NPYR-13

Overview
NameNPYR-13
Smed IDSMED30009299
Length (bp)1521
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPYR-13 (SMED30009299) t-SNE clustered cells

Violin plots show distribution of expression levels for NPYR-13 (SMED30009299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPYR-13 (SMED30009299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPYR-13 (SMED30009299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009299SMESG000028179.1 SmedASXL_004855SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPYR-13 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 81.6481 bits (200), Expect = 9.157e-16
Identity = 72/264 (27.27%), Postives = 127/264 (48.11%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETS-------YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLY----ISIYYRLKMRTFKKRD------NVRKLRTNKILIAIVLCFAVFWSP-WTIXXXXXXXXXXXXKMRWLQGYVH---HIYNFNSSNLNET--SFFN 876
             H VTN+F+L LAISD+L+  F +PI     I     FG   CK+   +  + +  S  T++ IAVDR++ ++YP K +++  TA +++++I V++     P A+  H    E     + L +        +C E WP    R  Y+  +F   Y  PL +   +Y    IS++      T +K        + +K +  K+L+ + L F + W P WT+  L   +    ++++ +  Y++   H   F +S++N     FFN
Sbjct:  178 MHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLH--VQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFN 439          
BLAST of NPYR-13 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 80.4925 bits (197), Expect = 1.274e-15
Identity = 72/264 (27.27%), Postives = 126/264 (47.73%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETS-------YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLY----ISIYYRLKMRTFKKRDNV------RKLRTNKILIAIVLCFAVFWSP-WTIXXXXXXXXXXXXKMRWLQGYVH---HIYNFNSSNLNET--SFFN 876
             H VTN+F+L LAISD+L+  F +PI     I     FG   CK+   +  + +  S  T++ IAVDR++ ++YP K +++  TA +++++I V++     P A+  H    E     + L +        +C E WP    R  Y+  +F   Y  PL +   +Y    IS++      T +K          +K +  K+L+ + L F + W P WT+  L   +    ++++ +  Y++   H   F +S++N     FFN
Sbjct:   76 MHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLH--VQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFN 337          
BLAST of NPYR-13 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 80.1073 bits (196), Expect = 1.775e-15
Identity = 72/264 (27.27%), Postives = 126/264 (47.73%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETS-------YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLY----ISIYYRLKMRTFKKRDNV------RKLRTNKILIAIVLCFAVFWSP-WTIXXXXXXXXXXXXKMRWLQGYVH---HIYNFNSSNLNET--SFFN 876
             H VTN+F+L LAISD+L+  F +PI     I     FG   CK+   +  + +  S  T++ IAVDR++ ++YP K +++  TA +++++I V++     P A+  H    E     + L +        +C E WP    R  Y+  +F   Y  PL +   +Y    IS++      T +K          +K +  K+L+ + L F + W P WT+  L   +    ++++ +  Y++   H   F +S++N     FFN
Sbjct:   79 MHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLH--VQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFN 340          
BLAST of NPYR-13 vs. Ensembl Human
Match: NPY1R (neuropeptide Y receptor Y1 [Source:HGNC Symbol;Acc:HGNC:7956])

HSP 1 Score: 78.5666 bits (192), Expect = 4.821e-15
Identity = 67/211 (31.75%), Postives = 108/211 (51.18%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTE----NNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR---TFKKRDN----VRKLRTNKILIAIVLCFAVFWSPWTI 759
            NVTNI ++ L+ SD+L+    +P    Y + +   FG   CK+   +  V + +S  +++LIAV+R+++II P   R +   A + + +I V++  SS+P  ++   + T+    N +L    +   C + +P    RL Y+  + +  YF PL      Y  IY RLK R     K RDN        R N +L++IV+ FAV W P TI
Sbjct:   73 NVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIY--QVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTI 281          
BLAST of NPYR-13 vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 75.0998 bits (183), Expect = 6.075e-14
Identity = 84/331 (25.38%), Postives = 143/331 (43.20%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRL---CYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDN----VRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGS 1125
               VTN F+  LA++D+L+    +P    Y +  +   G + C +V     + + +S++T+ +IA+DR+R I+Y L+ +ISK  + +++ L   IS + + P+A+F      E   +  + E   C E WP     +    YS    L  Y LPL I ++ Y  I+ +LK        N     R+ +T K+L+ +V+ FAV W P                   L  +   + + +S  L+   +        K I  +    A  S   NP LYGW+N + ++     F R    L    S  +      KN    +    N++F E +
Sbjct:   81 MRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIE---IIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLP-------------------LHAFQLAV-DIDSQVLDLKEY--------KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAF-RCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEAT 379          
BLAST of NPYR-13 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 86.6557 bits (213), Expect = 4.297e-18
Identity = 84/329 (25.53%), Postives = 142/329 (43.16%), Query Frame = 1
Query:  142 KHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKK----------------------------------RDNVRKL-------RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNF 1005
            KH     V NIF+L L  S++L+C  ++PI     + ++  F +  CK++  +    +++S+ ++  IA+DRY +++ P K+++S  +A ++ +LI VIS +  +P     +  Y +   L+  L   YC+E+WP    R  Y+  V +  +  P    A+ Y +I+ RL+ R   K                                   +N ++L       RT  IL  +VL FA  W P  + +L          M    G+  H         +ETS  +    HT  +       +  + V NPFLY WLN   KE+L +  
Sbjct:   78 KHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMP-----YGWYMDVEKLN-GLCGEYCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTL----------MIEYDGFFFHS--------DETSATSTD--HTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTL 380          
BLAST of NPYR-13 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 86.6557 bits (213), Expect = 5.021e-18
Identity = 84/329 (25.53%), Postives = 141/329 (42.86%), Query Frame = 1
Query:  142 KHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKK----------------------------------RDNVRKL-------RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNF 1005
            KH     V NIF+L L  S++L+C  ++PI     + ++  F +  CK++  +    +++S+ ++  IA+DRY +++ P K+++S  +A ++ +LI VIS +  +P   +      + N L  E    YC+E+WP    R  Y+  V +  +  P    A+ Y +I+ RL+ R   K                                   +N ++L       RT  IL  +VL FA  W P  + +L          M    G+  H         +ETS  +    HT  +       +  + V NPFLY WLN   KE+L +  
Sbjct:   96 KHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMPYGWYMD--VEKLNGLCGE----YCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTL----------MIEYDGFFFHS--------DETSATSTD--HTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTL 398          
BLAST of NPYR-13 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 86.2705 bits (212), Expect = 5.203e-18
Identity = 84/329 (25.53%), Postives = 142/329 (43.16%), Query Frame = 1
Query:  142 KHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKK----------------------------------RDNVRKL-------RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNF 1005
            KH     V NIF+L L  S++L+C  ++PI     + ++  F +  CK++  +    +++S+ ++  IA+DRY +++ P K+++S  +A ++ +LI VIS +  +P     +  Y +   L+  L   YC+E+WP    R  Y+  V +  +  P    A+ Y +I+ RL+ R   K                                   +N ++L       RT  IL  +VL FA  W P  + +L          M    G+  H         +ETS  +    HT  +       +  + V NPFLY WLN   KE+L +  
Sbjct:   53 KHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMP-----YGWYMDVEKLN-GLCGEYCSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTL----------MIEYDGFFFHS--------DETSATSTD--HTYIVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTL 355          
BLAST of NPYR-13 vs. Ensembl Celegans
Match: npr-3 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:P90745])

HSP 1 Score: 73.1738 bits (178), Expect = 8.236e-14
Identity = 71/295 (24.07%), Postives = 128/295 (43.39%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTH-SIYTENNSLSIELETSYCAEYWPYLLP-------RLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRD-NV----------RKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKE 987
            +V  +FV  LA SD+L+C F++PI      +    F  I CK++       +++SS T+ +IA+DR  +I+ P +E ++   A  +V  I ++    ++PV +++  ++Y        E+  ++C E WP   P       R  Y   V +  + +P +I++  Y  I   +  +  ++R  N+          RK R N+++I +V+ F + W P                             FN+ NL    F   K     T+  +    A  S V+NP +Y W N   ++
Sbjct:   58 SVRTVFVGCLAGSDLLMCLFSLPITAISIFSRVWVFPAIFCKLIGVFQGGTIFVSSFTLTVIALDRCVLILRPNQEIVNFPRAVFIVFCIWLLGYSLALPVGIYSDIAVYD-------EICGTFCEENWPDFNPDTGRSGIRRAYGLSVLVLQFGIPALISSICYWMISRVMSDQLARRRGHNIRPESETKLVNRKTRANRMMIVMVVGFVLAWMP-----------------------------FNAVNLYRDLFGISK--WYSTVFALCHVCAMCSAVLNPIIYSWFNPQFRQ 314          
BLAST of NPYR-13 vs. Ensembl Celegans
Match: npr-1 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q18534])

HSP 1 Score: 71.633 bits (174), Expect = 3.742e-13
Identity = 72/333 (21.62%), Postives = 133/333 (39.94%), Query Frame = 1
Query:  145 HCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSI-YTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRT-----------------------------------------FKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCF----ATFSCVINPFLYGWLNDSIKEVLCRNF 1005
            H    +V NIF+L LA SD ++C  ++PI     + +   FG + C ++  +  + +++ + ++  IA+DRY +++ P    +S+  A +  +L+ ++S + ++P A     I YTE       +   +C E W     R  Y+  V L  + +P  + A+ Y +I   L  R                                           K+R  ++  RT  IL+ +V+ F + W P                        H++ +      +  SFF         I  +L  F    A  + V+NP LY WLN S ++++ + +
Sbjct:   54 HKALLSVQNIFILNLAASDCMMCILSLPITPITNVYKNWYFGNLLCHLIPCIQGISIFVCTFSLGAIALDRYILVVRPHSTPLSQRGAFLTTVLLWILSFVVTLPYAFNMQMIEYTEE-----RICGYFCTEKWESAKSRRAYTMIVMLAQFVVPFAVMAFCYANIVSVLSKRAQTKIRKMVERTSALESSCAFPSHGLEQYENELNEFLDKQEKEKQRVVLQNRRTTSILVTMVVWFGITWLP------------------------HNVISLIIEYDDTQSFFRLYGRDDYDISYLLNLFTHSIAMSNNVLNPVLYAWLNPSFRQLVIKTY 357          
BLAST of NPYR-13 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308318)

HSP 1 Score: 102.834 bits (255), Expect = 3.926e-23
Identity = 88/305 (28.85%), Postives = 139/305 (45.57%), Query Frame = 1
Query:  151 VFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA---GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSL--SIELETS--YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR----------TFKKRDNVRKL-RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIK----EVLCR 999
            +     N+F+L LAISD+LLC   +P+ T  EI  K    G  +I CK +  L ++ +++S+++I  IA DRY++I+YP ++ +    A  ++  I  ++ + + P+ ++   I T+  +L   I L+ +  YC E WP    R  YS F     Y +P++I +  Y  IY +LK R            +K +  R++ RTN +LI+I + F V W P                              N  NL      +P          I       S   NP LYGWLND+ +    E+LCR
Sbjct:  116 IMRTARNLFILNLAISDLLLCLVTMPL-TLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLP-----------------------------LNFFNLYADMERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCR 390          
BLAST of NPYR-13 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0078590)

HSP 1 Score: 102.834 bits (255), Expect = 4.273e-23
Identity = 88/305 (28.85%), Postives = 139/305 (45.57%), Query Frame = 1
Query:  151 VFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA---GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSL--SIELETS--YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR----------TFKKRDNVRKL-RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIK----EVLCR 999
            +     N+F+L LAISD+LLC   +P+ T  EI  K    G  +I CK +  L ++ +++S+++I  IA DRY++I+YP ++ +    A  ++  I  ++ + + P+ ++   I T+  +L   I L+ +  YC E WP    R  YS F     Y +P++I +  Y  IY +LK R            +K +  R++ RTN +LI+I + F V W P                              N  NL      +P          I       S   NP LYGWLND+ +    E+LCR
Sbjct:  116 IMRTARNLFILNLAISDLLLCLVTMPL-TLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLP-----------------------------LNFFNLYADMERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCR 390          
BLAST of NPYR-13 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308317)

HSP 1 Score: 99.3673 bits (246), Expect = 5.774e-22
Identity = 93/351 (26.50%), Postives = 147/351 (41.88%), Query Frame = 1
Query:  151 VFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA---GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSL--SIELETS--YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR----------TFKKRDNVRKL-RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGH---NSQRGDNKNYRFNRLDMKNNNFQEGSEKANL 1140
            +     N+F+L LAISD+LLC   +P+ T  EI  K    G  +I CK +  L ++ +++S+++I  IA DRY++I+YP ++ +    A  ++  I  ++ + + P+ ++   I T+  +L   I L+ +  YC E WP    R  YS F     Y +P++I +  Y  IY +LK R            +K +  R++ RTN +LI+I + F V W P                              N  NL      +P          I       S   NP LYGWLND+ +  +     R R L  E   G        G           +   +F  G  +  L
Sbjct:  116 IMRTARNLFILNLAISDLLLCLVTMPL-TLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLP-----------------------------LNFFNLYADMERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRCNVQAAARRRRKLGAELSKGELKLLGPGGAQSGTAGGEGGLAATDFMTGHHEGGL 436          
BLAST of NPYR-13 vs. Ensembl Fly
Match: NPFR (gene:FBgn0037408 transcript:FBtr0308316)

HSP 1 Score: 98.9821 bits (245), Expect = 6.747e-22
Identity = 93/351 (26.50%), Postives = 147/351 (41.88%), Query Frame = 1
Query:  151 VFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA---GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSL--SIELETS--YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR----------TFKKRDNVRKL-RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGH---NSQRGDNKNYRFNRLDMKNNNFQEGSEKANL 1140
            +     N+F+L LAISD+LLC   +P+ T  EI  K    G  +I CK +  L ++ +++S+++I  IA DRY++I+YP ++ +    A  ++  I  ++ + + P+ ++   I T+  +L   I L+ +  YC E WP    R  YS F     Y +P++I +  Y  IY +LK R            +K +  R++ RTN +LI+I + F V W P                              N  NL      +P          I       S   NP LYGWLND+ +  +     R R L  E   G        G           +   +F  G  +  L
Sbjct:  116 IMRTARNLFILNLAISDLLLCLVTMPL-TLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLP-----------------------------LNFFNLYADMERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRCNVQAAARRRRKLGAELSKGELKLLGPGGAQSGTAGGEGGLAATDFMTGHHEGGL 436          
BLAST of NPYR-13 vs. Ensembl Fly
Match: sNPF-R (gene:FBgn0036934 transcript:FBtr0332667)

HSP 1 Score: 84.7297 bits (208), Expect = 5.257e-17
Identity = 88/351 (25.07%), Postives = 136/351 (38.75%), Query Frame = 1
Query:  151 VFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALF-------THSIYTENNSL---SIELETSYCA---------------------------------------EYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKK----------RDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLL 1026
                VTNIF+  LA+SDILLC   +P    Y    +  FG   C +V       +YIS+LT+  IA+DRY +IIYP   R+  ST   +++ I VI+ ++++P  ++        +   T N +L   ++ L  S+ A                                       E WP    R  +        + LP  I +  Y+ I  +L  R   K           D  RK RTN++LIA+V  F + W P  +                      +I++      NE  F+        +I     C+       NPFLY WLN++ ++        F+H+L
Sbjct:   93 AMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMTAGSTGPEMPYVRVYCEENWPSEQYRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRARAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVV---------------------NIFDDFDDKSNEWRFYILFFFVAHSIAMSSTCY-------NPFLYAWLNENFRK-------EFKHVL 408          
BLAST of NPYR-13 vs. Ensembl Zebrafish
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 96.2857 bits (238), Expect = 2.850e-21
Identity = 84/326 (25.77%), Postives = 139/326 (42.64%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF----------KKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLD 1095
             H+ TN  +  LA+ D+++C F +P+  +Y   E+   FG   C  V  + +  ++ + L++  IAVDRY ++ YP++ R  +     LV+ I + +   S P AL  H++Y + +    E+  + C E+W    L RL YSCF  L  YF+PL   +  Y +I   L+ R            +++   ++ +T ++L+  VL FA  W P  I                    V+ I +       +T F      H   I       A  S   NPF+Y  L+      LC N       + +    H +Q     + R  RL+
Sbjct:   65 LHSTTNFLIGNLALVDLVMCLFCVPLTAFYAFDERGWVFGQFMCHFVTLMQTATVFAAVLSLTAIAVDRYVVVAYPIRRRGGRWFCGWLVVSIWLCALAMSTPTAL--HTVYLDLSETGHEM--AVCEEFWHGQELSRLIYSCFFLLLSYFVPLAAVSISYCAISCHLQHRATPRLMAATPSNQEKWGRKRRKTFRLLLVSVLSFAFSWLPLQI--------------------VNLIRDL------DTDFAILSKNHVNVIQVSCHLLAMSSACYNPFIYASLHKKFLSYLCHN-------MFQKRKAHCTQSSITTSSRMTRLN 353          
BLAST of NPYR-13 vs. Ensembl Zebrafish
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 96.2857 bits (238), Expect = 2.850e-21
Identity = 84/326 (25.77%), Postives = 139/326 (42.64%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF----------KKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLD 1095
             H+ TN  +  LA+ D+++C F +P+  +Y   E+   FG   C  V  + +  ++ + L++  IAVDRY ++ YP++ R  +     LV+ I + +   S P AL  H++Y + +    E+  + C E+W    L RL YSCF  L  YF+PL   +  Y +I   L+ R            +++   ++ +T ++L+  VL FA  W P  I                    V+ I +       +T F      H   I       A  S   NPF+Y  L+      LC N       + +    H +Q     + R  RL+
Sbjct:   65 LHSTTNFLIGNLALVDLVMCLFCVPLTAFYAFDERGWVFGQFMCHFVTLMQTATVFAAVLSLTAIAVDRYVVVAYPIRRRGGRWFCGWLVVSIWLCALAMSTPTAL--HTVYLDLSETGHEM--AVCEEFWHGQELSRLIYSCFFLLLSYFVPLAAVSISYCAISCHLQHRATPRLMAATPSNQEKWGRKRRKTFRLLLVSVLSFAFSWLPLQI--------------------VNLIRDL------DTDFAILSKNHVNVIQVSCHLLAMSSACYNPFIYASLHKKFLSYLCHN-------MFQKRKAHCTQSSITTSSRMTRLN 353          
BLAST of NPYR-13 vs. Ensembl Zebrafish
Match: npy2rl (neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:ZDB-GENE-111115-4])

HSP 1 Score: 89.7373 bits (221), Expect = 5.294e-19
Identity = 77/278 (27.70%), Postives = 133/278 (47.84%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALF-THSIYTENNSLSIELETSYCAEYWP-YLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLK--MRTFKKRD-NVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLN 972
               VTN F+  LA++D+L+    +P    Y +  +  FG + C  +     + +++S++T+ +IA+DR+R I+Y L  R+SK T  +++ +  V+S + + P+A+F  + I   +   SIE+    C E WP        YS    L  Y LPL I ++ YI I+ +L+  +    + D + R+ +T K+L+ +V+ FAV W P+                +      H + +     L  T F             I+   +TF+   NP LYGW+N
Sbjct:   75 LRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLREWKFGQVLCFTLPYAQGLAVHVSTITLNVIALDRHRCIVYHLDTRMSKDTCFLVIAITWVVSAVLASPLAIFREYGIVDLSPDNSIEV----CGEKWPDSSTDSTLYSISTLLLQYVLPLAIISFAYIRIWSKLRNHVSPVGRNDRHHRRRKTTKMLVTMVVVFAVSWLPF-------------HAFQLAIDIDHSVLDMKDFRLLYTVF------------HIVAMCSTFA---NPLLYGWMN 320          
BLAST of NPYR-13 vs. Ensembl Zebrafish
Match: npy7r (neuropeptide Y receptor Y7 [Source:ZFIN;Acc:ZDB-GENE-040924-9])

HSP 1 Score: 88.5817 bits (218), Expect = 1.049e-18
Identity = 78/275 (28.36%), Postives = 137/275 (49.82%), Query Frame = 1
Query:  163 VTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPR--LCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDN---VRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLN 972
            VTN F+  LA++D+++    +P    Y + ++  FG + C +V    ++ +++S LT+ +IA++RYR I++ L +R+++ T+ I++ L    + + + P+A+F    Y E     I+L  + C+E WP    R  + YS  + L  Y +PL I +Y Y+ I+ +LK        N   VR+ +T K+L  +V+ FAV W P+                        H++   +S+L+    F       K I  +    A  S  +NP LYGW+N
Sbjct:   81 VTNYFIANLALADLMVDTVCLPFTLVYTLLDEWKFGAVMCHMVPYSQALSVHVSILTLTIIALERYRCIVFHLGQRLNRCTSFIIIGLTWAFAAILAGPLAIFREYRYEEIP--YIDLRIAVCSEKWPNGTNRDAVIYSLSMLLLQYVVPLAIISYAYVCIWIKLKNHVSPSNRNDGIVRRKKTTKMLALVVVVFAVCWLPF------------------------HMFQL-ASDLDLILKFK----EYKLIYTLFHIVAMCSTFVNPLLYGWMN 324          
BLAST of NPYR-13 vs. Ensembl Zebrafish
Match: PRLHR (si:dkey-202l22.3 [Source:ZFIN;Acc:ZDB-GENE-131127-471])

HSP 1 Score: 87.4261 bits (215), Expect = 3.419e-18
Identity = 60/206 (29.13%), Postives = 102/206 (49.51%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA-GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF-------KKRDNVRKLRTNKILIAIVLCFAVFW 744
             HN TN F+  LA  D+L+C   +P+   Y    +   FG   C ++  +    ++ S L++  IA+DRY ++ YP++ RIS      + + +  +S   + P +L  H+ Y +     +EL    C E+W      RL YSCF  L  Y +PL+  +  Y +I   L+  T        ++R + ++ +T  +L+A VL FA+ W
Sbjct:   69 LHNATNFFIGNLAAGDLLMCLSCVPLTASYAFDAQGWAFGRPMCHLIPLVQGATVFASVLSLTAIAMDRYVVVAYPVRRRISVWGCGAVALGVWAVSLALAAPPSL--HTRYVDLRPSGMELVV--CEEFWLGAERQRLLYSCFFLLASYMIPLLSVSISYCAISVHLRKHTLPGEPSQSQQRWSKQRRKTFSLLVASVLAFALCW 270          
BLAST of NPYR-13 vs. Ensembl Xenopus
Match: taf1b (TATA-box binding protein associated factor, RNA polymerase I, B [Source:Xenbase;Acc:XB-GENE-992275])

HSP 1 Score: 99.7525 bits (247), Expect = 2.929e-22
Identity = 83/310 (26.77%), Postives = 150/310 (48.39%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR---TFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYR 1080
             VTN F+  LAI+D+++ +F +P    Y + ++  FG++ C +     ++ + +S+LT+++IA+DRY  I++ L  RISK+ + +++ +  + + + +IP+A+F    Y +    +  L+ + CAE W      + YS  + +  Y LPL +  Y Y+ I+++LK     T +     R+  T K+L+ +V+ FAV W P+                        HI+   + +L  T   +      K +  I    A  S  +NPFLYGW+N + +      F     L  +N     S RG +  +R
Sbjct:   72 TVTNFFIANLAIADLMVDSFCLPFTLVYTLMDEWKFGSVLCHLFPYAQAMSVNVSTLTLIVIALDRYWCIVFHLNSRISKNLSFLIISITWITAAILAIPLAVFREFRYEDLPPFN--LKIAVCAENWTNRDSTI-YSLSMLILQYALPLAVICYAYLRIWFKLKNHISPTTRSESQQRRKNTTKMLVMMVVVFAVCWLPF------------------------HIFQL-AIDLEWTVAIH----ENKLLYTIFHVVAMCSTFVNPFLYGWMNKNYRHGFLTFFGCKDTL--QNSQPDGSLRGHSYTFR 347          
BLAST of NPYR-13 vs. Ensembl Xenopus
Match: ENSXETT00000044281.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:115219157:115249407:-1 gene:ENSXETG00000019365.1 transcript:ENSXETT00000044281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 1.013e-20
Identity = 88/306 (28.76%), Postives = 132/306 (43.14%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKR--------DNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSS---NLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIEN 1035
            HNVTN F+  LA SD+L+CA  +P    Y    +   FG   C  VF +  V +Y+S  T+  IAVDRY   ++PLK+RIS +T   +++ I ++S     P    T+ +  +    +I      C E+W      RL Y+    +  Y LPL   +  YI I  +LK R             D +RK +  ++++ +V  F + W P                         H++N       NL    +F    +H   I      FA  S   NPFLY WL+D  +  L + FT  R ++  N
Sbjct:   66 HNVTNFFIGNLAFSDMLMCATCVPFTLAYAFNPQGWVFGKFMCYFVFLMQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISVTTCIYVLMGIWLLSCALVGPAIAHTYHVEFQQEGFTI------CEEFWMGKETERLAYAYSTLIITYILPLSAVSLSYICITVKLKNRVVPGHPTQSQAEFDRLRKRKIFRLIVLVVTAFGICWLP------------------------IHVFNIIRDIDINLINKHYF----LH---IQLFCHWFAMSSSCCNPFLYAWLHDRFRSELRKMFTFKRKIIPTN 334          
BLAST of NPYR-13 vs. Ensembl Xenopus
Match: errfi1 (ERBB receptor feedback inhibitor 1 [Source:Xenbase;Acc:XB-GENE-1005334])

HSP 1 Score: 93.9745 bits (232), Expect = 1.903e-20
Identity = 84/296 (28.38%), Postives = 131/296 (44.26%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYL-LPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF--------KKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSS---NLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNF 1005
            HNVTN  V  LA SD+L+CA  +P+   Y    +   FG   C  VF +  V +Y+S  T+ +IAVDRY   +YPL+ R++  T   ++  I ++S + + P     H+ + E      +L+ S C E+W  +   RL Y+    +  Y LP II A  Y+ I  +LK R           + D  R+ +T ++L+ +V  F + W P                         HI+N       +L +  +FN        +  +    A  S   N  LY WL+DS +  L + F
Sbjct:   66 HNVTNFLVGNLAFSDMLMCATCVPLTLAYVFEPRGWVFGHFLCYFVFLMQPVTVYVSVFTLTVIAVDRYHATVYPLRRRLTIPTCAYILAGIWLLSCLMAAPA--LAHTYHVEFP----QLDFSICEEFWFGMEKKRLAYAYSTLILTYALPFIIIALSYLRISVKLKNRVVPGNITNVQAEWDRARRKKTFRLLVLVVGAFGMCWLP------------------------LHIFNIMKDIDIHLIDKQYFN-------LVQLLCHWLAMMSACTNSLLYAWLHDSFRGELKKMF 324          
BLAST of NPYR-13 vs. Ensembl Xenopus
Match: NPY2R (neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:100498351])

HSP 1 Score: 88.1965 bits (217), Expect = 3.606e-18
Identity = 79/281 (28.11%), Postives = 133/281 (47.33%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFT-HSIYTENNSLSIELETSYCAEYWPY--LLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDN----VRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLND 975
               VTN F++ LA+SD+++    +P    Y + +   FGT+ C +V     + + +S++T+++IA+DR+R I+Y L+ +IS     +++ +  V S + + P+A+F  +S+      +S + +   C+E WP   L     YS  + L  Y +PL I +Y YI I+ +LK        N     R+ +T K+L+A+V+ FAV W P+                        H +   S    +    N      K I  I    A  S   NP LYGW+N+
Sbjct:  104 MRTVTNFFIVNLAVSDLMVNTLCLPFTLVYTLLDDWKFGTVLCHLVTYSQGLAVQVSTVTLMVIALDRHRCIVYHLESKISTKICFMIIGITWVCSALLASPLAIFKEYSVIV----ISSDFQIQACSERWPVGDLNYGTIYSISMLLIQYIVPLAIISYAYIRIWTKLKNHVSPGGGNDHYHQRRRKTTKMLVAVVVVFAVCWLPF------------------------HAFQLASDIDGKVLDLN----EYKLIYTIFHVIAMCSTFANPLLYGWMNN 352          
BLAST of NPYR-13 vs. Ensembl Xenopus
Match: ENSXETT00000042620.1 (neuropeptide Y receptor type 4-like [Source:NCBI gene;Acc:100491805])

HSP 1 Score: 83.5741 bits (205), Expect = 6.702e-17
Identity = 89/330 (26.97%), Postives = 153/330 (46.36%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIEL----ETSYCAEYWPYLLPRLCYSCFVFLFHYFLPL--IITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGH--NSQRGDNKNYRFNRLDMKNNNFQEGS 1125
            NVT+I +  LA SD+L+CAF +P    Y + +   FG   CK+   L    + +S L ++LIA +RY++I++P   + S   A   V+L+ VI+++ + P+A       T N ++S  +    + S C E W      + Y+  + L  Y +PL  I+  YL IS++ + +   F + DN  + R N + + +V  FAV W P+ I+++          + W     HH        L    + N        I  +    A  S  +NP +YG LN ++K        R    L++N +G   +++    +  R+  L +K +    GS
Sbjct:   65 NVTHILIANLAFSDVLVCAFCLPFTAVYTVMDYWVFGLSLCKITNFLQCASVTVSVLILVLIAFERYQLILHPTGWKPSVLQAYAAVLLVWVIASLLAFPLASSMVLTDTPNKNISKVIGFLADKSVCVESWSSNQQLVAYTISLQLLQYIVPLCFILGCYLRISVHLKHRGAMFGRNDNHMR-RVNLMFVIMVGAFAVCWLPFHIFNII---------VDW-----HH-------QLIPVCYHN-------LIFSLCHLLAMISTCVNPVIYGLLNSNVK--------REVKALVQNCTGRKLDTRSAVEEPERY-PLSLKQSATLPGS 356          
BLAST of NPYR-13 vs. Ensembl Mouse
Match: Npffr2 (neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:MGI:1860130])

HSP 1 Score: 87.4261 bits (215), Expect = 4.396e-18
Identity = 74/263 (28.14%), Postives = 123/263 (46.77%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETS-------YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL---------KMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSP-WTIXXXXXXXXXXXXKMRWLQGYVH---HIYNFNSSNLNET--SFFN 876
             H VTN F+L LAISD+L+  F +PI     I     FG+  CK+   +  + +  S  T++ IAVDR+R ++YP K +++  TA + +++I  ++     P A+  H    E     + L +        +C E WP    R  Y+  +F   Y  PL +   +Y  I   L         K R  +   + +K +  K+L+ + L F + W P WT+  L   +    +K+R +  Y++   H   F +S++N     FFN
Sbjct:   76 MHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLH--VQEEKYYRVRLSSHNKTSTVYWCREDWPRHEMRRIYTTVLFATIYLAPLSLIVIMYARIGASLFKTAAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYTDLSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFN 336          
BLAST of NPYR-13 vs. Ensembl Mouse
Match: Npy6r (neuropeptide Y receptor Y6 [Source:MGI Symbol;Acc:MGI:1098590])

HSP 1 Score: 82.0333 bits (201), Expect = 2.136e-16
Identity = 72/212 (33.96%), Postives = 113/212 (53.30%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELET----SYCAEYWPYLLPRLCYSCFVFLFHYFLPL--IITAYLYISIYYRLKMRTFKKR-DNVRKL----RTNKILIAIVLCFAVFWSPWTI 759
             NVTNI +  L++SDIL+C   IP    Y + +   FG   CK+   + SV + +S  +++LIA++RY++I+ P   +   + A   +ILI +IS   SIP+ L  H      ++LS+  +       C E WP  L +L +S  +F+  YF+PL  I+  YL I +  R + R   +R +N  +L    R N +LI+IV+ F   W P  I
Sbjct:   68 QNVTNILIANLSLSDILVCVMCIPFTVIYTLMDHWVFGNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLISLTLSIPLFLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQYFVPLGFILICYLKIVLCLRKRTRQVDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNI 279          
BLAST of NPYR-13 vs. Ensembl Mouse
Match: Pgr15l (G protein-coupled receptor 15-like [Source:MGI Symbol;Acc:MGI:2676330])

HSP 1 Score: 79.337 bits (194), Expect = 2.114e-15
Identity = 87/306 (28.43%), Postives = 140/306 (45.75%), Query Frame = 1
Query:  142 KHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSL-SIELET-SYCAEYWPYLLPRLCYSCFV----FLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKL--------RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFR 1017
            KH      T + +  LAISDIL+   N P      ++ +  FG I C V        L++S+LT++ +A+DR+R+I++P+K R++ S    +V +I  I+   ++P     H+IY    +L +++ +T SYC   +P   P +  S +V    F+  Y LPL++    Y  +  RL ++      + R+L        ++ ++LI IVL FAV W P                   L  YV  I +    N +   F+                FA  S   NPF+Y WLN S +  L R+ + FR
Sbjct:   99 KHKEIKKSTGLLIFNLAISDILIILLNSPFALARFLSGQWVFGRIMCHVSRFAQYCSLHVSTLTLMAVAMDRHRVILHPMKPRLTHSQCLFVVAMIWSIAVFLALP-----HAIYQNLFTLVNMDGDTRSYCLPSFPG--PSILVSKYVDLGTFILLYILPLLVIVVTYSHLGKRLWIQNAIGDASARQLMAHYQKRKKSIRMLILIVLVFAVCWFP-------------------LNFYVVLISSAGVEN-DSVLFYA------------FHWFAMSSTCYNPFIYCWLNRSFRAKL-RSISSFR 364          
BLAST of NPYR-13 vs. Ensembl Mouse
Match: Npy4r (neuropeptide Y receptor Y4 [Source:MGI Symbol;Acc:MGI:105374])

HSP 1 Score: 78.5666 bits (192), Expect = 3.020e-15
Identity = 87/338 (25.74%), Postives = 149/338 (44.08%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFT--HSIYTENNSLSIEL--ETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR-------TFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGH-NSQRGDNKNYRFNRL--DMKNNNFQEGSEK 1131
            NVTN+ +  LA SD L+C    P+   Y I +   FG + CK++  +  + + +S L+++L+A++R+++II P   + S   A + +++I  +S   S+P    +  + ++  N+S  +E   +   C   W     RL Y+ F+ LF Y +PL      YI IY RL+ +           R    K R N +L+ +V  FAV W P                         H++N       E         H   I  +    A  S  +NPF+YG+LN         NF +    L+  L+ H  S RG++++   + +  D+   + + GS+ 
Sbjct:   74 NVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLPFLANSTLNDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQRLQRQKHVFHAHACSSRAGQMK-RINSMLMTMVTAFAVLWLPL------------------------HVFNTLEDWYQEAI----PACHGNLIFLMCHLLAMASTCVNPFIYGFLN--------INFKKDIKALV--LTCHCRSPRGESEHLPLSTVHTDLSKGSMRMGSKS 372          
BLAST of NPYR-13 vs. Ensembl Mouse
Match: Npy1r (neuropeptide Y receptor Y1 [Source:MGI Symbol;Acc:MGI:104963])

HSP 1 Score: 77.411 bits (189), Expect = 6.159e-15
Identity = 69/212 (32.55%), Postives = 110/212 (51.89%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTE----NNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL--------KMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTI 759
            NVTNI ++ L+ SD+L+    +P    Y + +   FG   CK+   +  V + +S  +++LIAV+R+++II P   R +   A I + +I V++  SS+P  ++   I T+    N SL+   +   C + +P    RL Y+  + +  YF PL      Y  IY RL        K+R  K R +  K R N +L++IV+ FAV W P TI
Sbjct:   72 NVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIY--QILTDEPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKIRDSKYRSSETK-RINIMLLSIVVAFAVCWLPLTI 280          
BLAST of NPYR-13 vs. UniProt/SwissProt
Match: sp|Q9VNM1|NPFR_DROME (Neuropeptide F receptor OS=Drosophila melanogaster OX=7227 GN=NPFR PE=1 SV=3)

HSP 1 Score: 102.834 bits (255), Expect = 4.284e-22
Identity = 88/305 (28.85%), Postives = 139/305 (45.57%), Query Frame = 1
Query:  151 VFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA---GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSL--SIELETS--YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR----------TFKKRDNVRKL-RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIK----EVLCR 999
            +     N+F+L LAISD+LLC   +P+ T  EI  K    G  +I CK +  L ++ +++S+++I  IA DRY++I+YP ++ +    A  ++  I  ++ + + P+ ++   I T+  +L   I L+ +  YC E WP    R  YS F     Y +P++I +  Y  IY +LK R            +K +  R++ RTN +LI+I + F V W P                              N  NL      +P          I       S   NP LYGWLND+ +    E+LCR
Sbjct:  116 IMRTARNLFILNLAISDLLLCLVTMPL-TLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLP-----------------------------LNFFNLYADMERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCR 390          
BLAST of NPYR-13 vs. UniProt/SwissProt
Match: sp|Q924H0|NPFF2_MOUSE (Neuropeptide FF receptor 2 OS=Mus musculus OX=10090 GN=Npffr2 PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 3.075e-17
Identity = 74/263 (28.14%), Postives = 123/263 (46.77%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETS-------YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL---------KMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSP-WTIXXXXXXXXXXXXKMRWLQGYVH---HIYNFNSSNLNET--SFFN 876
             H VTN F+L LAISD+L+  F +PI     I     FG+  CK+   +  + +  S  T++ IAVDR+R ++YP K +++  TA + +++I  ++     P A+  H    E     + L +        +C E WP    R  Y+  +F   Y  PL +   +Y  I   L         K R  +   + +K +  K+L+ + L F + W P WT+  L   +    +K+R +  Y++   H   F +S++N     FFN
Sbjct:   76 MHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLH--VQEEKYYRVRLSSHNKTSTVYWCREDWPRHEMRRIYTTVLFATIYLAPLSLIVIMYARIGASLFKTAAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYTDLSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFN 336          
BLAST of NPYR-13 vs. UniProt/SwissProt
Match: sp|Q9EQD2|NPFF2_RAT (Neuropeptide FF receptor 2 OS=Rattus norvegicus OX=10116 GN=Npffr2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.355e-16
Identity = 74/263 (28.14%), Postives = 123/263 (46.77%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETS-------YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL---------KMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSP-WTIXXXXXXXXXXXXKMRWLQGYVH---HIYNFNSSNLNET--SFFN 876
             H VTN F+  LAISD+L+  F +PI     I     FG+  CK+   +  + +  S  T++ IAVDR+R ++YP K +++  TA +++++I  ++     P A+  H    E     + L +        +C E WP    R  Y+  +F   Y  PL +   +Y  I   L         K R  +   + +K +  K+L+ + L F + W P WT+  L   +    +K+R +  YV+   H   F +S++N     FFN
Sbjct:   76 MHTVTNFFIFNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVMIVIIWGLAITIMTPSAIMLH--VQEEKYYRVRLSSHNKTSTVYWCREDWPNQEMRRIYTTVLFATIYLAPLSLIVIMYARIGASLFKTSAHSTGKQRLEQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYADLSPNKLRVINIYVYPFAHWLAFCNSSVNPIIYGFFN 336          
BLAST of NPYR-13 vs. UniProt/SwissProt
Match: sp|Q63447|NPY4R_RAT (Neuropeptide Y receptor type 4 OS=Rattus norvegicus OX=10116 GN=Npy4r PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.014e-15
Identity = 79/287 (27.53%), Postives = 127/287 (44.25%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPL--KERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIEL--ETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR-------TFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKE 987
            NVTN+ +  LA SD L+C    P+   Y I +   FG + CK++  +  + + +S L+++L+A++R+++II P   K  IS++   I+VI  +              + ++  N+S  +E   +   C   W     RL Y+ F+ LF Y +PL      Y+ IY RL+ +       T   R    K R N +L+A+V  FAV W P                         H++N       E         H   I  +   FA  S  +NPF+YG+LN + K+
Sbjct:   74 NVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVVIWFISCFLSLPFLANSILNDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCVPLAFILVCYMRIYQRLQRQRRAFHTHTCSSRVGQMK-RINGMLMAMVTAFAVLWLPL------------------------HVFNTLEDWYQEAI----PACHGNLIFLMCHLFAMASTCVNPFIYGFLNINFKK 331          
BLAST of NPYR-13 vs. UniProt/SwissProt
Match: sp|Q61212|NPY6R_MOUSE (Neuropeptide Y receptor type 6 OS=Mus musculus OX=10090 GN=Npy6r PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.494e-15
Identity = 72/212 (33.96%), Postives = 113/212 (53.30%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELET----SYCAEYWPYLLPRLCYSCFVFLFHYFLPL--IITAYLYISIYYRLKMRTFKKR-DNVRKL----RTNKILIAIVLCFAVFWSPWTI 759
             NVTNI +  L++SDIL+C   IP    Y + +   FG   CK+   + SV + +S  +++LIA++RY++I+ P   +   + A   +ILI +IS   SIP+ L  H      ++LS+  +       C E WP  L +L +S  +F+  YF+PL  I+  YL I +  R + R   +R +N  +L    R N +LI+IV+ F   W P  I
Sbjct:   68 QNVTNILIANLSLSDILVCVMCIPFTVIYTLMDHWVFGNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLISLTLSIPLFLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQYFVPLGFILICYLKIVLCLRKRTRQVDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNI 279          
BLAST of NPYR-13 vs. TrEMBL
Match: A0A193KUR5 (NPYR-13 OS=Schmidtea mediterranea OX=79327 GN=npyr-13 PE=2 SV=1)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 503/503 (100.00%), Postives = 503/503 (100.00%), Query Frame = 1
Query:   13 MEFNHAQQGSHRKFEFVYSISTLFSILTFXXXXXXXXXXXXXXKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNAGAIPSIFDMSTKRTSLYPSNNQRNPSHMSQDASNVNYESSFISNVPHNYTSSERRFTNESSDITLSNAKEIDVFTAMAIVVKQQTFDRSRRVSLAVESKRKPMTLLNRKTSL 1521
            MEFNHAQQGSHRKFEFVYSISTLFSILTFLGIALNLLIVLVILKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKSTATILVILIVVISTMSSIPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIYSLYLESYSYYSKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNAGAIPSIFDMSTKRTSLYPSNNQRNPSHMSQDASNVNYESSFISNVPHNYTSSERRFTNESSDITLSNAKEIDVFTAMAIVVKQQTFDRSRRVSLAVESKRKPMTLLNRKTSL
Sbjct:    1 MEFNHAQQGSHRKFEFVYSISTLFSILTFLGIALNLLIVLVILKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKSTATILVILIVVISTMSSIPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIYSLYLESYSYYSKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNAGAIPSIFDMSTKRTSLYPSNNQRNPSHMSQDASNVNYESSFISNVPHNYTSSERRFTNESSDITLSNAKEIDVFTAMAIVVKQQTFDRSRRVSLAVESKRKPMTLLNRKTSL 503          
BLAST of NPYR-13 vs. TrEMBL
Match: A0A193KUX0 (NPYR-14 OS=Schmidtea mediterranea OX=79327 GN=npyr-14 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.628e-55
Identity = 141/376 (37.50%), Postives = 214/376 (56.91%), Query Frame = 1
Query:   37 GSHRKFEFVYSISTLFSILTFXXXXXXXXXXXXXXKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFT---HSIYTENNSLSIELET---SYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL-KMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHH------IYNFNSSNLNETSFFN---------------PKNVHTKT-----------------------IDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTR 1011
             +HR  E  YS+  L++  +F+G   N+ +V+ +L+H    N+TNI++  LA+SDI LC+ N+PIQ YYEI+E +   +  C+++F+ F +PLYIS LTILLIA+DR+R+I+YPL  R+S++ A +LVI +++ S ++SIPVA++T    S Y E  SL+        +YC E WP    RL YS  +F  H+F+PL ++A LY+ IY  L + R FK+++  RK RTNKILI +V+ FA+ W+PW I+SL          +  +QGY+        +     S +  T+ F+               P +    T                       ID ILK +A  S ++NPFLYGWLN+ I+E +C+ + R
Sbjct:   58 SAHRISEVFYSLIFLYTSFSFIGFLFNVAVVIALLQHRALTNITNIYIFCLAMSDIFLCSANMPIQAYYEISENSNLSSSMCRILFSSFGLPLYISCLTILLIAIDRHRMIVYPLSRRMSRTKAVLLVISVIMFSLVNSIPVAVYTDINESEYIELLSLTSREGKQFPTYCIESWPTKTTRLIYSVLIFFLHFFVPLSVSAVLYVHIYICLNRRRLFKQKEVERKKRTNKILILVVILFAICWAPWCIFSL----------LLEVQGYIQQKPKTMPLKPIICSRIGNTTPFSTGMPILSTFSIPIKIPPHFGNSTQKLASKSIRKENHEFIEGSILKPIDLILKLWAMGSAIVNPFLYGWLNEPIRESMCKIWRR 423          
BLAST of NPYR-13 vs. TrEMBL
Match: U6JBI8 (Neuropeptide Y receptor OS=Echinococcus granulosus OX=6210 GN=EGR_04846 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 2.002e-55
Identity = 137/351 (39.03%), Postives = 198/351 (56.41%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALF---THSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMR----------WLQGYVHHIYNFNS--------------SNLNET-----SFFNPKNV-------------HTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCR---NFTRFRHLLIENLSGHNSQRG 1062
             HN+TN FVL LAISDI +  FN+P+Q YYE+ E+  F  + C++VF+ F +P++IS L IL+I +DRY II+YPL+ R+ + +A++ ++ I VIS +S IP+A+F   + ++    +     +E  YC E WP    RLCY+ F F   +FLPL++TA LY  IY+RL  R F+KRD  RK RTNKILIAIV+CF + W+PW ++S+ LE Y+Y ++ R            Q  +  + N  S               +LN +     SF    N+             H K ID ILK  A  S  +NP LYG + D+++ ++ R    F R R+L +  L G  S RG
Sbjct:   78 LHNITNRFVLALAISDIFMSGFNMPMQAYYEMQERVYFSNLACQLVFSTFGLPMHISCLVILVIGIDRYNIIVYPLRRRMPRGSASLTLVAIAVISVISVIPIAIFNKSSQAVTRLEDGQREPMEYHYCVEEWPSPEIRLCYTIFTFTVQFFLPLLLTATLYTRIYFRLHERRFRKRDLERKKRTNKILIAIVICFFICWTPWNVFSIILEVYAYRAQKRNPINLFPLFEGTQSNLSSVVNIKSLLLPSRDNNLVFIHEDLNASVRPPRSFERKYNISDIVPQSRLLLGGHAKIIDLILKLLAMCSGCLNPCLYGCMTDTMRLLMKRVTIRFQRTRNLSLTRLRG--SLRG 426          
BLAST of NPYR-13 vs. TrEMBL
Match: A0A087W0K9 (Neuropeptide receptor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000186600 PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 3.761e-55
Identity = 138/351 (39.32%), Postives = 197/351 (56.13%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIE---LETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMR----------WLQGYVHHIYNFNS--------------SNLNET-----SFFNPKNV-------------HTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCR---NFTRFRHLLIENLSGHNSQRG 1062
             HN+TN FVL LAISDI +  FN+P+Q YYE+ E+  F  + C++VF+ F +P++IS L IL+I +DRY II+YPL+ R+ + +A++ ++ I VIS +S IP+A+F  S       +  +   +E  YC E WP    RLCY+ F F   +FLPL++TA LY  IY+RL  R F+KRD  RK RTNKILIAIV+CF + W+PW ++S+ LE Y+Y ++ R            Q  +  + N  S               +LN +     SF    N+             H K ID ILK  A  S  +NP LYG + D+++ ++ R    F R R+L +  L G  S RG
Sbjct:   78 LHNITNRFVLALAISDIFMSGFNMPMQAYYEMQERVYFSNLACQLVFSTFGLPMHISCLVILVIGIDRYNIIVYPLRRRMPRGSASLTLVAIAVISVISVIPIAIFNKSSQAVTRLIDGQREPMEYHYCVEEWPSPEIRLCYTIFTFTVQFFLPLLLTATLYTRIYFRLHERRFRKRDLERKKRTNKILIAIVICFFICWTPWNVFSIILEVYAYRAQKRNPINLFPLFEGTQSNLSSVVNIKSLLLPSRDNNLVFIHEDLNASVQPPRSFERKYNISDIVPQSRLLLGGHAKIIDLILKLLAMCSGCLNPCLYGCMTDTMRLLMKRVTIRFQRTRNLSLTRLRG--SLRG 426          
BLAST of NPYR-13 vs. TrEMBL
Match: A0A193KUI8 (NPYR-16 OS=Schmidtea mediterranea OX=79327 GN=npyr-16 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.439e-53
Identity = 131/340 (38.53%), Postives = 199/340 (58.53%), Query Frame = 1
Query:   19 FNHAQQGSHRKFEFVYSISTLFSILTFXXXXXXXXXXXXXXKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNF----NSSNLNETSFFNPKNV----HTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRF 1014
            FN  +  S+R     Y +   +S++T +G+ +N+++ + + +  V  NVTN+FVL+L +SDI+LC  N PIQ +Y +          CK +F+ F VP+Y+SSL I+LI++DRY++I+YP K+RI+K  A   ++L+   S++S IPVA+F     T+N+ ++      YC E WP    RL YS F F   +F+PL+++  LY  IY  L+ RT  KRD  RK RTN++L  +V+CF + WSPW ++SL LE  ++   ++      +   N     N+S+      F   N+    HT  +D ILK  A FS  INP LYGW+ND I+E + R F  F
Sbjct:   37 FNRPEYASYRLNWVQYFMIFAYSLVTLIGLLINVIVFVALCRCRVLSNVTNLFVLSLTLSDIILCGVNSPIQIFYVLNRLTKIPDWACKFLFSCFGVPIYVSSLLIMLISIDRYKVILYPFKKRITKRRAFFEILLVFSYSSVSIIPVAMF-----TQNSPVTKSASFIYCMEKWPNKNLRLIYSIFTFFGQFFIPLLVSGILYRKIYCCLQRRTSMKRDIERKERTNRLLAGVVICFGMCWSPWCLFSLILEIIAF---LKISSADFNEAINVNMSRNTSSCKYIPIFKEPNLLLGPHTILVDLILKLVALFSACINPLLYGWMNDPIRESIRRVFNDF 368          
BLAST of NPYR-13 vs. Ensembl Cavefish
Match: prlh2r (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:103044274])

HSP 1 Score: 105.531 bits (262), Expect = 2.224e-24
Identity = 83/301 (27.57%), Postives = 139/301 (46.18%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF----------KKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRN-FTRFRH 1020
            H+ TN  +  LA++D+++C F +P+  +Y   E+   FG   C+ V  + +  ++ + L++  IAVDRY ++ YP++ R  +     LV+ I + + + S P AL  H++Y + ++    +  + C E+W    L RL YSCF  L  YF+PL      Y +I + L+ R            +++   ++ +T ++L+  VLCFA  W P  +                    V+ I +       +T F      H   I       A  S   NPF+Y  L+D     LCR+ F R RH
Sbjct:   68 HSTTNFLIGNLALADLVMCLFCVPLTVFYAFDERGWVFGHFMCRFVTLMQTATVFAAVLSLTAIAVDRYVVVAYPIRRRGGRHFCAGLVLGIWLCALVMSTPAAL--HTVYLDLSATGHHM--AVCEEFWQGQELGRLIYSCFFLLLSYFVPLAAVTISYCAISHHLRRRAGPGLMAAIPSNQEKWGRKRRKTFRLLLVSVLCFAFSWLPLQV--------------------VNLIRDL------DTDFIILSKNHINVIQVSCHLLAMSSACFNPFIYASLHDKFLAYLCRHMFQRGRH 338          
BLAST of NPYR-13 vs. Ensembl Cavefish
Match: prlhr2b (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:103046295])

HSP 1 Score: 98.2117 bits (243), Expect = 6.545e-22
Identity = 87/304 (28.62%), Postives = 129/304 (42.43%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA-GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPL--IITAYLYISIYYR------LKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIEN 1035
             HNVTN+F+  LA SD+L+C   +P    Y    +   FG   C +VF +  V +Y+S  T+  IAVDRY   ++PLK+RIS      ++  I ++S     P  + T+ +  E   L+I      C E+W      RL Y+    L  Y LPL  +  +YL IS+  R       + R   +    RK +  +++  +V  F V W P                          I+ FN     +    N +  H   I  +    A  S   NPFLY WL+D  +  L + FT  R + I  
Sbjct:   95 MHNVTNVFIGNLAFSDMLMCVTCVPFTLAYAFNPRGWTFGRFMCYLVFLVQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISMVACVYILSGIWLLSCTLVAPAVVHTYHVEFEGEDLTI------CEEFWLGQETERLVYAYSTLLITYILPLSAVCVSYLCISVKLRNCVAPGHRTRAQAEAQRARKRKIFRLVSLVVAAFGVCWLP--------------------------IHVFNVLRDIDIRLINKR--HFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKIFTCRRRIGIST 364          
BLAST of NPYR-13 vs. Ensembl Cavefish
Match: prlhr2b (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:103046295])

HSP 1 Score: 97.0561 bits (240), Expect = 1.397e-21
Identity = 87/304 (28.62%), Postives = 129/304 (42.43%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKA-GFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPL--IITAYLYISIYYR------LKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIEN 1035
             HNVTN+F+  LA SD+L+C   +P    Y    +   FG   C +VF +  V +Y+S  T+  IAVDRY   ++PLK+RIS      ++  I ++S     P  + T+ +  E   L+I      C E+W      RL Y+    L  Y LPL  +  +YL IS+  R       + R   +    RK +  +++  +V  F V W P                          I+ FN     +    N +  H   I  +    A  S   NPFLY WL+D  +  L + FT  R + I  
Sbjct:   77 MHNVTNVFIGNLAFSDMLMCVTCVPFTLAYAFNPRGWTFGRFMCYLVFLVQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISMVACVYILSGIWLLSCTLVAPAVVHTYHVEFEGEDLTI------CEEFWLGQETERLVYAYSTLLITYILPLSAVCVSYLCISVKLRNCVAPGHRTRAQAEAQRARKRKIFRLVSLVVAAFGVCWLP--------------------------IHVFNVLRDIDIRLINKR--HFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKIFTCRRRIGIST 346          
BLAST of NPYR-13 vs. Ensembl Cavefish
Match: npy7r (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103037035])

HSP 1 Score: 88.5817 bits (218), Expect = 9.133e-19
Identity = 78/275 (28.36%), Postives = 142/275 (51.64%), Query Frame = 1
Query:  163 VTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPR--LCYSCFVFLFHYFLPLIITAYLYISIYYRLK--MRTFKKRDNV-RKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLN 972
            VTN F+  LA++D+++    +P    Y + ++  FG + C +V    ++ +++S LT+ +IA++RYR I++ L +R+++ T+ I++ L    + + + P+A+F    Y E     I L  + C+E WP+   R  + YS  + L  Y  PL I +Y Y+ I+ +LK  +    + DN+ R+ +T K+L  +V+ FAV W P+                        H++   +S+L+    F    +   T+  I+   +TF+   NP LYGW+N
Sbjct:   80 VTNYFIANLALADLMVDTMCLPFTLAYTLLDEWKFGAVMCHMVPYAQALSVHVSILTLTVIALERYRCIVFHLGQRLTRCTSFIIITLTWAFAAILAGPLAIFREYRYEEIP--YINLRIAVCSEKWPHGTNRDAIIYSISMLLLQYVFPLGIISYAYVCIWVKLKNHVSPSNRNDNISRRKKTTKMLALVVVVFAVCWLPF------------------------HVFQL-ASDLDLVLKFKEYKL-LYTLFHIVAMCSTFT---NPLLYGWMN 323          
BLAST of NPYR-13 vs. Ensembl Cavefish
Match: npffr1 (neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8106])

HSP 1 Score: 85.5001 bits (210), Expect = 1.451e-17
Identity = 85/331 (25.68%), Postives = 144/331 (43.50%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVAL---FTHSIY---TENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFK---KRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEG 1122
              VTNIF+L LAISD+L+  F +PI     +     F  +TCK+   +    +  S  T++ IAV+R+R I+YP +++++   A I +  I  ++ +   P A+    +H  +    + ++ +  L T  C E WP    R  Y+  +F   Y  P+     L + +Y R+ ++ FK   +R   RK+R   +L+ + L F V W P                  W+   +    N +SS LN  + +     H           A F+  INP +YG+ N++ +      F +F   L+E            + YR      +N  F +G
Sbjct:   67 RTVTNIFILNLAISDLLVGIFCLPITLADNLVTGWPFDEVTCKMSGLIQGASVSASVFTLVAIAVERFRCIVYPFQQKLTLRQAIITIAFIWALAIIIMCPSAVTLTVSHDAFHFMVDRDNATYPLYT--CWEAWPDQSMRKIYTMVLFSHIYLAPVT----LIVIMYTRIALKLFKSPGRRVYRRKIRVVNMLLIVALLFTVSWLP-----------------LWIIILLTDYGNMSSSQLNVIAVYIFPFAH---------WLAFFNSSINPIVYGYFNENFRRGFQAAF-KFGLCLVEMPPQPTVAMAAGETYRRKGTWKRNRVFVDG 364          
BLAST of NPYR-13 vs. Ensembl Sea Lamprey
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 101.293 bits (251), Expect = 6.243e-24
Identity = 89/312 (28.53%), Postives = 138/312 (44.23%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYW-PYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF--------KKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSS---NLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNS 1053
            HNVTN+ +  LA SD+L+CA  +P+   Y    +   FG+  C  VF +  V +Y+S  T+ +IAVDRY + +YPL+ RI+    T   +L  +  T  ++      H+ Y E      E   + C E+W      RL Y+    +  Y LPL++ +  Y  I  +LK R           + D  R+ +T ++L+ +V  F+V W P                         HI+NF       L +  +FN        +  +   FA  S   NPF+Y WL+D  +  L + FT  R +   N +G  S
Sbjct:   53 HNVTNLLIGNLAFSDLLMCAMCVPLTLAYVFDARGWVFGSFMCYFVFLMQPVSVYVSVFTLTVIAVDRYIVTVYPLRRRIT--IPTCGYLLAAIWVTACALAAPALAHTYYCEFP----EQRMTICEEFWIGTERERLAYAYSTLVLTYGLPLLVISLSYFKISVKLKNRVVPGTVTQNQAEMDRARRRKTFRLLVLVVTAFSVCWLP------------------------LHIFNFLRDVDIRLIDKYYFN-------LVQLLCHWFAMSSACYNPFIYAWLHDRFRSELKKMFTVKRRVAPSNNTGMAS 327          
BLAST of NPYR-13 vs. Ensembl Sea Lamprey
Match: npy8br (neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-GENE-980526-208])

HSP 1 Score: 73.9442 bits (180), Expect = 1.235e-14
Identity = 77/300 (25.67%), Postives = 130/300 (43.33%), Query Frame = 1
Query:  142 KHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTE-----NNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL----KMRTFKKRDNVRKLRT------NKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNS-SNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVL 993
            +H   HNVTNI ++ LA SD+L+    +P+   Y + +   FG   CK    L    + +S  +++LIA++R+++II P   + S + A + +  I V +   S P   F H +  E     ++      E   C E WP    +  ++  + +F +  PL+     Y+ I+ RL    KM    +      +R       N +L+AIV  FA+ W P                          +Y FN+ S+ N T   + ++     I  +    A  S  INP  YG+LN++ ++ L
Sbjct:   65 RHSELHNVTNILIVNLAFSDMLVGLVCLPLTIAYTLMDHWIFGEALCKGSPFLQCSAVSVSIFSLVLIAIERHQLIINPTGWKPSLNHAYVAIGAIWVTAFAMSSPFLAF-HVLTDEPYRNLSHYFPDYGEKVACIELWPSDTSKFAFTTSLLVFQFSCPLLFVFLCYLRIFLRLRQRKKMLPTGREGGGNGVRASHMKKINMMLVAIVAGFAICWLP--------------------------LYAFNAVSDWNPTLLLHCQH---DLIFSLCHLTAMLSICINPIFYGFLNNNFQKEL 334          
BLAST of NPYR-13 vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 73.559 bits (179), Expect = 1.701e-14
Identity = 72/303 (23.76%), Postives = 128/303 (42.24%), Query Frame = 1
Query:  160 NVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFT--------HSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL------------------KMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSP-WTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKE 987
             VTN+F+L LA+SD+L+  F +PI     +     FG + CK+   +    +  S  T++ IAVDR+R I+YP K ++  S A   +++I  ++     P AL          + +Y++ ++ +  L    C E WP    R  Y+  +F   Y  PL +   +Y  I +RL                             R+++  K+LI + + F + W P WT+  L   +      + +L  YV+ + ++        +FFN                      +NP +YG+ N++ + 
Sbjct:   82 TVTNLFILNLAVSDLLVGIFCMPITLVDNLITGWPFGVVVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFKRKLRISHALFTILVIWALALSIMCPSALMLTAEVSRGHYMVYSDGSNDTHPLHQ--CWEAWPDPRMRKAYTTVLFANVYLAPLALILLMYARIGFRLCSLSASAAAAASAAAPSRGGGGGATGVTRRRVKVIKMLIIVAMLFMLSWLPLWTVMMLVDYANLSPWDLAFLNMYVYPVAHW-------LAFFNSS--------------------VNPIVYGYFNENFRR 355          
BLAST of NPYR-13 vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 72.4034 bits (176), Expect = 4.218e-14
Identity = 58/213 (27.23%), Postives = 103/213 (48.36%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALF-THSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRT--------FKKRDNVRKL-----RTNKILIAIVLCFAVFWSP 750
             H V N+FV +LA+SD+++  F IPI            G   CK+V  +    +  S LT+  IAV+R++ I++PL+ R   +TA    +L  V      +   +F  H++    + L  ++  + C+E W +   R  Y+  + L  + LPL+    LY  + + L ++T          +R  + K+     R  K+++ +V+ FAV W+P
Sbjct:   76 LHTVANVFVCSLAVSDLMITVFCIPITLMQNFFSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARAASMLCGVWLVGLCVAAPMFYAHTVQVTYDVLY-DVSHTGCSEQWSHAEHRQAYTTTLLLVTFVLPLLTMTALYTRLAHELWVKTRVHDAVFNALQRSEINKITRSKKRAVKMMVIVVILFAVCWAP 287          
BLAST of NPYR-13 vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 72.0182 bits (175), Expect = 5.547e-14
Identity = 57/211 (27.01%), Postives = 104/211 (49.29%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLL-PRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRT----------FKKRDNVRKLRTNKILIAIVLCFAVFWSP 750
             HN TN  +  LA+SD+L+C   +PI   +    +   +G + C +V  L    +++S L++  IA+DRY ++ YP++ R++  +  +    I + S   + P AL  +++Y +  +     E   C E W  L   RL YSC + +  Y LPL+  +  Y +I   L+ R            ++  + ++ +T ++L+  V  FA+ W P
Sbjct:   98 LHNATNFLLGNLALSDLLVCLTCVPISAAFAFEPRGWVYGALLCYLVALLQPATVHVSVLSLTAIALDRYVVVAYPIRRRVAVRSCALTAGFIWIASAALACPAAL--NTVYIDFRT----EEPQVCEELWTGLEDQRLAYSCAMMIVSYLLPLLAVSASYCAISLTLRGRVPPGGAHCTVNARRTWHQKRRKTFRLLVMSVGTFALCWLP 302          
BLAST of NPYR-13 vs. Ensembl Nematostella
Match: EDO40944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q4])

HSP 1 Score: 77.7962 bits (190), Expect = 4.637e-16
Identity = 62/194 (31.96%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCA----FNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRD----NVRKLRTNKIL 711
               VTN FVL LAI+D+ L      F+IP+Q   E+     +G   CK+++ L ++ L+ S  T+  +++ RY  I++PL++++S    +    +IV I  +S IPV+ +++ +  E+ SLS       C E W     R  Y+  +F+F Y LPL + A  YI I   L+ R  + R     +V    T K+L
Sbjct:   24 MKTVTNYFVLNLAIADLALTCICIPFDIPVQ---EMNYVWPYGGFMCKILYPLQTLSLFASVFTLTAVSLTRYWAIVHPLRQQLS---VSNSKRIIVAIWVISIIPVSPYSYVLSHEDGSLS-------CEENWGDTSMRKVYTAVLFMFQYVLPLTVIAGAYIGIGIELRKRQTRDRSGGLRDVHAEETRKVL 204          
BLAST of NPYR-13 vs. Ensembl Nematostella
Match: EDO36473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH8])

HSP 1 Score: 75.8702 bits (185), Expect = 2.380e-15
Identity = 57/185 (30.81%), Postives = 93/185 (50.27%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCA----FNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLR 696
               VTN F+L LA++D+ L      F+IP+Q   E+     +G + CKV++ L ++ L+ S  T+  + + RY  I++P+K ++S + + +++  I + S +   P A          NSL    ET  C EYW     R  ++  +F+F Y LPL +    Y +I   L+ R   K  N  KLR
Sbjct:   38 MKTVTNYFILNLAVADLALTCICIPFDIPVQ---EMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVGLTRYWAIVHPMKRQLSITQSKLVIAFIWLGSVVPVFPYA----------NSLKFTRETHTCEEYWSSKKVREIFTAVIFVFQYVLPLGVIGTAYAAIGRELRRRKATKSGN-HKLR 208          
BLAST of NPYR-13 vs. Ensembl Nematostella
Match: EDO36453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH9])

HSP 1 Score: 75.485 bits (184), Expect = 5.236e-15
Identity = 62/204 (30.39%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCA----FNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF-----KKRDNVRKLRTNKILIAIVLCFAV 738
               VTN F+L LA++D+ L      F+IP+Q   E+     +G + CKV++ L ++ L+ S  T+  +++ RY  I++PL++++S    +    L++ I  +S +PVA +        NSLS    + YC E W     R  Y+  +F F Y +PL I A  Y SI   L  RT      + + +    +  ++L+ + L FAV
Sbjct:   66 MKTVTNYFILNLAVADLALTCICIPFDIPVQ---EMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLS---VSKAKTLVIAIWVLSLLPVAPYM-------NSLSYVPHSKYCEENWDNHNARKGYTASLFAFQYVIPLTIIATAYCSITRELSRRTIESACVRNQQHKETKKVVRMLMIVTLLFAV 256          
BLAST of NPYR-13 vs. Ensembl Nematostella
Match: EDO46084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR06])

HSP 1 Score: 75.485 bits (184), Expect = 8.152e-15
Identity = 67/210 (31.90%), Postives = 116/210 (55.24%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDI---LLC-AFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETS-YCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLK----MRTFK------KRDNVRKLRTNKILIAIVLCFAV 738
               VTN F+L LAI+D+   L+C  F+IP+Q   E   K  +G   CK+++ L ++ ++ S  T++ ++++R+  I+YPL++ +SKS ATI++ILI  IS+  ++P                +EL+    C+E WP    R  Y+  +F+  Y LPL + A+ Y+ I + L+     RT        K+++ RK+   ++LI + L FA+
Sbjct:   66 MRTVTNYFILNLAIADLAITLICIPFDIPVQ---ENGYKWPYGAFMCKIMYPLQTMCMFASIFTLVAVSLNRFWAIVYPLRQEMSKSQATIIIILIWFISSGLTVPYVTV------------LELKNGDDCSESWPEPGYRKAYTACIFVVQYLLPLTLIAFAYLKIGFELRKCVGTRTANSALERAKQEDTRKVV--RMLIIVTLLFAM 258          
BLAST of NPYR-13 vs. Ensembl Nematostella
Match: EDO27481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T950])

HSP 1 Score: 73.559 bits (179), Expect = 1.932e-14
Identity = 62/204 (30.39%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCA----FNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTF-----KKRDNVRKLRTNKILIAIVLCFAV 738
               VTN F+L LA++D+ L      F+IP+Q   E+     +G + CKV++ L ++ L+ S  T+  +++ RY  I++PL++++S    +    L++ I  +S +PVA +        NSLS    + YC E W     R  Y+  +F F Y +PL I A  Y SI   L  RT      + + +    +  ++L+ + L FAV
Sbjct:   34 MKTVTNYFILNLAVADLALTCICIPFDIPVQ---EMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLS---VSKAKTLVIAIWVLSLLPVAPYM-------NSLSYVPHSKYCEENWDNHNARKGYTASLFAFQYVIPLTIIATAYCSITSELSRRTIESACVRNQQHKETKKVVRMLMIVTLLFAV 224          
BLAST of NPYR-13 vs. Ensembl Medaka
Match: npy7r (PRELI domain-containing protein 1, mitochondrial [Source:NCBI gene;Acc:101174272])

HSP 1 Score: 108.612 bits (270), Expect = 1.474e-25
Identity = 77/275 (28.00%), Postives = 138/275 (50.18%), Query Frame = 1
Query:  163 VTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPR--LCYSCFVFLFHYFLPLIITAYLYISIYYRLK--MRTFKKRDNV-RKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLN 972
            VTN F+  LA++D+L+    +P    Y + ++  FG + C +V    ++ +++S LT+ +IA++RYR I++ L  R++  ++ +++     +S + + P+A+F    Y +    SI L  + C+E WP+   R  + YS F+ L  Y +PL + +Y YI I+ +LK  +    + DN+ R+ +T K+L  +V+ FA  W P+                        H++   +S+L+    F       K I  +    A  S   NP LYGW+N
Sbjct:   78 VTNFFIANLALADLLVNTLCLPFTLVYTLLDEWKFGAVLCHMVPFAQALSVHVSILTLTVIALERYRCIVFHLGRRLTWHSSLLIMAFTWTVSAVLAAPLAIFRE--YRQEEIPSINLRIAVCSEKWPHGTSRDGVIYSLFMLLLQYIIPLAVISYAYICIWVKLKNHISPSSRNDNINRRKKTTKMLALVVVVFATCWLPF------------------------HVFQL-ASDLDLVLRFE----EYKFIYTVFHVVAMCSTFANPLLYGWMN 321          
BLAST of NPYR-13 vs. Ensembl Medaka
Match: ENSORLT00000019392.2 (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:101157262])

HSP 1 Score: 105.531 bits (262), Expect = 2.824e-24
Identity = 88/321 (27.41%), Postives = 143/321 (44.55%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYL-LPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKL------------RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSS-NLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKN 1074
            H+ TN  +  LA+ D+++C F +P+   Y    +   FG   C  V  + S  +Y + L+++ IAVDRY I+ YP+++R        LV++I + S   S P+AL  H++Y + ++  +E+    C E+W      RL YSCF+ LF YF+PL   +  Y +I Y LK RT        +L            +T  +L+A VLCFA  W P  +                    V+ I + ++  ++   ++ N   V    +     C+       NPF+Y  L++     LC +F   R        G    RG   +
Sbjct:   88 HSTTNFLISNLALVDLVMCVFCVPLTASYAFDRRGWVFGYHMCHFVAIMQSAAVYAAVLSLMAIAVDRYIIVAYPIRKRAGCKFCWGLVVVIWLSSLGLSSPIAL--HTVYLDLHAAGLEMAV--CEEFWDGQERGRLIYSCFILLFSYFVPLAAVSISYCAISYHLKQRTMSGLTACLELRSARASWSRRRRKTFCLLLASVLCFAFSWLPLQV--------------------VNLIRDLDTDFSILGKNYVNVIQVSAHLLAMSSACY-------NPFIYASLHNKFLSCLCLHFLSQRR-------GKGKYRGQGSS 370          
BLAST of NPYR-13 vs. Ensembl Medaka
Match: ENSORLT00000035956.1 (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:101157262])

HSP 1 Score: 105.531 bits (262), Expect = 3.053e-24
Identity = 88/321 (27.41%), Postives = 143/321 (44.55%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAG-FGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYL-LPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKL------------RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSS-NLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKN 1074
            H+ TN  +  LA+ D+++C F +P+   Y    +   FG   C  V  + S  +Y + L+++ IAVDRY I+ YP+++R        LV++I + S   S P+AL  H++Y + ++  +E+    C E+W      RL YSCF+ LF YF+PL   +  Y +I Y LK RT        +L            +T  +L+A VLCFA  W P  +                    V+ I + ++  ++   ++ N   V    +     C+       NPF+Y  L++     LC +F   R        G    RG   +
Sbjct:  102 HSTTNFLISNLALVDLVMCVFCVPLTASYAFDRRGWVFGYHMCHFVAIMQSAAVYAAVLSLMAIAVDRYIIVAYPIRKRAGCKFCWGLVVVIWLSSLGLSSPIAL--HTVYLDLHAAGLEMAV--CEEFWDGQERGRLIYSCFILLFSYFVPLAAVSISYCAISYHLKQRTMSGLTACLELRSARASWSRRRRKTFCLLLASVLCFAFSWLPLQV--------------------VNLIRDLDTDFSILGKNYVNVIQVSAHLLAMSSACY-------NPFIYASLHNKFLSCLCLHFLSQRR-------GKGKYRGQGSS 384          
BLAST of NPYR-13 vs. Ensembl Medaka
Match: npy8br (neuropeptide Y receptor type 1 [Source:NCBI gene;Acc:101167799])

HSP 1 Score: 99.7525 bits (247), Expect = 1.814e-22
Identity = 85/301 (28.24%), Postives = 140/301 (46.51%), Query Frame = 1
Query:  142 KHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPL--KERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYT---ENNSLSIEL-ETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMR---TFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFR 1017
            +H   HNVTNI +  L+ SDIL+C   +P+   Y + +    G   CK+   +  + + +S  +++LIA++RY++I++P   K  +S+S   + V  IV         V   ++S+ T   +N S+ I + E   C E WP +  R  Y+  + +F YFLPL +    Y+ IY RLK R     + R N    R N +L +IV+ FA+ W P  I+                    + ++++N   +       P   H   I       A  S  +NP +YG+LN + ++ L     R R
Sbjct:   59 QHKEMHNVTNILIANLSFSDILMCIICLPVTIIYTLMDHWILGDALCKLTPFIQCISVTVSIFSLVLIAMERYQLIVHPTGWKPLVSQSYLAVAVTWIVACLIS----VPFLSYSVLTFPFQNLSIPIPVSEQLVCMEMWPTVQGRRAYTTSLLVFQYFLPLSLILICYLQIYLRLKRRKDMVERGRKNKGSARINAMLFSIVVAFALSWLPLNIF--------------------NTVFDWNHDVI-------PTCGH-DIIFSFCHLMAMVSTCVNPIIYGFLNSNFQKQLKSTVLRCR 327          
BLAST of NPYR-13 vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 88.9669 bits (219), Expect = 1.012e-18
Identity = 84/356 (23.60%), Postives = 152/356 (42.70%), Query Frame = 1
Query:  154 FHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALF-THSIYTENNSLSIELETSYCAEYWPYL-LPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRK----------LRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNA 1185
               VTN F+  LA++D+L+    +P    Y +  +  FG+  C ++     + +++S++T+ +IA+DR+R I+Y L+ R+ K     ++ L  V+S + + P+A+F  +  +T     +I++    C E WP        YS  + +  YFLPL I ++ Y  I+ +L+                       +T K+L+ +V+ FAV W P+  + L  +  +    MR          +F                  + +  I    A  S   NP LYGW+N + +      F                +RG ++  R  RLDM +     G  +A  ++    +  + HL+A
Sbjct:   93 LRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGEWKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQV----CTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSSAGSERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDIDNKVLDMR----------DF------------------RLLYTIFHVVAMCSTFANPLLYGWMNRNYRAAFLAVF--------------KCRRGADRG-RSGRLDMVHPINGGGGGRAKKIVLETQEAVSAHLDA 401          
BLAST of NPYR-13 vs. Planmine SMEST
Match: SMESG000028179.1 (SMESG000028179.1)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 503/503 (100.00%), Postives = 503/503 (100.00%), Query Frame = 1
Query:   13 MEFNHAQQGSHRKFEFVYSISTLFSILTFXXXXXXXXXXXXXXKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNAGAIPSIFDMSTKRTSLYPSNNQRNPSHMSQDASNVNYESSFISNVPHNYTSSERRFTNESSDITLSNAKEIDVFTAMAIVVKQQTFDRSRRVSLAVESKRKPMTLLNRKTSL 1521
            MEFNHAQQGSHRKFEFVYSISTLFSILTFLGIALNLLIVLVILKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKSTATILVILIVVISTMSSIPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIYSLYLESYSYYSKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNAGAIPSIFDMSTKRTSLYPSNNQRNPSHMSQDASNVNYESSFISNVPHNYTSSERRFTNESSDITLSNAKEIDVFTAMAIVVKQQTFDRSRRVSLAVESKRKPMTLLNRKTSL
Sbjct:    1 MEFNHAQQGSHRKFEFVYSISTLFSILTFLGIALNLLIVLVILKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKSTATILVILIVVISTMSSIPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIYSLYLESYSYYSKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHNSQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNAGAIPSIFDMSTKRTSLYPSNNQRNPSHMSQDASNVNYESSFISNVPHNYTSSERRFTNESSDITLSNAKEIDVFTAMAIVVKQQTFDRSRRVSLAVESKRKPMTLLNRKTSL 503          
BLAST of NPYR-13 vs. Planmine SMEST
Match: SMESG000072379.1 (SMESG000072379.1)

HSP 1 Score: 206.453 bits (524), Expect = 1.885e-59
Identity = 141/376 (37.50%), Postives = 214/376 (56.91%), Query Frame = 1
Query:   37 GSHRKFEFVYSISTLFSILTFXXXXXXXXXXXXXXKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFT---HSIYTENNSLSIELE---TSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRL-KMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHH------IYNFNSSNLNETSFFN---------------PKNVHTKT-----------------------IDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTR 1011
             +HR  E  YS+  L++  +F+G   N+ +V+ +L+H    N+TNI++  LA+SDI LC+ N+PIQ YYEI+E +   +  C+++F+ F +PLYIS LTILLIA+DR+R+I+YPL  R+S++ A +LVI +++ S ++SIPVA++T    S Y E  SL+        +YC E WP    RL YS  +F  H+F+PL ++A LY+ IY  L + R FK+++  RK RTNKILI +V+ FA+ W+PW I+SL          +  +QGY+        +     S +  T+ F+               P +    T                       ID ILK +A  S ++NPFLYGWLN+ I+E +C+ + R
Sbjct:   58 SAHRISEVFYSLIFLYTSFSFIGFLFNVAVVIALLQHRALTNITNIYIFCLAMSDIFLCSANMPIQAYYEISENSNLSSSMCRILFSSFGLPLYISCLTILLIAIDRHRMIVYPLSRRMSRTKAVLLVISVIMFSLVNSIPVAVYTDINESEYIELLSLTSREGKQFPTYCIESWPTKTTRLIYSVLIFFLHFFVPLSVSAVLYVHIYICLNRRRLFKQKEVERKKRTNKILILVVILFAICWAPWCIFSL----------LLEVQGYIQQKPKTMPLKPIICSRIGNTTPFSTGMPILSTFSIPIKIPPHFGNSTQKLASKSIRKENHEFIEGSILKPIDLILKLWAMGSAIVNPFLYGWLNEPIRESMCKIWRR 423          
BLAST of NPYR-13 vs. Planmine SMEST
Match: SMESG000064757.1 (SMESG000064757.1)

HSP 1 Score: 195.282 bits (495), Expect = 4.676e-56
Identity = 157/417 (37.65%), Postives = 240/417 (57.55%), Query Frame = 1
Query:    7 LFMEFNHAQQ--GSHRKFEFVYSISTLFSILTFXXXXXXXXXXXXXXKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELET-----SYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKM-RTFKKRDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYN---FNSSNLNETSF------------------FNPKNVH----TKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNF-TRF-RHLLIENLS-GHNSQRGDNKNYRFNRLDMKNNNFQE--GSEKANLL 1143
            LF+  ++ Q    +HR  E  +++  L+S ++ +G   NL +++ +LKH    N+TNI++L LA+SDI+LC+FN+P+QTYYEI+E A   T  C+++F  F +P+Y+SSL ILLIA+DR+++I++PL +RI+   A  LV+++++ S  SSIPVA++T S + ++  L + +        YC E WP    RL YS   F   +  PL+IT+ LY+ IY  L   R ++K +  RK RTNK+L  +V+ F V WSPW IYSL LE YSY+  +  ++  +  I      +SS+L + S                    N  N+     TK +D +LK  A  S V+NPFLYGWLN+SI+  + R    RF R    EN S   N+ R +++N  F    +     ++    EK+NLL
Sbjct:   52 LFISKSYLQPIFSTHRVKEIYFTLIFLYSFVSVVGFIFNLTVIVALLKHKTLINITNIYILCLALSDIVLCSFNVPMQTYYEISELANLQTNQCRLLFTSFGIPMYVSSLIILLIAIDRHQMIVHPLNKRITPLKAVFLVLIVLIFSIFSSIPVAMYTISDFVDHFKLFVNISNIPAFPKYCTESWPDNNLRLTYSITTFFILFLCPLLITSGLYVHIYNSLNTKRIYRKNETSRKKRTNKVLSLVVVMFGVCWSPWCIYSLLLEIYSYFYPILKIENTLLKILCQRILDSSSLRQISVNLSFSIANHSQTIDSVVERNQANLMDGRATKAVDMVLKLIAMGSAVVNPFLYGWLNESIRLSMMRLIHPRFLRIFWKENESCSLNTSRVNSENRTFGLTIIHRTTRRKYINQEKSNLL 468          
BLAST of NPYR-13 vs. Planmine SMEST
Match: SMESG000001731.1 (SMESG000001731.1)

HSP 1 Score: 155.221 bits (391), Expect = 7.462e-43
Identity = 122/321 (38.01%), Postives = 180/321 (56.07%), Query Frame = 1
Query:   43 HRKFEFVYSISTLFSILTFXXXXXXXXXXXXXXKHCVFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKKRDNVRKL------RTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTK-TIDQILKCFATFSCVINPFLYGWLNDSIK 984
            H  +E +  + +L+ +L F G+ LN+ +  ++L   ++ N+TN  +L LA SDILLC    P+QT YE+ +K       CK+VFA F +PLYIS LT+LLIA+DRYR+I++PL  ++++  A I V  I++ S ++ IPVA +   +  ++ +       SYC E W   L R+ YS  V +F   +PL  T +LY  IY  L+      R    KL      RTN IL   V+C  + W PWT+YSL LE   Y S  +     + HIY+ N S  +   F +P + H   ++D  LK  +  S  INP LYGW+N+SI+
Sbjct:   10 HVSYEVI--LLSLYGLLIFAGLILNVSLASILLYRKLYTNITNCLILILAFSDILLCGICTPLQTLYEVFKKLPLNDWICKIVFAFFGMPLYISCLTVLLIAIDRYRMILHPLLPKMNRKCAVICVSGIILFSIVNCIPVAYYMEFMELKDGT------QSYCPETWSSPLIRIIYSIHVPIFLVMIPLFSTTFLYYRIYAGLRRSRSNPRIRRSKLNERRSNRTNAILFCNVICIILCWLPWTLYSLILEINIYRSDPKSTYEPI-HIYSHNVSIGSLDGFDHPNSFHHLFSVDLYLKMLSMLSTCINPILYGWINNSIR 321          
BLAST of NPYR-13 vs. Planmine SMEST
Match: SMESG000066072.1 (SMESG000066072.1)

HSP 1 Score: 109.768 bits (273), Expect = 5.144e-26
Identity = 99/330 (30.00%), Postives = 157/330 (47.58%), Query Frame = 1
Query:  157 HNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFALFSVPLYISSLTILLIAVDRYRIIIYPLKERISKXXXXXXXXXXXXXXXXXXXPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYFLPLIITAYLYISIYYRLKMRTFKK------------RDNVRKLRTNKILIAIVLCFAVFWSPWTIXXXXXXXXXXXXKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKTIDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRH---LLIENLSG--HNSQRGDNKNYRFNRLD 1095
            + VTN F+  LA SDIL+C   +P        E      + CK++    ++ +Y+S+LT L+I++DRY +I+YP K R+  S    L++LI  ++ ++S P+A +      EN+ L      S C E WP    +  Y+   F+  + LP I  ++ Y  I   L+ R  +K             D  RK +TNK+LIA+V+ F V W P  +               W+      IY+   S LN        N++  TI  I    A  S + NPFLYGW+N++ ++  C  F+ +R    LLIE  S    NS++    +Y  + ++
Sbjct:   59 YTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKK---ENDVLR---NISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRKLSKKIKSLSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVL--------------WI--ITDLIYSDEQSKLNT-------NLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIE 359          
The following BLAST results are available for this feature:
BLAST of NPYR-13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFFR29.157e-1627.27neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR21.274e-1527.27neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR21.775e-1527.27neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPY1R4.821e-1531.75neuropeptide Y receptor Y1 [Source:HGNC Symbol;Acc... [more]
NPY2R6.075e-1425.38neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-24.297e-1825.53NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-25.021e-1825.53NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-25.203e-1825.53NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-38.236e-1424.07NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-13.742e-1321.62NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFR3.926e-2328.85gene:FBgn0037408 transcript:FBtr0308318[more]
NPFR4.273e-2328.85gene:FBgn0037408 transcript:FBtr0078590[more]
NPFR5.774e-2226.50gene:FBgn0037408 transcript:FBtr0308317[more]
NPFR6.747e-2226.50gene:FBgn0037408 transcript:FBtr0308316[more]
sNPF-R5.257e-1725.07gene:FBgn0036934 transcript:FBtr0332667[more]
back to top
BLAST of NPYR-13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prlh2r2.850e-2125.77prolactin releasing hormone 2 receptor [Source:ZFI... [more]
prlh2r2.850e-2125.77prolactin releasing hormone 2 receptor [Source:ZFI... [more]
npy2rl5.294e-1927.70neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:... [more]
npy7r1.049e-1828.36neuropeptide Y receptor Y7 [Source:ZFIN;Acc:ZDB-GE... [more]
PRLHR3.419e-1829.13si:dkey-202l22.3 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf1b2.929e-2226.77TATA-box binding protein associated factor, RNA po... [more]
ENSXETT00000044281.11.013e-2028.76pep primary_assembly:Xenopus_tropicalis_v9.1:3:115... [more]
errfi11.903e-2028.38ERBB receptor feedback inhibitor 1 [Source:Xenbase... [more]
NPY2R3.606e-1828.11neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:1... [more]
ENSXETT00000042620.16.702e-1726.97neuropeptide Y receptor type 4-like [Source:NCBI g... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npffr24.396e-1828.14neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:... [more]
Npy6r2.136e-1633.96neuropeptide Y receptor Y6 [Source:MGI Symbol;Acc:... [more]
Pgr15l2.114e-1528.43G protein-coupled receptor 15-like [Source:MGI Sym... [more]
Npy4r3.020e-1525.74neuropeptide Y receptor Y4 [Source:MGI Symbol;Acc:... [more]
Npy1r6.159e-1532.55neuropeptide Y receptor Y1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of NPYR-13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VNM1|NPFR_DROME4.284e-2228.85Neuropeptide F receptor OS=Drosophila melanogaster... [more]
sp|Q924H0|NPFF2_MOUSE3.075e-1728.14Neuropeptide FF receptor 2 OS=Mus musculus OX=1009... [more]
sp|Q9EQD2|NPFF2_RAT1.355e-1628.14Neuropeptide FF receptor 2 OS=Rattus norvegicus OX... [more]
sp|Q63447|NPY4R_RAT1.014e-1527.53Neuropeptide Y receptor type 4 OS=Rattus norvegicu... [more]
sp|Q61212|NPY6R_MOUSE1.494e-1533.96Neuropeptide Y receptor type 6 OS=Mus musculus OX=... [more]
back to top
BLAST of NPYR-13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUR50.000e+0100.00NPYR-13 OS=Schmidtea mediterranea OX=79327 GN=npyr... [more]
A0A193KUX01.628e-5537.50NPYR-14 OS=Schmidtea mediterranea OX=79327 GN=npyr... [more]
U6JBI82.002e-5539.03Neuropeptide Y receptor OS=Echinococcus granulosus... [more]
A0A087W0K93.761e-5539.32Neuropeptide receptor OS=Echinococcus multilocular... [more]
A0A193KUI81.439e-5338.53NPYR-16 OS=Schmidtea mediterranea OX=79327 GN=npyr... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prlh2r2.224e-2427.57prolactin-releasing peptide receptor-like [Source:... [more]
prlhr2b6.545e-2228.62prolactin-releasing peptide receptor-like [Source:... [more]
prlhr2b1.397e-2128.62prolactin-releasing peptide receptor-like [Source:... [more]
npy7r9.133e-1928.36neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npffr11.451e-1725.68neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prlh2r6.243e-2428.53prolactin releasing hormone 2 receptor [Source:ZFI... [more]
npy8br1.235e-1425.67neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-G... [more]
npffr1l31.701e-1423.76neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
qrfpr44.218e-1427.23pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
si:dkey-202l22.35.547e-1427.01prolactin releasing hormone receptor [Source:HGNC ... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPYR-13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO409444.637e-1631.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364732.380e-1530.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364535.236e-1530.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460848.152e-1531.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274811.932e-1430.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPYR-13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy7r1.474e-2528.00PRELI domain-containing protein 1, mitochondrial [... [more]
ENSORLT00000019392.22.824e-2427.41prolactin-releasing peptide receptor-like [Source:... [more]
ENSORLT00000035956.13.053e-2427.41prolactin-releasing peptide receptor-like [Source:... [more]
npy8br1.814e-2228.24neuropeptide Y receptor type 1 [Source:NCBI gene;A... [more]
npy2rl1.012e-1823.60neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
back to top
BLAST of NPYR-13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028179.10.000e+0100.00SMESG000028179.1[more]
SMESG000072379.11.885e-5937.50SMESG000072379.1[more]
SMESG000064757.14.676e-5637.65SMESG000064757.1[more]
SMESG000001731.17.462e-4338.01SMESG000001731.1[more]
SMESG000066072.15.144e-2630.00SMESG000066072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009299 ID=SMED30009299|Name=NPYR-13|organism=Schmidtea mediterranea sexual|type=transcript|length=1521bp
ATATTTCTATTTATGGAATTCAATCATGCTCAGCAGGGAAGCCATAGAAA
ATTTGAATTTGTATATTCAATTTCCACACTATTCTCAATTCTAACGTTTC
TTGGTATTGCACTCAATCTTTTAATTGTTCTAGTGATCTTGAAACATTGC
GTTTTCCACAATGTTACCAACATATTCGTTCTAACTCTCGCAATCTCGGA
TATTCTTCTCTGTGCATTCAATATCCCAATTCAAACGTACTATGAGATCA
CTGAAAAGGCCGGCTTCGGTACAATTACTTGTAAGGTGGTGTTTGCCCTT
TTTAGTGTACCCCTTTACATTTCCAGTTTGACGATATTGCTAATAGCAGT
TGACCGATATCGTATAATAATTTATCCATTAAAAGAACGAATATCAAAGT
CCACTGCCACAATTTTGGTGATTCTCATTGTTGTTATTAGCACAATGTCC
TCTATTCCAGTAGCACTATTTACTCATTCGATTTACACGGAAAATAACTC
TTTAAGCATTGAACTGGAGACGAGTTATTGCGCTGAATACTGGCCCTATC
TATTACCAAGATTGTGCTATTCATGTTTCGTGTTTCTATTTCATTACTTT
TTGCCATTGATAATCACGGCCTATTTGTATATTTCAATCTATTATCGTCT
AAAGATGCGAACATTTAAAAAGCGAGATAATGTTCGTAAACTACGAACTA
ATAAAATATTGATAGCAATTGTATTGTGTTTTGCAGTTTTCTGGTCTCCA
TGGACGATTTATTCTTTGTATTTAGAGTCATATTCCTATTACTCCAAGAT
GAGATGGCTTCAAGGTTACGTTCACCATATATATAATTTTAATAGTTCTA
ATCTTAATGAAACAAGTTTCTTTAATCCAAAAAACGTTCACACAAAAACG
ATTGATCAAATTTTAAAATGTTTTGCCACATTTTCTTGCGTCATAAATCC
ATTCCTATACGGATGGCTCAATGATTCTATCAAAGAAGTTTTGTGTAGAA
ACTTTACAAGATTCAGACATTTATTAATAGAAAATCTATCAGGACACAAT
AGTCAAAGAGGTGACAATAAAAACTACCGCTTTAACCGATTAGACATGAA
AAATAACAACTTTCAAGAAGGAAGCGAGAAGGCAAATCTTTTGCTCACAA
ACCAAAATAAATGGGATGCCCAGCATCTCAATGCTGGAGCAATACCGTCA
ATATTCGACATGTCAACGAAACGAACCAGCTTATATCCAAGCAATAATCA
AAGAAATCCATCTCATATGTCCCAGGATGCAAGCAACGTCAATTATGAAT
CTTCATTTATTTCAAATGTACCGCACAACTACACTTCATCCGAAAGAAGA
TTTACTAATGAATCTTCGGATATCACTCTTTCTAATGCTAAAGAAATCGA
CGTGTTTACCGCAATGGCGATTGTGGTTAAGCAACAAACCTTTGACAGAA
GTCGACGAGTATCATTAGCCGTGGAATCAAAAAGGAAACCGATGACTTTA
TTAAATCGAAAAACATCGCTA
back to top

protein sequence of SMED30009299-orf-1

>SMED30009299-orf-1 ID=SMED30009299-orf-1|Name=SMED30009299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
IFLFMEFNHAQQGSHRKFEFVYSISTLFSILTFLGIALNLLIVLVILKHC
VFHNVTNIFVLTLAISDILLCAFNIPIQTYYEITEKAGFGTITCKVVFAL
FSVPLYISSLTILLIAVDRYRIIIYPLKERISKSTATILVILIVVISTMS
SIPVALFTHSIYTENNSLSIELETSYCAEYWPYLLPRLCYSCFVFLFHYF
LPLIITAYLYISIYYRLKMRTFKKRDNVRKLRTNKILIAIVLCFAVFWSP
WTIYSLYLESYSYYSKMRWLQGYVHHIYNFNSSNLNETSFFNPKNVHTKT
IDQILKCFATFSCVINPFLYGWLNDSIKEVLCRNFTRFRHLLIENLSGHN
SQRGDNKNYRFNRLDMKNNNFQEGSEKANLLLTNQNKWDAQHLNAGAIPS
IFDMSTKRTSLYPSNNQRNPSHMSQDASNVNYESSFISNVPHNYTSSERR
FTNESSDITLSNAKEIDVFTAMAIVVKQQTFDRSRRVSLAVESKRKPMTL
LNRKTSL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 302..328
score: 21.47
coord: 191..214
score: 23.14
coord: 23..47
score: 23.1
coord: 233..257
score: 25.07
coord: 56..77
score: 32.46
coord: 101..123
score: 29.43
coord: 135..156
score: 19.76
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 32..335
e-value: 0.0086
score: -68.4
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 39..320
e-value: 2.4E-32
score: 112.3
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 107..123
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 5..372
e-value: 5.6E-55
score: 188.2
NoneNo IPR availablePANTHERPTHR24235FAMILY NOT NAMEDcoord: 9..378
NoneNo IPR availableCDDcd152037tmA_NPYR-likecoord: 22..331
e-value: 1.20511E-72
score: 230.569
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 21..341
NoneNo IPR availableTMHMMTMhelixcoord: 96..117
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 138..157
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 193..215
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 38..320
score: 36.38