Identity = 34/107 (31.78%), Postives = 57/107 (53.27%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA---------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R KR+ T R   ++ T           + + F QL    + M + G+  +LC +F++KQ  I NL E++  +L + I+
Sbjct:  298 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRDKWSHMTQEERDDSLQFNENITFGQLGTFTHNMLAFGLSKKLCYDFLKKQAVIGNLDEEKFKQLTDHID 404          
BLAST of Aamy domain-containing protein vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:NCBI gene;Acc:100125070])

HSP 1 Score: 71.633 bits (174), Expect = 9.721e-13
Identity = 41/112 (36.61%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHA 1272
            +S  +EL S  REF+  +V  I+  G  ++ EE   +F +   +++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA+ LM + F+ Y    A
Sbjct:   92 ESARDELMSEQREFVRKYVEKIFEGGEDMDQEEK-ARFGELCSTENGKGREWFARFVSA-QRCNSKCVSEQTFYRLVQSFAVVLFECHQMDDFGPAKSLMTMCFTYYYTGRA 201          

HSP 2 Score: 60.077 bits (144), Expect = 5.629e-9
Identity = 34/121 (28.10%), Postives = 57/121 (47.11%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA-------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R KR+ T R N+    +                    + + F QL    + M + G+  +LC +F++KQ  I NL E++  +L + I+
Sbjct:  283 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRENAGEEKEERDKWSHMTQEERDDSLQFNENITFGQLGTFTHNMLAFGLSKKLCYDFLKKQAVIGNLDEEKFKQLTDHID 403          
BLAST of Aamy domain-containing protein vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:NCBI gene;Acc:100125070])

HSP 1 Score: 72.0182 bits (175), Expect = 9.891e-13
Identity = 41/112 (36.61%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHA 1272
            +S  +EL S  REF+  +V  I+  G  ++ EE   +F +   +++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA+ LM + F+ Y    A
Sbjct:   92 ESARDELMSEQREFVRKYVEKIFEGGEDMDQEEK-ARFGELCSTENGKGREWFARFVSA-QRCNSKCVSEQTFYRLVQSFAVVLFECHQMDDFGPAKSLMTMCFTYYYTGRA 201          

HSP 2 Score: 60.077 bits (144), Expect = 5.102e-9
Identity = 34/118 (28.81%), Postives = 57/118 (48.31%), Query Frame = 1
Query: 1297 FYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA-------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
             YL + +   PIW +++FWN  FF+AV   R KR+ T R N+    +                    + + F QL    + M + G+  +LC +F++KQ  I NL E++  +L + I+
Sbjct:  297 IYLYTHLKQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRENAGEEKEERDKWSHMTQEERDDSLQFNENITFGQLGTFTHNMLAFGLSKKLCYDFLKKQAVIGNLDEEKFKQLTDHID 414          
BLAST of Aamy domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 82.8037 bits (203), Expect = 2.196e-17
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            DS P+E     REF+ ++V  I+  G  L+ EE   KF +Y   + GK   W  + V   Q   SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   85 DSAPDEETLALREFMRSYVEKIFSGGEDLDQEEK-AKFGEYCSGEDGKGREWFARFVSA-QRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHLGKPQL 196          
BLAST of Aamy domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 82.0333 bits (201), Expect = 1.012e-16
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            DS P+E     REF+ ++V  I+  G  L+ EE   KF +Y   + GK   W  + V   Q   SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   85 DSAPDEETLALREFMRSYVEKIFSGGEDLDQEEK-AKFGEYCSGEDGKGREWFARFVSA-QRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHLGKPQL 196          
BLAST of Aamy domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 81.2629 bits (199), Expect = 5.298e-16
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            DS P+E     REF+ ++V  I+  G  L+ EE   KF +Y   + GK   W  + V   Q   SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   85 DSAPDEETLALREFMRSYVEKIFSGGEDLDQEEK-AKFGEYCSGEDGKGREWFARFVSA-QRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHLGKPQL 196          

HSP 2 Score: 67.0106 bits (162), Expect = 2.170e-11
Identity = 38/121 (31.40%), Postives = 60/121 (49.59%), Query Frame = 1
Query: 1258 TVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA---------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            T++     Q     YL + +   PIW +++FWN  FF+AV   R KR+ T R    + T           + + F QL    + M + G+  +LCS+F++KQ  I NL E++   L + IE
Sbjct:  272 TMISPEDEQKGEKVYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKRSPTTREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIE 392          
BLAST of Aamy domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 81.6481 bits (200), Expect = 5.537e-16
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            DS P+E     REF+ ++V  I+  G  L+ EE   KF +Y   + GK   W  + V   Q   SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   85 DSAPDEETLALREFMRSYVEKIFSGGEDLDQEEK-AKFGEYCSGEDGKGREWFARFV-SAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHLGKPQL 196          

HSP 2 Score: 66.2402 bits (160), Expect = 4.182e-11
Identity = 37/131 (28.24%), Postives = 59/131 (45.04%), Query Frame = 1
Query: 1258 TVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDA--------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            T++     Q     YL + +   PIW +++FWN  FF+AV   R KR+   R  A   +                     + + F QL    + M + G+  +LCS+F++KQ  I NL E++   L + IE
Sbjct:  272 TMISPEDEQKGEKVYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRGDAGEQEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIE 402          
BLAST of Aamy domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 81.6481 bits (200), Expect = 5.537e-16
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            DS P+E     REF+ ++V  I+  G  L+ EE   KF +Y   + GK   W  + V   Q   SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   85 DSAPDEETLALREFMRSYVEKIFSGGEDLDQEEK-AKFGEYCSGEDGKGREWFARFV-SAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHLGKPQL 196          

HSP 2 Score: 66.2402 bits (160), Expect = 4.182e-11
Identity = 37/131 (28.24%), Postives = 59/131 (45.04%), Query Frame = 1
Query: 1258 TVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDA--------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            T++     Q     YL + +   PIW +++FWN  FF+AV   R KR+   R  A   +                     + + F QL    + M + G+  +LCS+F++KQ  I NL E++   L + IE
Sbjct:  272 TMISPEDEQKGEKVYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRGDAGEQEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIE 402          
BLAST of Aamy domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R0A7|K0513_MOUSE (Uncharacterized protein KIAA0513 OS=Mus musculus OX=10090 GN=Kiaa0513 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.873e-15
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  943 DSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            DS P+E     REF+ ++V  I+  G  L+ EE   KF +Y   + GK   W  + V   Q   SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   85 DSAPDEETLALREFMRSYVEKIFSGGEDLDQEEK-AKFGEYCSGEDGKGREWFARFV-SAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHLGKPQL 196          

HSP 2 Score: 66.2402 bits (160), Expect = 2.925e-10
Identity = 37/131 (28.24%), Postives = 59/131 (45.04%), Query Frame = 1
Query: 1258 TVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDA--------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            T++     Q     YL + +   PIW +++FWN  FF+AV   R KR+   R  A   +                     + + F QL    + M + G+  +LCS+F++KQ  I NL E++   L + IE
Sbjct:  272 TMISPEDEQKGEKVYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRGDAGEQEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIE 402          
BLAST of Aamy domain-containing protein vs. UniProt/SwissProt
Match: sp|O60268|K0513_HUMAN (Uncharacterized protein KIAA0513 OS=Homo sapiens OX=9606 GN=KIAA0513 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.750e-14
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQI 1287
            R+F+  +V  I+  G  L+ EE   KF +Y  S++GK   W  + V   Q  +SK VSE  FYRL+Q F  VL EC++ ++F PA++LM +   C+T  H G  Q+
Sbjct:   96 RDFMRGYVEKIFSGGEDLDQEEK-AKFGEYCSSENGKGREWFARYVSA-QRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTM---CFTYYHIGKPQL 196          

HSP 2 Score: 63.1586 bits (152), Expect = 2.963e-9
Identity = 34/121 (28.10%), Postives = 56/121 (46.28%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDA--------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R+KR+   R  A   +                     + + F QL    + M + G+  +LC++F++KQ  I NL E++   L + IE
Sbjct:  286 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIE 406          
BLAST of Aamy domain-containing protein vs. TrEMBL
Match: R7TYG9 (SBF2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_148510 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.383e-33
Identity = 75/227 (33.04%), Postives = 122/227 (53.74%), Query Frame = 1
Query:  919 RRFSNGSLDSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTD----ADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVI 1587
            R +++G      ++ +    EF+  FV  ++    S        +F  + Q  +G+ W  + V   Q +++++V E  FY L+Q F   L ECYE E+F PA+ LM + F+ Y      +    H  +L S++   PIW+S++FWN  FF+AVQ+ R+++ T  R+ AN  D     + V F QL      MR+ G+  ELC EF+RKQ  IVNL ++++  L++ I
Sbjct:   11 RSWTSGMSGEHIDDRSRECMEFMRDFVERMFGSSSSAITPLDKAQFGHFCQQSAGRLWFARFVNA-QRVNNQRVLEQTFYGLVQYFAVALFECYEEEDFGPAKTLMNMCFTFYFEAVQPTGGAPHKHFLYSYLKEQPIWQSLRFWNAAFFDAVQQERARKPTPTRDQANGQDEREFQENVTFGQLGTFTCNMRAFGLSQELCMEFLRKQSTIVNLKDEQVQMLRKNI 236          
BLAST of Aamy domain-containing protein vs. TrEMBL
Match: A0A210PNI1 (SBF2 domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14346 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.644e-32
Identity = 77/224 (34.38%), Postives = 122/224 (54.46%), Query Frame = 1
Query:  949 EPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDAD------GVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE 1602
            +P+++      F++ FV  I+   HS+   E   KF +  Q   G+ W  + V   Q +H+K VSE +F++L+Q F  VL EC E E+F PA+ LM + F+ +   H G+  ++   +L SF+   PIW+S++FWN  FF+AVQ  R+++        +    D       + F QL      MRS G+  +LC EF+RKQ  I NL E+++  L+E +E  +E
Sbjct:  404 QPDDITLECMSFMKQFVEKIFNISHSIAQTEK-AKFGELCQFAPGRLWFARYVNS-QRVHNKNVSEQIFFQLVQYFAVVLFECNEAEDFSPAKSLMNMCFTFFYESHHGN--VSGRNFLYSFLREQPIWQSLRFWNAAFFDAVQCERARQPMCTSQGTDQAQTDDQEFQENITFGQLGTFTCNMRSFGLNKDLCLEFLRKQSTIANLKEEQVQMLRENVEKLRE 623          
BLAST of Aamy domain-containing protein vs. TrEMBL
Match: A0A0L8FM91 (SBF2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22014315mg PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.686e-32
Identity = 77/223 (34.53%), Postives = 123/223 (55.16%), Query Frame = 1
Query:  937 SLDSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDAD------GVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVI 1587
            S++S+P+++     EF++ FV  I++    ++  E   KF +  Q Q G+ W  + V   Q +H+K+V E +F+RL+Q F+ VL EC+  E++ PA+ LM + F+ +       ++ A   +L +F+   PIW S++FWN  FF+AVQ  R++R       A+    D       V F QL      M+S G+  ELC EF+RKQ  I NL+ ++   LKE I
Sbjct:  905 SIESQPDDITLECMEFMKMFVEKIFLLNEEISQTEKA-KFGELCQHQPGRIWFARYVNS-QRVHNKRVDEQIFFRLVQYFSVVLFECHMAEDYTPAKSLMNMCFTFFYENRQFGSKTAAKCFLYTFLREQPIWHSLRFWNAAFFDAVQCERARRPVCTSEEASEEKVDDSEFQENVTFGQLGTFTCNMKSFGLSRELCFEFLRKQSTIANLSREKQRLLKENI 1125          
BLAST of Aamy domain-containing protein vs. TrEMBL
Match: A0A1S3I814 (uncharacterized protein LOC106161551 OS=Lingula unguis OX=7574 GN=LOC106161551 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.111e-31
Identity = 79/229 (34.50%), Postives = 126/229 (55.02%), Query Frame = 1
Query:  937 SLDSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFS-CYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDAD------GVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE 1602
            S DS+ +E +   +EF++ FV  I+  G +++  +   +F +  Q   G+ W  + +   Q +++K V E +FYRL+Q F   L EC E E+F PA+ LM + F+ C+ V H       H  +L S++   PIW+S++FWN  FF+AVQ  RS+R      + N    D       + F QL    + M +LG+  +LC EF++KQ  I +L E++   L+E I +WKE
Sbjct:  325 SSDSQLDEHSRQVKEFMKIFVDKIF-QGEAISQTDK-ARFGELCQENPGRLWFARNM-NAQRVNTKTVDEQIFYRLIQFFAICLFECNEAEDFSPAKTLMNMCFTFCHEVRHPSGPVYKH--FLYSYLKDQPIWRSLRFWNAAFFDAVQHERSRRHIQNSGNDNEDRRDDRKFERNITFGQLGNFTSNMLALGLTKQLCLEFLKKQSTIASLKEEQQKMLEENIHNWKE 548          
BLAST of Aamy domain-containing protein vs. TrEMBL
Match: A0A1S3J2G7 (uncharacterized protein LOC106169538 OS=Lingula unguis OX=7574 GN=LOC106169538 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.298e-31
Identity = 79/229 (34.50%), Postives = 126/229 (55.02%), Query Frame = 1
Query:  937 SLDSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFS-CYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDAD------GVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE 1602
            S DS+ +E +   +EF++ FV  I+  G +++  +   +F +  Q   G+ W  + +   Q +++K V E +FYRL+Q F   L EC E E+F PA+ LM + F+ C+ V H       H  +L S++   PIW+S++FWN  FF+AVQ  RS+R      + N    D       + F QL    + M +LG+  +LC EF++KQ  I +L E++   L+E I +WKE
Sbjct:  325 SSDSQLDEHSRQVKEFMKIFVDKIF-QGEAISQTDK-ARFGELCQENPGRLWFARNM-NAQRVNTKTVDEQIFYRLIQFFAICLFECNEAEDFSPAKTLMNMCFTFCHEVRHPSGPVYKH--FLYSYLKDQPIWRSLRFWNAAFFDAVQHERSRRHIQNSGNDNEDRRDDRKFERNITFGQLGNFTSNMLALGLTKQLCLEFLKKQSTIASLKEEQQKMLEENIHNWKE 548          
BLAST of Aamy domain-containing protein vs. Ensembl Cavefish
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:103043002])

HSP 1 Score: 67.3958 bits (163), Expect = 1.559e-11
Identity = 37/99 (37.37%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  967 SHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCY 1257
            +  REF++A+V  ++  G    D+E   +F +    ++GK   W  K V   Q  +SK VSE  FYRL+Q F  VL ECY+ ++++PA+ LM + F+ Y
Sbjct:  110 TERREFMKAYVEKLF-HGKEDFDQEEKARFGELCSGENGKGREWFAKYV-SVQRCNSKCVSEQTFYRLVQSFAVVLFECYQMDDYVPAKHLMTMCFTYY 206          

HSP 2 Score: 62.003 bits (149), Expect = 8.532e-10
Identity = 35/121 (28.93%), Postives = 58/121 (47.93%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA-------------------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R+KR+ T RR +    D                    + + F QL    + M + G+  +LC++F++KQ  I +L E++   L + IE
Sbjct:  302 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERNKRSPTTRRTAEEEKDEREKWCHMTQEEKDDSSRIDENITFGQLGTFTHNMLAFGLTKKLCNDFLKKQAVIGHLNEEQYKLLSDHIE 422          
BLAST of Aamy domain-containing protein vs. Ensembl Cavefish
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:103043002])

HSP 1 Score: 67.3958 bits (163), Expect = 1.625e-11
Identity = 37/99 (37.37%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  967 SHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCY 1257
            +  REF++A+V  ++  G    D+E   +F +    ++GK   W  K V   Q  +SK VSE  FYRL+Q F  VL ECY+ ++++PA+ LM + F+ Y
Sbjct:  110 TERREFMKAYVEKLF-HGKEDFDQEEKARFGELCSGENGKGREWFAKYV-SVQRCNSKCVSEQTFYRLVQSFAVVLFECYQMDDYVPAKHLMTMCFTYY 206          

HSP 2 Score: 62.3882 bits (150), Expect = 5.713e-10
Identity = 34/111 (30.63%), Postives = 57/111 (51.35%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA---------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R+KR+ T R    + T           + + F QL    + M + G+  +LC++F++KQ  I +L E++   L + IE
Sbjct:  302 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERNKRSPTTREKWCHMTQEEKDDSSRIDENITFGQLGTFTHNMLAFGLTKKLCNDFLKKQAVIGHLNEEQYKLLSDHIE 412          
BLAST of Aamy domain-containing protein vs. Ensembl Cavefish
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:103043002])

HSP 1 Score: 66.6254 bits (161), Expect = 2.576e-11
Identity = 37/99 (37.37%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  967 SHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCY 1257
            +  REF++A+V  ++  G    D+E   +F +    ++GK   W  K V   Q  +SK VSE  FYRL+Q F  VL ECY+ ++++PA+ LM + F+ Y
Sbjct:  110 TERREFMKAYVEKLF-HGKEDFDQEEKARFGELCSGENGKGREWFAKYV-SVQRCNSKCVSEQTFYRLVQSFAVVLFECYQMDDYVPAKHLMTMCFTYY 206          

HSP 2 Score: 62.003 bits (149), Expect = 6.712e-10
Identity = 34/111 (30.63%), Postives = 57/111 (51.35%), Query Frame = 1
Query: 1288 AHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRA-TMRRNSANTTDA---------DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
                YL + +   PIW +++FWN  FF+AV   R+KR+ T R    + T           + + F QL    + M + G+  +LC++F++KQ  I +L E++   L + IE
Sbjct:  285 GEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERNKRSPTTREKWCHMTQEEKDDSSRIDENITFGQLGTFTHNMLAFGLTKKLCNDFLKKQAVIGHLNEEQYKLLSDHIE 395          
BLAST of Aamy domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 68.5514 bits (166), Expect = 4.982e-12
Identity = 38/105 (36.19%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQ 1284
            R+F++ +V  I+ +G+   D+E   +F +    ++GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA++LM +   C+T  + G +Q
Sbjct:   74 RQFMKVYVGKIF-NGNEDFDQEEKARFGELCSGENGKGREWFAKYVTA-QRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTM---CFTYYYIGKSQ 173          

HSP 2 Score: 65.0846 bits (157), Expect = 7.094e-11
Identity = 36/115 (31.30%), Postives = 59/115 (51.30%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSA-----------------NTTDAD-GVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R+KR+   R+                   +T+  D  +AF QL    + M + G+  +LC +F++KQ  I NL E++  +L + IE
Sbjct:  254 YLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRSDEEKDKREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNEEQYKQLSDYIE 368          
BLAST of Aamy domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 68.9366 bits (167), Expect = 5.398e-12
Identity = 38/105 (36.19%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQ 1284
            R+F++ +V  I+ +G+   D+E   +F +    ++GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA++LM +   C+T  + G +Q
Sbjct:  115 RQFMKVYVGKIF-NGNEDFDQEEKARFGELCSGENGKGREWFAKYVTA-QRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTM---CFTYYYIGKSQ 214          

HSP 2 Score: 63.1586 bits (152), Expect = 3.226e-10
Identity = 35/118 (29.66%), Postives = 58/118 (49.15%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATM---------------------RRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R+KR+                        R+  +  D + +AF QL    + M + G+  +LC +F++KQ  I NL E++  +L + IE
Sbjct:  301 YLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKRSPTTSGAQDEEKDKREKWDHMSQKERDDTSKID-ENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNEEQYKQLSDYIE 417          
BLAST of Aamy domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 68.9366 bits (167), Expect = 5.434e-12
Identity = 36/98 (36.73%), Postives = 59/98 (60.20%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTV 1263
            R+F++ +V  I+ +G+   D+E   +F +    ++GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA++LM + F+ Y +
Sbjct:  115 RQFMKVYVGKIF-NGNEDFDQEEKARFGELCSGENGKGREWFAKYVTA-QRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTMCFTYYYI 210          

HSP 2 Score: 63.5438 bits (153), Expect = 2.706e-10
Identity = 34/97 (35.05%), Postives = 52/97 (53.61%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSA---------NTTDAD-GVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTED 1560
            YL + +   PIW +++FWN  FF+AV   R+KR+   R            +T+  D  +AF QL    + M + G+  +LC +F++KQ  I NL ED
Sbjct:  301 YLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKRSPTTREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNED 397          
BLAST of Aamy domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 68.9366 bits (167), Expect = 5.771e-12
Identity = 36/98 (36.73%), Postives = 59/98 (60.20%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTV 1263
            R+F++ +V  I+ +G+   D+E   +F +    ++GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA++LM + F+ Y +
Sbjct:  115 RQFMKVYVGKIF-NGNEDFDQEEKARFGELCSGENGKGREWFAKYVTA-QRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTMCFTYYYI 210          

HSP 2 Score: 56.9954 bits (136), Expect = 3.604e-8
Identity = 32/107 (29.91%), Postives = 51/107 (47.66%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATM---------------------RRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTE 1557
            YL + +   PIW +++FWN  FF+AV   R+KR+                        R+  +  D + +AF QL    + M + G+  +LC +F++KQ  I NL E
Sbjct:  301 YLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKRSPTTSGAQDEEKDKREKWDHMSQKERDDTSKID-ENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNE 406          
BLAST of Aamy domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 68.5514 bits (166), Expect = 5.860e-12
Identity = 38/105 (36.19%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  976 REFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKC--WLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQ 1284
            R+F++ +V  I+ +G+   D+E   +F +    ++GK   W  K V   Q  HSK VSE  FYRL+Q F  VL EC++ +++ PA++LM +   C+T  + G +Q
Sbjct:  115 RQFMKVYVGKIF-NGNEDFDQEEKARFGELCSGENGKGREWFAKYVTA-QRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTM---CFTYYYIGKSQ 214          

HSP 2 Score: 67.781 bits (164), Expect = 1.120e-11
Identity = 36/107 (33.64%), Postives = 58/107 (54.21%), Query Frame = 1
Query: 1300 YLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSAN---------TTDAD-GVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIE 1590
            YL + +   PIW +++FWN  FF+AV   R+KR+   R   +         T+  D  +AF QL    + M + G+  +LC +F++KQ  I NL E++  +L + IE
Sbjct:  301 YLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKRSPTTREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNEEQYKQLSDYIE 407          
BLAST of Aamy domain-containing protein vs. Planmine SMEST
Match: SMESG000055799.1 (SMESG000055799.1)

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 467/492 (94.92%), Postives = 468/492 (95.12%), Query Frame = 1
Query:  127 MNFGKFIRKYSTDTDNENSQNRSSLISNTTKLFDSVNTKTTSLVSGISNTFENIKRRTSIETLTFTDKEASKQEEDVYNDKPKPTQTNTLKYSEIETMEPKPIYQDAKSYIEQSYQMKTDPQKADNIYSQSPMGSTIRKNXXXXXXXXLTKQKSAPHEEDKQDPKDMFQRSHTMVDNDIMEDIYHTECLKIEGGQLANEVLADAKNKLEELTQMECQKIVSAMDDLISFDQPNFLTQTADDNSSPSEYGDRGDQPIYGDHGQKIRRFSNGSLDSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE 1602
            MNFGKFIRKYSTDTDNENSQNRSSLISNTTKLFDSVNTKTTSLVSGISNTFENIKRRTSIETLTFTDKEASKQEEDVYNDKPKPTQTNTLKYSEIETMEPKPIYQDAKSYIEQSYQMKTDPQKADNIYSQSPMGSTIRKNPPPKPPPPLTKQKSAPHEEDKQDPKDMFQRSHTMVDNDIMEDIYHTECLKIEGGQLANEVLADAKNKLEELTQMECQKIVSAMDDLISFDQPNFLTQTADDNSSPSEYGDRGDQPIYGDHGQKIRR                      +F  NIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE
Sbjct:    1 MNFGKFIRKYSTDTDNENSQNRSSLISNTTKLFDSVNTKTTSLVSGISNTFENIKRRTSIETLTFTDKEASKQEEDVYNDKPKPTQTNTLKYSEIETMEPKPIYQDAKSYIEQSYQMKTDPQKADNIYSQSPMGSTIRKNPPPKPPPPLTKQKSAPHEEDKQDPKDMFQRSHTMVDNDIMEDIYHTECLKIEGGQLANEVLADAKNKLEELTQMECQKIVSAMDDLISFDQPNFLTQTADDNSSPSEYGDRGDQPIYGDHGQKIRR-------------------IFRSFCGNIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE 473          
BLAST of Aamy domain-containing protein vs. Planmine SMEST
Match: SMESG000055799.1 (SMESG000055799.1)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 467/492 (94.92%), Postives = 468/492 (95.12%), Query Frame = 1
Query:  127 MNFGKFIRKYSTDTDNENSQNRSSLISNTTKLFDSVNTKTTSLVSGISNTFENIKRRTSIETLTFTDKEASKQEEDVYNDKPKPTQTNTLKYSEIETMEPKPIYQDAKSYIEQSYQMKTDPQKADNIYSQSPMGSTIRKNXXXXXXXXLTKQKSAPHEEDKQDPKDMFQRSHTMVDNDIMEDIYHTECLKIEGGQLANEVLADAKNKLEELTQMECQKIVSAMDDLISFDQPNFLTQTADDNSSPSEYGDRGDQPIYGDHGQKIRRFSNGSLDSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE 1602
            MNFGKFIRKYSTDTDNENSQNRSSLISNTTKLFDSVNTKTTSLVSGISNTFENIKRRTSIETLTFTDKEASKQEEDVYNDKPKPTQTNTLKYSEIETMEPKPIYQDAKSYIEQSYQMKTDPQKADNIYSQSPMGSTIRKNPPPKPPPPLTKQKSAPHEEDKQDPKDMFQRSHTMVDNDIMEDIYHTECLKIEGGQLANEVLADAKNKLEELTQMECQKIVSAMDDLISFDQPNFLTQTADDNSSPSEYGDRGDQPIYGDHGQKIRR                      +F  NIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE
Sbjct:    1 MNFGKFIRKYSTDTDNENSQNRSSLISNTTKLFDSVNTKTTSLVSGISNTFENIKRRTSIETLTFTDKEASKQEEDVYNDKPKPTQTNTLKYSEIETMEPKPIYQDAKSYIEQSYQMKTDPQKADNIYSQSPMGSTIRKNPPPKPPPPLTKQKSAPHEEDKQDPKDMFQRSHTMVDNDIMEDIYHTECLKIEGGQLANEVLADAKNKLEELTQMECQKIVSAMDDLISFDQPNFLTQTADDNSSPSEYGDRGDQPIYGDHGQKIRR----------------------SFCGNIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDADGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE 470          
BLAST of Aamy domain-containing protein vs. Planmine SMEST
Match: SMESG000078604.1 (SMESG000078604.1)

HSP 1 Score: 129.413 bits (324), Expect = 8.020e-33
Identity = 81/258 (31.40%), Postives = 136/258 (52.71%), Query Frame = 1
Query:  844 DDNSSPSEYGDRGDQPIYGD-HGQKIRRFSNGSLDSEPEELNSHHREFLEAFVANIYIDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKR---ATMRRNSANTTDA---DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESW 1596
            D +SS SEYGD GD+P+Y +  G + RR S  S+DS PE+    ++ F+   V  I+ D +S   E   + F  + +  +G+    K +++ +   +K+V+  +  +L+ +F  VL +C  +E+F PAR  M + F+ Y  V A ++      YL   +S  PIW+S++FWN  FF ++   R+K+    T     A   D    + VAF QL      M +LG+  E+  +F+RKQ  + NL  ++   ++  I+ W
Sbjct:   82 DGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIF-DTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQ-KKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY--VEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTDDPEKALIQDKEFQENVAFSQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQKW 335          
The following BLAST results are available for this feature:
BLAST of Aamy domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA05132.307e-1539.62KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05139.891e-1539.62KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05139.891e-1539.62KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05131.007e-1439.62KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05131.740e-1032.71KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG173781.716e-1229.58gene:FBgn0031858 transcript:FBtr0079336[more]
CG173782.682e-1229.58gene:FBgn0031858 transcript:FBtr0332335[more]
CG173782.682e-1229.58gene:FBgn0031858 transcript:FBtr0079337[more]
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:918604.666e-1235.51zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34][more]
zgc:918604.697e-1235.51zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34][more]
zgc:918604.697e-1235.51zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34][more]
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kiaa05139.683e-1336.61KIAA0513 [Source:NCBI gene;Acc:100125070][more]
kiaa05139.721e-1336.61KIAA0513 [Source:NCBI gene;Acc:100125070][more]
kiaa05139.891e-1336.61KIAA0513 [Source:NCBI gene;Acc:100125070][more]
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
6430548M08Rik2.196e-1739.32RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik1.012e-1639.32RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik5.298e-1639.32RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik5.537e-1639.32RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik5.537e-1639.32RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Aamy domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8R0A7|K0513_MOUSE3.873e-1539.32Uncharacterized protein KIAA0513 OS=Mus musculus O... [more]
sp|O60268|K0513_HUMAN4.750e-1439.62Uncharacterized protein KIAA0513 OS=Homo sapiens O... [more]
back to top
BLAST of Aamy domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TYG91.383e-3333.04SBF2 domain-containing protein OS=Capitella teleta... [more]
A0A210PNI11.644e-3234.38SBF2 domain-containing protein OS=Mizuhopecten yes... [more]
A0A0L8FM912.686e-3234.53SBF2 domain-containing protein OS=Octopus bimaculo... [more]
A0A1S3I8142.111e-3134.50uncharacterized protein LOC106161551 OS=Lingula un... [more]
A0A1S3J2G72.298e-3134.50uncharacterized protein LOC106169538 OS=Lingula un... [more]
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:918601.559e-1137.37KIAA0513 ortholog [Source:NCBI gene;Acc:103043002][more]
zgc:918601.625e-1137.37KIAA0513 ortholog [Source:NCBI gene;Acc:103043002][more]
zgc:918602.576e-1137.37KIAA0513 ortholog [Source:NCBI gene;Acc:103043002][more]
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aamy domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:918604.982e-1236.19KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918605.398e-1236.19KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918605.434e-1236.73KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918605.771e-1236.73KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918605.860e-1236.19KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
back to top
BLAST of Aamy domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000055799.10.000e+094.92SMESG000055799.1[more]
SMESG000055799.10.000e+094.92SMESG000055799.1[more]
SMESG000078604.18.020e-3331.40SMESG000078604.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009301 ID=SMED30009301|Name=Aamy domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1825bp
CAGAAACAACAGTGGATGCACGAGAACAATTCCGATTGTTGTCTTGAGTC
ATTTTGCATCTGAATTATGTCGAATTGTTGATTGCAATTATTTCCATTTT
ACTCTCTTGATTTTCTCTCGTTTCTCATGAATTTCGGAAAGTTTATCCGC
AAATATTCCACCGACACAGACAATGAGAATTCTCAGAATAGGTCGAGTTT
GATATCAAATACGACAAAGCTCTTTGATTCTGTCAATACAAAAACGACAA
GTCTCGTAAGTGGGATTTCAAATACCTTTGAAAACATTAAACGAAGAACT
TCCATTGAAACTTTAACGTTCACTGACAAGGAAGCCTCGAAACAAGAGGA
AGATGTTTACAACGATAAACCAAAGCCTACTCAAACAAATACGTTGAAAT
ATTCAGAAATTGAAACAATGGAACCGAAACCGATATATCAAGACGCAAAG
AGCTACATTGAACAGTCTTACCAAATGAAAACTGATCCACAAAAAGCTGA
CAACATTTATAGTCAATCACCAATGGGATCGACTATAAGAAAAAATCCCC
CTCCAAAACCTCCTCCTCCGTTGACAAAGCAGAAATCAGCTCCACACGAA
GAAGACAAACAAGATCCAAAGGATATGTTCCAACGGAGTCACACGATGGT
TGACAATGATATAATGGAAGATATATACCACACCGAATGTTTGAAAATAG
AGGGTGGACAGTTAGCCAATGAAGTTTTGGCCGACGCTAAAAATAAATTG
GAAGAGTTAACTCAAATGGAATGCCAGAAAATTGTATCAGCTATGGATGA
TTTAATAAGTTTTGATCAACCAAATTTTCTTACTCAAACAGCTGATGATA
ACAGTTCTCCATCGGAATACGGAGACAGAGGCGATCAACCGATTTATGGA
GATCATGGACAAAAGATTCGTCGGTTTTCAAATGGAAGTCTCGACAGTGA
ACCAGAAGAATTAAATTCTCATCATCGAGAATTTTTAGAAGCTTTTGTGG
CCAATATTTACATAGACGGACATAGTCTTAATGACGAAGAAACCTTCAAT
AAATTTAAGAAATACATTCAATCACAGTCTGGGAAATGTTGGCTAGGAAA
ATTGGTAGAAAAATATCAATCAATTCATTCTAAGAAAGTCTCTGAAGTCG
TATTCTACAGACTGCTGCAATTATTTACTTTTGTTTTACTAGAATGCTAT
GAAAATGAAGAATTTCTACCGGCAAGAGATTTGATGCTTGTTGCTTTCAG
CTGTTACACAGTGGTTCATGCCGGTAGCAATCAAATTGCCCACAATTTCT
ACCTGTCCTCATTTATCAGTTGCCATCCAATTTGGAAATCCATTCAGTTC
TGGAATGTCTGTTTTTTCAATGCAGTCCAGGAAGTGAGATCCAAACGAGC
AACAATGAGAAGAAATTCGGCTAATACAACAGACGCAGATGGAGTAGCTT
TTCATCAATTGCAGGTCCATCTAAATTACATGAGGAGCTTAGGAATACCG
ATTGAACTCTGCTCGGAATTCGTAAGAAAGCAAGTGAACATCGTCAATCT
GACTGAAGATGAAATGAACCGTCTGAAAGAAGTAATAGAGAGCTGGAAAG
AATGACCAGAGAACTGTGTAAAGGAAAATTGACTGAATTATTTGAAAAAA
GAAATGTTTTGTCTTTAACCAATATTGATTTTTATGTGCTTATCTTTATA
CAAACTTGATTTCAAATGAAATTTTGAAAAGTCTTGGAAATTTTCTTCAA
TTTCTACAGCAAATAATTATGAAAAATTTTTGTTGTCATGTTAGATGTGA
TCGGTTTAATAAATAGCATTAGGAC
back to top

protein sequence of SMED30009301-orf-1

>SMED30009301-orf-1 ID=SMED30009301-orf-1|Name=SMED30009301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=493bp
MNFGKFIRKYSTDTDNENSQNRSSLISNTTKLFDSVNTKTTSLVSGISNT
FENIKRRTSIETLTFTDKEASKQEEDVYNDKPKPTQTNTLKYSEIETMEP
KPIYQDAKSYIEQSYQMKTDPQKADNIYSQSPMGSTIRKNPPPKPPPPLT
KQKSAPHEEDKQDPKDMFQRSHTMVDNDIMEDIYHTECLKIEGGQLANEV
LADAKNKLEELTQMECQKIVSAMDDLISFDQPNFLTQTADDNSSPSEYGD
RGDQPIYGDHGQKIRRFSNGSLDSEPEELNSHHREFLEAFVANIYIDGHS
LNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLF
TFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCH
PIWKSIQFWNVCFFNAVQEVRSKRATMRRNSANTTDADGVAFHQLQVHLN
YMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESWKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR022096SBF1/SBF2