kinesin light chain

Overview
Namekinesin light chain
Smed IDSMED30009297
Length (bp)2050
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of kinesin light chain (SMED30009297) t-SNE clustered cells

Violin plots show distribution of expression levels for kinesin light chain (SMED30009297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of kinesin light chain (SMED30009297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for kinesin light chain (SMED30009297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009297SMESG000007554.1 dd_Smed_v4_6239_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009297SMESG000007554.1 Contig24118newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of kinesin light chain vs. Ensembl Human
Match: KLC4 (kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC:21624])

HSP 1 Score: 269.626 bits (688), Expect = 1.291e-80
Identity = 186/497 (37.42%), Postives = 287/497 (57.75%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGAS---VVDTLSETSSK 1678
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD             +  + SE     G+ T+   +++    N  +    N L       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG+NHPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LT  H     ++  S     KP+W+  E+R      + +  S   +   P   +    +  +  S   ++T+  L   Y+ QGKL  A+ L++   RS +Q     S   V + L E+  +
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYD-------------EDGHTSEE--KEGDATKDSLDDLFP--NEEEEDPSNGLSRGQGATAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAH----VQEFGSVDDDHKPIWMHAEER------EEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECALRSRRQGTDPISQTKVAELLGESDGR 516          
BLAST of kinesin light chain vs. Ensembl Human
Match: KLC4 (kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC:21624])

HSP 1 Score: 269.626 bits (688), Expect = 1.291e-80
Identity = 186/497 (37.42%), Postives = 287/497 (57.75%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGAS---VVDTLSETSSK 1678
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD             +  + SE     G+ T+   +++    N  +    N L       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG+NHPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LT  H     ++  S     KP+W+  E+R      + +  S   +   P   +    +  +  S   ++T+  L   Y+ QGKL  A+ L++   RS +Q     S   V + L E+  +
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYD-------------EDGHTSEE--KEGDATKDSLDDLFP--NEEEEDPSNGLSRGQGATAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAH----VQEFGSVDDDHKPIWMHAEER------EEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECALRSRRQGTDPISQTKVAELLGESDGR 516          
BLAST of kinesin light chain vs. Ensembl Human
Match: KLC4 (kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC:21624])

HSP 1 Score: 269.626 bits (688), Expect = 1.291e-80
Identity = 186/497 (37.42%), Postives = 287/497 (57.75%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGAS---VVDTLSETSSK 1678
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD             +  + SE     G+ T+   +++    N  +    N L       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG+NHPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LT  H     ++  S     KP+W+  E+R      + +  S   +   P   +    +  +  S   ++T+  L   Y+ QGKL  A+ L++   RS +Q     S   V + L E+  +
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYD-------------EDGHTSEE--KEGDATKDSLDDLFP--NEEEEDPSNGLSRGQGATAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAH----VQEFGSVDDDHKPIWMHAEER------EEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECALRSRRQGTDPISQTKVAELLGESDGR 516          
BLAST of kinesin light chain vs. Ensembl Human
Match: KLC4 (kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC:21624])

HSP 1 Score: 269.626 bits (688), Expect = 1.927e-80
Identity = 185/497 (37.22%), Postives = 286/497 (57.55%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGAS---VVDTLSETSSK 1678
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD             +  + SE     G+ T+   +++    N  +    N L       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G          D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG+NHPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LT  H     ++  S     KP+W+  E+R      + +  S   +   P   +    +  +  S   ++T+  L   Y+ QGKL  A+ L++   RS +Q     S   V + L E+  +
Sbjct:   84 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYD-------------EDGHTSEE--KEGDATKDSLDDLFP--NEEEEDPSNGLSRGQGATAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG--------HPDVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAH----VQEFGSVDDDHKPIWMHAEER------EEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECALRSRRQGTDPISQTKVAELLGESDGR 534          
BLAST of kinesin light chain vs. Ensembl Human
Match: KLC1 (kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC:6387])

HSP 1 Score: 261.536 bits (667), Expect = 3.105e-78
Identity = 176/430 (40.93%), Postives = 255/430 (59.30%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGN---LTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR 1420
            L +L+ T      D+     EEKS  ++KSLE +ELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD             D ++ SE   +      L +   N+ +    G +    +         +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R
Sbjct:   46 LQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYD-------------DDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAA------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEER 433          
BLAST of kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 257.684 bits (657), Expect = 1.007e-77
Identity = 170/452 (37.61%), Postives = 253/452 (55.97%), Query Frame = 2
Query:  299 VEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS------YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSV---FGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQ 1627
            ++A   K  A   RL +EN WLR+E+S+TQ +L  +E+   +LE + K  +  + ++++D       + S     V++    ++   L E  +        G +  E  +    N P   N  +      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN++L++RE  LG +HP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE+ YK+AL IY    G D+ NV KT+NN++  +LKQ  + +AE ++K++LT  HER   +    N    KP+W + E+R      G G      A   K   + S           + ++T+  L   Y+ QGK   A+ L+D   R+ KQ
Sbjct:   83 MDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFD-----DGTQSDTKTSVDVGPQPVTNETLQELGF--------GPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGEN----KPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDS----------PTVTTTLKNLGALYRRQGKYEAAETLEDVALRAKKQ 488          
BLAST of kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 257.684 bits (657), Expect = 1.007e-77
Identity = 170/452 (37.61%), Postives = 253/452 (55.97%), Query Frame = 2
Query:  299 VEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS------YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSV---FGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQ 1627
            ++A   K  A   RL +EN WLR+E+S+TQ +L  +E+   +LE + K  +  + ++++D       + S     V++    ++   L E  +        G +  E  +    N P   N  +      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN++L++RE  LG +HP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE+ YK+AL IY    G D+ NV KT+NN++  +LKQ  + +AE ++K++LT  HER   +    N    KP+W + E+R      G G      A   K   + S           + ++T+  L   Y+ QGK   A+ L+D   R+ KQ
Sbjct:   83 MDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFD-----DGTQSDTKTSVDVGPQPVTNETLQELGF--------GPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGEN----KPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDS----------PTVTTTLKNLGALYRRQGKYEAAETLEDVALRAKKQ 488          
BLAST of kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 257.684 bits (657), Expect = 1.399e-77
Identity = 170/452 (37.61%), Postives = 253/452 (55.97%), Query Frame = 2
Query:  299 VEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS------YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSV---FGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQ 1627
            ++A   K  A   RL +EN WLR+E+S+TQ +L  +E+   +LE + K  +  + ++++D       + S     V++    ++   L E  +        G +  E  +    N P   N  +      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN++L++RE  LG +HP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE+ YK+AL IY    G D+ NV KT+NN++  +LKQ  + +AE ++K++LT  HER   +    N    KP+W + E+R      G G      A   K   + S           + ++T+  L   Y+ QGK   A+ L+D   R+ KQ
Sbjct:  104 MDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFD-----DGTQSDTKTSVDVGPQPVTNETLQELGF--------GPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGEN----KPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDS----------PTVTTTLKNLGALYRRQGKYEAAETLEDVALRAKKQ 509          
BLAST of kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 257.684 bits (657), Expect = 1.399e-77
Identity = 170/452 (37.61%), Postives = 253/452 (55.97%), Query Frame = 2
Query:  299 VEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS------YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSV---FGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQ 1627
            ++A   K  A   RL +EN WLR+E+S+TQ +L  +E+   +LE + K  +  + ++++D       + S     V++    ++   L E  +        G +  E  +    N P   N  +      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN++L++RE  LG +HP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE+ YK+AL IY    G D+ NV KT+NN++  +LKQ  + +AE ++K++LT  HER   +    N    KP+W + E+R      G G      A   K   + S           + ++T+  L   Y+ QGK   A+ L+D   R+ KQ
Sbjct:  104 MDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFD-----DGTQSDTKTSVDVGPQPVTNETLQELGF--------GPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGEN----KPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDS----------PTVTTTLKNLGALYRRQGKYEAAETLEDVALRAKKQ 509          
BLAST of kinesin light chain vs. Ensembl Celegans
Match: klc-2 (Kinesin light chain [Source:UniProtKB/Swiss-Prot;Acc:P46822])

HSP 1 Score: 257.684 bits (657), Expect = 2.788e-77
Identity = 170/452 (37.61%), Postives = 253/452 (55.97%), Query Frame = 2
Query:  299 VEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS------YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSV---FGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQ 1627
            ++A   K  A   RL +EN WLR+E+S+TQ +L  +E+   +LE + K  +  + ++++D       + S     V++    ++   L E  +        G +  E  +    N P   N  +      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN++L++RE  LG +HP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE+ YK+AL IY    G D+ NV KT+NN++  +LKQ  + +AE ++K++LT  HER   +    N    KP+W + E+R      G G      A   K   + S           + ++T+  L   Y+ QGK   A+ L+D   R+ KQ
Sbjct:   83 MDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQMVAQLEEENKHLKYMASIKQFDD-----GTQSDTKTSVDVGPQPVTNETLQELGF--------GPEDEEDMNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLAVLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGEN----KPIWQIAEEREENKHKGEGATANEQAGWAKAAKVDS----------PTVTTTLKNLGALYRRQGKYEAAETLEDVALRAKKQ 488          
BLAST of kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331556)

HSP 1 Score: 268.855 bits (686), Expect = 7.924e-82
Identity = 180/478 (37.66%), Postives = 277/478 (57.95%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EKS  L+K++E IELG+ E +++++L+ + + +EA + KL   + RL +EN WLR+E++ TQ +   +E+   +LE + K  E  + ++KYD+       + +  D  + S +      + E   +E N  R+    T  +   N        T  Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L++R   LG NHP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+Y+EVE+ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + +AEI++K++LT  HER      S N    KP+W + E+R         ++  + ++  P   +    +  + DS   ++T+  L   Y+ QG    A+ L+D   RS K++
Sbjct:   42 EKSDMLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDE-------NQEQDDACDKSRT----DPVVELFPDEENEDRHNMSPTPPSQFAN-------QTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LERTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKN----KPIWQVAEERE--------EHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEA 470          
BLAST of kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0075951)

HSP 1 Score: 268.855 bits (686), Expect = 8.757e-82
Identity = 180/478 (37.66%), Postives = 277/478 (57.95%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EKS  L+K++E IELG+ E +++++L+ + + +EA + KL   + RL +EN WLR+E++ TQ +   +E+   +LE + K  E  + ++KYD+       + +  D  + S +      + E   +E N  R+    T  +   N        T  Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L++R   LG NHP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+Y+EVE+ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + +AEI++K++LT  HER      S N    KP+W + E+R         ++  + ++  P   +    +  + DS   ++T+  L   Y+ QG    A+ L+D   RS K++
Sbjct:   42 EKSDMLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDE-------NQEQDDACDKSRT----DPVVELFPDEENEDRHNMSPTPPSQFAN-------QTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LERTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKN----KPIWQVAEERE--------EHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEA 470          
BLAST of kinesin light chain vs. Ensembl Fly
Match: Klc (gene:FBgn0010235 transcript:FBtr0331555)

HSP 1 Score: 268.855 bits (686), Expect = 8.757e-82
Identity = 180/478 (37.66%), Postives = 277/478 (57.95%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EKS  L+K++E IELG+ E +++++L+ + + +EA + KL   + RL +EN WLR+E++ TQ +   +E+   +LE + K  E  + ++KYD+       + +  D  + S +      + E   +E N  R+    T  +   N        T  Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L++R   LG NHP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+Y+EVE+ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + +AEI++K++LT  HER      S N    KP+W + E+R         ++  + ++  P   +    +  + DS   ++T+  L   Y+ QG    A+ L+D   RS K++
Sbjct:   42 EKSDMLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDE-------NQEQDDACDKSRT----DPVVELFPDEENEDRHNMSPTPPSQFAN-------QTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LERTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKN----KPIWQVAEERE--------EHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEA 470          
BLAST of kinesin light chain vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 269.24 bits (687), Expect = 7.744e-81
Identity = 187/484 (38.64%), Postives = 272/484 (56.20%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLS-----ESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EEK+  +++S+E +ELG+ E +++++LS +   VEA + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E  ++L+KYDQ L  S      S +  L      E    G  +     + + + + G                      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R         ++  + +   P   +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS KQ 
Sbjct:   71 EEKTAMIQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDLSPSDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVAAAQQGG---------------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREE-------QSKIKQKDGTPFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAALRSRKQG 503          
BLAST of kinesin light chain vs. Ensembl Zebrafish
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 269.24 bits (687), Expect = 8.533e-81
Identity = 187/484 (38.64%), Postives = 272/484 (56.20%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLS-----ESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EEK+  +++S+E +ELG+ E +++++LS +   VEA + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E  ++L+KYDQ L  S      S +  L      E    G  +     + + + + G                      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R         ++  + +   P   +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS KQ 
Sbjct:   71 EEKTAMIQRSMEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDLSPSDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVAAAQQGG---------------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREE-------QSKIKQKDGTPFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAALRSRKQG 503          
BLAST of kinesin light chain vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 258.07 bits (658), Expect = 2.108e-76
Identity = 187/507 (36.88%), Postives = 286/507 (56.41%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR----SVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASV 1648
            L +L+ T      DE  +   EKS  L+KS+E IELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ ++  +E+   +LE + K  E  ++L+KYD         +  + + +L +   +  +      ++++ + N +               +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA +LLN +L++RE  LG ++P +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG  HPDVAKQL NLALLCQNQG+YEEVE  Y +AL IY    G D+ NV KT+NN+A  +LKQ  + +AEI++KE+LT  HE+      + N    KP+W+  E+R         G          K   + S           + ++T+  L   Y+ QGKL  A+ L++   RS +Q   GA+V
Sbjct:   42 LQSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKNSDTPKDSLDDLFPNDED------DQVSHQHNSAAVA------------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGREHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGCVDAEN----KPIWMHAEEREESKGKLADGNHYGEYGGWYKACKVNS----------PTVNTTLRNLGALYRKQGKLEAAETLEECAMRSRRQ---GAAV 494          
BLAST of kinesin light chain vs. Ensembl Zebrafish
Match: klc4 (kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-050417-350])

HSP 1 Score: 258.07 bits (658), Expect = 2.108e-76
Identity = 187/507 (36.88%), Postives = 286/507 (56.41%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR----SVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASV 1648
            L +L+ T      DE  +   EKS  L+KS+E IELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ ++  +E+   +LE + K  E  ++L+KYD         +  + + +L +   +  +      ++++ + N +               +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA +LLN +L++RE  LG ++P +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG  HPDVAKQL NLALLCQNQG+YEEVE  Y +AL IY    G D+ NV KT+NN+A  +LKQ  + +AEI++KE+LT  HE+      + N    KP+W+  E+R         G          K   + S           + ++T+  L   Y+ QGKL  A+ L++   RS +Q   GA+V
Sbjct:   42 LQSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQHKVQKSEQSVAQLEEEKKHLEFMNQLKKYDDGATPEEEKNSDTPKDSLDDLFPNDED------DQVSHQHNSAAVA------------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGNDNPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGREHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALDIYEKRLGPDDPNVAKTKNNLASCYLKQGKYKEAEILYKEILTRAHEKEFGCVDAEN----KPIWMHAEEREESKGKLADGNHYGEYGGWYKACKVNS----------PTVNTTLRNLGALYRKQGKLEAAETLEECAMRSRRQ---GAAV 494          
BLAST of kinesin light chain vs. Ensembl Zebrafish
Match: klc3 (kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-060929-772])

HSP 1 Score: 249.98 bits (637), Expect = 1.493e-74
Identity = 165/406 (40.64%), Postives = 238/406 (58.62%), Query Frame = 2
Query:  275 SLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS-----YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSG-QILKNSAEIQKL 1474
            +LS +   +EA + KL A + RL +EN WLR+E+S  Q +L   E++ + LE Q +  +  S +RKYD             ++ +L +   + G   ES+ +           TE  +  +++ P S    +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K              S P   D+AT+ NI ALVYRDQ  Y EA +LLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG++HPDVAKQL NLALLCQNQG+Y+EVEQ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + QAE ++KE+LT  HE+    +  S     +P+W+  E+ S    G   LK S    KL
Sbjct:   73 ALSAHLGSLEAEKQKLRAQVRRLCQENQWLRDELSRAQQQLQEREQEVVTLEEQNRHLQFMSSIRKYDH------------EETSLEDKDSTSGK--ESLDDLF--------PTEEEEQTHMSQPHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK----------SSGHSHP---DVATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGMDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYQEVEQYYERALHIYQSQLGPDDANVAKTKNNLASCYLKQGKYRQAEALYKEILTRAHEK----EFGSVEGDGRPVWIHTEEGSSRPDGLGNLKRSGSFTKL 433          
BLAST of kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 242.276 bits (617), Expect = 4.283e-71
Identity = 144/323 (44.58%), Postives = 193/323 (59.75%), Query Frame = 2
Query:  668 SYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
             Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK REAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R  F   Q      E         +    +  + DS   ++T+  L   Y+ QGK   AD L++   RS KQ+
Sbjct:  181 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREKFKGKQKDGTFGE---------YGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQA 471          
BLAST of kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 241.121 bits (614), Expect = 8.005e-71
Identity = 144/323 (44.58%), Postives = 193/323 (59.75%), Query Frame = 2
Query:  668 SYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
             Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK REAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R  F   Q      E         +    +  + DS   ++T+  L   Y+ QGK   AD L++   RS KQ+
Sbjct:  206 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREKFKGKQKDGTFGE---------YGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQA 496          
BLAST of kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 241.121 bits (614), Expect = 3.586e-70
Identity = 144/323 (44.58%), Postives = 193/323 (59.75%), Query Frame = 2
Query:  668 SYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
             Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK REAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R  F            QK      +    +  + DS   ++T+  L   Y+ QGK   AD L++   RS KQ+
Sbjct:  206 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREKFK-----------QKDGTFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQA 494          
BLAST of kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 240.736 bits (613), Expect = 4.579e-70
Identity = 144/323 (44.58%), Postives = 193/323 (59.75%), Query Frame = 2
Query:  668 SYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
             Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK REAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R  F   Q      E         +    +  + DS   ++T+  L   Y+ QGK   AD L++   RS KQ+
Sbjct:  206 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREKFKGKQKDGTFGE---------YGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQA 496          
BLAST of kinesin light chain vs. Ensembl Xenopus
Match: hira (histone cell cycle regulator [Source:Xenbase;Acc:XB-GENE-976072])

HSP 1 Score: 241.121 bits (614), Expect = 6.890e-70
Identity = 146/323 (45.20%), Postives = 196/323 (60.68%), Query Frame = 2
Query:  668 SYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
             Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK REAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R  F   Q      E         +    +  + DS   ++T+  L   Y+ QGK   AD L++   RS KQ+
Sbjct:  206 GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREKFKGKQKDGTFGE---------YGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAADTLEEAAIRSRKQA 496          
BLAST of kinesin light chain vs. Ensembl Mouse
Match: Klc4 (kinesin light chain 4 [Source:MGI Symbol;Acc:MGI:1922014])

HSP 1 Score: 276.174 bits (705), Expect = 2.967e-83
Identity = 188/491 (38.29%), Postives = 285/491 (58.04%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSET 1669
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD+            D   + E     G  T+   +++    N  +    NDL       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG++HPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LTC H     ++  S     KP+W+  E+R      +   +SA      P   +    +     S   ++T+  L   Y+ QGKL  A+ L++   RS KQ        D +S+T
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLRQLRQYDE------------DGHGMEEKE---GEATKDSLDDLFP--NEEEEDSGNDLSRGQGAAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYESQLGPDNPNVARTKNNLASCYLKQGKYSEAEALYKEILTCAH----VQEFGSVDDDHKPIWMHAEEREEMSRSRPRDSSA------PYAEYGGWYKACRVSSPTVNTTLKNLGALYRRQGKLEAAETLEECALRSRKQG------TDPISQT 504          
BLAST of kinesin light chain vs. Ensembl Mouse
Match: Klc4 (kinesin light chain 4 [Source:MGI Symbol;Acc:MGI:1922014])

HSP 1 Score: 276.174 bits (705), Expect = 2.967e-83
Identity = 188/491 (38.29%), Postives = 285/491 (58.04%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSET 1669
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD+            D   + E     G  T+   +++    N  +    NDL       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG++HPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LTC H     ++  S     KP+W+  E+R      +   +SA      P   +    +     S   ++T+  L   Y+ QGKL  A+ L++   RS KQ        D +S+T
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLRQLRQYDE------------DGHGMEEKE---GEATKDSLDDLFP--NEEEEDSGNDLSRGQGAAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYESQLGPDNPNVARTKNNLASCYLKQGKYSEAEALYKEILTCAH----VQEFGSVDDDHKPIWMHAEEREEMSRSRPRDSSA------PYAEYGGWYKACRVSSPTVNTTLKNLGALYRRQGKLEAAETLEECALRSRKQG------TDPISQT 504          
BLAST of kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 263.462 bits (672), Expect = 3.346e-79
Identity = 176/430 (40.93%), Postives = 253/430 (58.84%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSE---SIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR 1420
            L +L+ T      D+     EEKS  ++KSLE +ELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD             D ++ SE   S  S   L +   N+ +    G +    +         +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R
Sbjct:   46 LQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYD-------------DDISPSEDKDSDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAA------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEER 433          
BLAST of kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 263.077 bits (671), Expect = 7.765e-79
Identity = 176/430 (40.93%), Postives = 253/430 (58.84%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSE---SIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR 1420
            L +L+ T      D+     EEKS  ++KSLE +ELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD             D ++ SE   S  S   L +   N+ +    G +    +         +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R
Sbjct:   46 LQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYD-------------DDISPSEDKDSDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAA------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEER 433          
BLAST of kinesin light chain vs. Ensembl Mouse
Match: Klc1 (kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:107978])

HSP 1 Score: 264.233 bits (674), Expect = 7.885e-79
Identity = 178/430 (41.40%), Postives = 256/430 (59.53%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSE---SIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR 1420
            L +L+ T      D+     EEKS  ++KSLE +ELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD             D ++ SE   S  S   L +   N+ +    G +    +         +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y +A NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R
Sbjct:   46 LQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYD-------------DDISPSEDKDSDSSKEPLDDLFPNDEDEPGQGIQQQHSSAAA------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEER 433          
BLAST of kinesin light chain vs. UniProt/SwissProt
Match: sp|Q9DBS5|KLC4_MOUSE (Kinesin light chain 4 OS=Mus musculus OX=10090 GN=Klc4 PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.075e-82
Identity = 188/491 (38.29%), Postives = 285/491 (58.04%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSET 1669
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD+            D   + E     G  T+   +++    N  +    NDL       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG++HPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LTC H     ++  S     KP+W+  E+R      +   +SA      P   +    +     S   ++T+  L   Y+ QGKL  A+ L++   RS KQ        D +S+T
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLRQLRQYDE------------DGHGMEEKE---GEATKDSLDDLFP--NEEEEDSGNDLSRGQGAAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYESQLGPDNPNVARTKNNLASCYLKQGKYSEAEALYKEILTCAH----VQEFGSVDDDHKPIWMHAEEREEMSRSRPRDSSA------PYAEYGGWYKACRVSSPTVNTTLKNLGALYRRQGKLEAAETLEECALRSRKQG------TDPISQT 504          
BLAST of kinesin light chain vs. UniProt/SwissProt
Match: sp|P46825|KLC_DORPE (Kinesin light chain OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 2.801e-82
Identity = 188/480 (39.17%), Postives = 285/480 (59.38%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNL-SESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EEK+  LKKS++ IELG+ E +++++L+++ +  EA + KL A + RL +EN WLR+E++ TQ +L ++E++   +E + K  E  +E++KYD              QVN   ES  S  +L     ++   +      T+ + +          +   ++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQG Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE+ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + QAEI++KE+LT  HE+   +    N    KP+W+  E+R         +N A+ +   P   + + L+  + DS   ++T+  L   Y+ QGK   A+ L++   RS K +
Sbjct:   72 EEKANILKKSVDSIELGLGEAQVMMALANHLQHTEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQMSEQKVATIEEEKKHLEFMNEMKKYD----------TNEAQVNEEKESEQSSLDLGFPDDDDDGGQPEVLSPTQPSAMAQAA------SGGCEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALVIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVERYYQRALEIYQKELGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDDDN----KPIWMQAEERE--------ENKAKYKDGAPQPDYGSWLKAVKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECALRSRKSA 504          
BLAST of kinesin light chain vs. UniProt/SwissProt
Match: sp|P46824|KLC_DROME (Kinesin light chain OS=Drosophila melanogaster OX=7227 GN=Klc PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 8.778e-81
Identity = 180/478 (37.66%), Postives = 277/478 (57.95%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EKS  L+K++E IELG+ E +++++L+ + + +EA + KL   + RL +EN WLR+E++ TQ +   +E+   +LE + K  E  + ++KYD+       + +  D  + S +      + E   +E N  R+    T  +   N        T  Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L++R   LG NHP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+Y+EVE+ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + +AEI++K++LT  HER      S N    KP+W + E+R         ++  + ++  P   +    +  + DS   ++T+  L   Y+ QG    A+ L+D   RS K++
Sbjct:   42 EKSDMLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDE-------NQEQDDACDKSRT----DPVVELFPDEENEDRHNMSPTPPSQFAN-------QTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LERTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKN----KPIWQVAEERE--------EHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEA 470          
BLAST of kinesin light chain vs. UniProt/SwissProt
Match: sp|Q9NSK0|KLC4_HUMAN (Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3)

HSP 1 Score: 269.626 bits (688), Expect = 6.201e-80
Identity = 186/497 (37.42%), Postives = 287/497 (57.75%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGAS---VVDTLSETSSK 1678
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD             +  + SE     G+ T+   +++    N  +    N L       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG+NHPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LT  H     ++  S     KP+W+  E+R      + +  S   +   P   +    +  +  S   ++T+  L   Y+ QGKL  A+ L++   RS +Q     S   V + L E+  +
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLGQLRQYD-------------EDGHTSEE--KEGDATKDSLDDLFP--NEEEEDPSNGLSRGQGATAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAH----VQEFGSVDDDHKPIWMHAEER------EEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECALRSRRQGTDPISQTKVAELLGESDGR 516          
BLAST of kinesin light chain vs. UniProt/SwissProt
Match: sp|Q5PQM2|KLC4_RAT (Kinesin light chain 4 OS=Rattus norvegicus OX=10116 GN=Klc4 PE=1 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.517e-79
Identity = 186/491 (37.88%), Postives = 282/491 (57.43%), Query Frame = 2
Query:  203 EKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSET 1669
            EK+++L++S+E IELG+ E +++L+L+ +   VE+ + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E   +LR+YD+              +   E   S  +L +   NE        +    NDL       +     Y++P  L++LH+LV  Y++QGR+EVA+ LCKQA+++           L  T+  G      P   D+AT+ NI ALVYRDQ  Y EA +LLN +L++RE+ LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG++HPDVAKQL NLALLCQNQG+YE VE+ Y++AL+IY    G DN NV +T+NN+A  +LKQ  + +AE ++KE+LT  H     ++  S     KP+W+  E+R      + +  S   +   P   +    +     S   ++T+  L   Y+ QGKL  A+ L++   RS KQ        D +S+T
Sbjct:   66 EKARQLRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQLEEEKKHLEFLRQLRQYDE----------DGHSMEEKEGDASKDSLDDLFPNE-------EEEDSSNDLSRGQGAAAAQQGGYEIPARLRTLHNLVIQYAAQGRYEVAVPLCKQALED-----------LERTSGRG-----HP---DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYERQLGPDNPNVARTKNNLASCYLKQGKYSEAETLYKEILTRAH----VQEFGSVDDDHKPIWMHAEER------EEMSRSRSRESGTPYAEYGGWYKACRVSSPTVNTTLRNLGALYRRQGKLEAAETLEECALRSRKQG------TDPISQT 504          
BLAST of kinesin light chain vs. TrEMBL
Match: H2Z633 (TPR_REGION domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.354e-86
Identity = 201/508 (39.57%), Postives = 306/508 (60.24%), Query Frame = 2
Query:  179 DELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISG--GNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR--SVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSETSSKYS 1684
            DE V   EEKS  +KKSLE IELG+ E E+++SLS +   +E+ + +  A+I RL +EN WLR+E++ TQ++L ++E++ ++LE +    E    +RK+D+ LP     +   +  ++ +   SG  G+ + SI            S   + L  IN   S+ +  Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  + EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQ +YEEVE+ Y++AL IY  N G D+ NV KT+NN+A  ++KQ  F QAE ++K++LT  HE+    D  S     KP+W+  E+R  SV+ +GQ  K+SA      P   +    +  + DS   ++T+  L   Y+ QGK   A  L++  SR+ +Q ++ A+     ++  ++++
Sbjct:   58 DEDVNLVEEKSNIIKKSLEMIELGLGEAEMMVSLSCHLNTMESEKQRAKALIRRLCQENAWLRDELANTQNKLQMSEQKVVQLEEEKNHLEFLKSIRKFDEDLPDQGLGNTTKETSSMEDLFSSGTNGDGSTSI-----------GSAPSSSLNQINS-NSVASGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKFKEAGNLLNDALAIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGGDHPDVAKQLNNLALLCQNQSKYEEVEKYYQRALQIYETNLGPDDPNVAKTKNNLASAYMKQGKFKQAETLYKQVLTQAHEK----DFGSIDEKNKPIWMHAEEREASVY-TGQS-KDSA------PYGEYGGWYKAAKVDSPTVTTTLKNLGALYRRQGKYEAAQTLENCASRTGRQPSQSATPTGERAKDKAQFT 522          
BLAST of kinesin light chain vs. TrEMBL
Match: A0A4S2LDN0 (TPR_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007925 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 1.715e-85
Identity = 176/449 (39.20%), Postives = 261/449 (58.13%), Query Frame = 2
Query:  278 LSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIK 1624
            L +Y +I +A + KL     RL +EN WLREE+S TQ      E++ + LE +IK  EL +ELRKYD   P+        D   L++   +  N T+  + + +  ++    ++   +  +         +Y++P  L++LH+LV  Y+S+GR+EVA+ LCKQA+++                 + G +  D     +AT+ NI ALVYRDQ  Y EA  LLN +LT+RE  LG NHP +A TLNN+A+L  + GK +EAE +C+RAL IRE  LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY +  G D+ NV+KT+NN+A  +LKQ  + +AE ++K++LT  HE+   E  ++N    KP+W+L EDR    +G + +            S +A L  +E  +  +T+  L   Y+ QGK   AD++D+   R+ K
Sbjct:   75 LYEYIQITDAEKQKLRYQARRLFQENAWLREELSTTQHLHWECEKKVVVLEEKIKQLELNAELRKYDSNEPA--------DSSGLADGDSTTKNATDMGFPQDDGDQDAMSQSQTVTMSQV-------ASTYEIPTRLRTLHNLVIQYASEGRYEVAVPLCKQALED--------------LERSSGRDHPD-----VATMLNILALVYRDQQKYREAATLLNDALTIREKTLGPNHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALLIREAVLGQDHPDVAKQLNNLALLCQNQGKYEEVELYYQRALEIYVNTLGPDDPNVVKTKNNLASAYLKQCKYAEAEELYKQVLTRAHEKEFGEVSTTN----KPIWMLAEDRQ---AGLVTETDV-------AQSLAARLSRQESQTVVTTLRNLAALYRRQGKFEAADVVDECAGRTSK 475          
BLAST of kinesin light chain vs. TrEMBL
Match: A0A210QE77 (Kinesin light chain OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10107 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 8.626e-85
Identity = 193/489 (39.47%), Postives = 291/489 (59.51%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTE-----------RNDLKNINCPESLN---TYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRS 1618
            EEK+ RLKKSLE IELG+ E +++++LS++ + VEA + KL A + RL +EN WLR+E++ TQ +L ++E++   +E + K  E  +E++KYD   P          Q ++S    +GG +      E   +   ++S E           + ++ + + P ++    +  Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQG Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVEQ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + QAE ++KE+LT  HE+   +    N    KP+W+  E+R         +N  + +   P+  +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS
Sbjct:   74 EEKTNRLKKSLETIELGLSEAQVMMALSNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQMSEQKVATIEEEKKHLEFMNEMKKYDSSDP---------QQTSVSLPRSAGGVVPVHQATEEKEQDQSTQSLELGFPDDDDDSPQPEVLSPSQPSAMAQAASGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGYDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALDIYEGKLGPDDPNVAKTKNNLASAYLKQGKYKQAEALYKEVLTRAHEKEFGKVDGEN----KPIWMQAEERE--------ENKGKYKDGTPMPEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECAMRS 522          
BLAST of kinesin light chain vs. TrEMBL
Match: A0A1S3IGZ4 (kinesin light chain isoform X10 OS=Lingula unguis OX=7574 GN=LOC106164206 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.155e-84
Identity = 190/480 (39.58%), Postives = 293/480 (61.04%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS---YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIK 1624
            EEK+  LKKSLE I+LG++E +++++L+++ + VEA + KL A + RL +EN WLR+E++ TQ +L ++E++  E+E Q K  E   E+RKYD+         + + Q    +  IS    ++++  ++    +   + +++ + + + P  ++  +   Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQG Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVEQ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + QAEI++KE+LT  HE+   +    N    KP+W+  E+R         +N  + +   P   +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS K
Sbjct:   74 EEKTGILKKSLEMIDLGLNEAQVMMALTNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQLSEQKVAEIEEQNKHLEFMKEMRKYDE---------EDTTQTTPDQEPISSEKDSKNLPLDLGFPDDDEDNQQQDSMMSPSQPMVMSQAAAGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALEIYETKLGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDGDN----KPIWMQAEERE--------ENKGKFKDNAPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECAIRSRK 513          
BLAST of kinesin light chain vs. TrEMBL
Match: A0A1S3IGY9 (kinesin light chain isoform X5 OS=Lingula unguis OX=7574 GN=LOC106164206 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.480e-84
Identity = 190/480 (39.58%), Postives = 293/480 (61.04%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS---YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIK 1624
            EEK+  LKKSLE I+LG++E +++++L+++ + VEA + KL A + RL +EN WLR+E++ TQ +L ++E++  E+E Q K  E   E+RKYD+         + + Q    +  IS    ++++  ++    +   + +++ + + + P  ++  +   Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQG Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVEQ Y++AL IY    G D+ NV KT+NN+A  +LKQ  + QAEI++KE+LT  HE+   +    N    KP+W+  E+R         +N  + +   P   +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS K
Sbjct:   74 EEKTGILKKSLEMIDLGLNEAQVMMALTNHLQHVEAEKQKLRAQVRRLCQENAWLRDELANTQQKLQLSEQKVAEIEEQNKHLEFMKEMRKYDE---------EDTTQTTPDQEPISSEKDSKNLPLDLGFPDDDEDNQQQDSMMSPSQPMVMSQAAAGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQGKYKEAANLLNDALGIREKTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEQYYQRALEIYETKLGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEVLTRAHEKEFGKVDGDN----KPIWMQAEERE--------ENKGKFKDNAPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETLEECAIRSRK 513          
BLAST of kinesin light chain vs. Ensembl Cavefish
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:103045712])

HSP 1 Score: 275.789 bits (704), Expect = 5.789e-84
Identity = 189/479 (39.46%), Postives = 273/479 (56.99%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EEK+  +++SLE +ELG+ E +++++LS +   VEA + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E  ++L+KYDQ L             +  +S  S   L +   +E +    G +    + +       +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R     G+    S       P   +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS KQ 
Sbjct:   71 EEKTTMIQRSLEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDL----------SPTDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVA------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREEQSKGKQKDGS-------PFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQG 503          
BLAST of kinesin light chain vs. Ensembl Cavefish
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:103045712])

HSP 1 Score: 275.789 bits (704), Expect = 2.845e-83
Identity = 189/479 (39.46%), Postives = 273/479 (56.99%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EEK+  +++SLE +ELG+ E +++++LS +   VEA + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E  ++L+KYDQ L             +  +S  S   L +   +E +    G +    + +       +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R     G+    S       P   +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS KQ 
Sbjct:   71 EEKTTMIQRSLEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDL----------SPTDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVA------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREEQSKGKQKDGS-------PFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQG 503          
BLAST of kinesin light chain vs. Ensembl Cavefish
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:103045712])

HSP 1 Score: 275.789 bits (704), Expect = 7.136e-83
Identity = 189/479 (39.46%), Postives = 273/479 (56.99%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            EEK+  +++SLE +ELG+ E +++++LS +   VEA + KL A + RL +EN WLR+E++ TQ RL  +E+   +LE + K  E  ++L+KYDQ L             +  +S  S   L +   +E +    G +    + +       +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  F QAE ++KE+LT  HER        N    KP+W+  E+R     G+    S       P   +    +  + DS   ++T+  L   Y+ QGK   A+ L++   RS KQ 
Sbjct:   71 EEKTTMIQRSLEMLELGLSEAQVMMALSGHLSAVEAEKQKLRAQVRRLCQENQWLRDELAGTQQRLQKSEQSVAQLEEEKKHLEFMNQLKKYDQDL----------SPTDDKDSDSSRETLDDLFPDEQDEPGPGIQPPHSSAVA------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREEQSKGKQKDGS-------PFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQG 503          
BLAST of kinesin light chain vs. Ensembl Cavefish
Match: ENSAMXT00000003218.2 (kinesin light chain 1-like [Source:NCBI gene;Acc:103047573])

HSP 1 Score: 270.781 bits (691), Expect = 3.442e-81
Identity = 190/512 (37.11%), Postives = 289/512 (56.45%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSET 1669
            L +L+ T      DE      EKS  L+KS+E IELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD+               ++S S    G   +   +++        +       N     +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA +LLN +L++RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y +AL IY    G D+ NV KT+NN+A   LKQ  + +AE+++KE+LT  HE+      + N    KP+W+  E+R     G+   N+       P   +    +  + +S   ++T+  L   Y+ QGK+  A+ L++   RS KQ       +D +++T
Sbjct:   42 LHSLLETIKCLKKDEEANLVHEKSNLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDE---------------DVSPSEEKDGEPPKDSLDDLFPNDEEEHAQGMQHQHNSAAVAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALEIYECRLGPDDPNVAKTKNNLASCFLKQGKYKEAEVLYKEILTRAHEKEFGSVDAEN----KPIWMHAEEREEMSKGKHRDNT-------PYGEYGGWYKACKVNSPTVNTTLRNLGALYRRQGKMEAAETLEECAMRSRKQG------IDPINQT 502          
BLAST of kinesin light chain vs. Ensembl Cavefish
Match: ENSAMXT00000055945.1 (kinesin light chain 2-like [Source:NCBI gene;Acc:111194328])

HSP 1 Score: 266.929 bits (681), Expect = 7.271e-80
Identity = 185/480 (38.54%), Postives = 279/480 (58.13%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTES-IYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            +EKS  L+KSLE IELG+ E ++I++LS +   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  +++RK+D     S       ++ NL +   +  +   +    E+ +++ G                      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA +LLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG  HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    GAD+ NV KT+NN+A  +LKQ  F  AE ++KE+LT  HE+      + N    KP+W+  E+R         ++  + +   P   + +  +  + DS   ++T+  L   Y+ QGKL  A+ L++  +++ KQ 
Sbjct:   55 QEKSGVLRKSLEAIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELANTQHKLQKSEQNVAQLEEEKKHLEFMNQIRKFDDDASPSEEKPGEKEKDNLDDLFPNDDDQGPAQPSGEVAAQQGG----------------------YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKYHPDVAKQLNNLALLCQNQGKYEEVEYYYRRALEIYESKLGADDPNVAKTKNNLATCYLKQGKFKDAEALYKEILTRAHEKQFGSVNNDN----KPIWMHAEERE--------ESKGKKKDSGPYGEYGSWYKACKVDSPTVTNTLKSLGALYRRQGKLEAAETLEECATKNRKQG 481          
BLAST of kinesin light chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009139.1 (pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 gene:ENSPMAG00000008222.1 transcript:ENSPMAT00000009139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.87 bits (712), Expect = 8.112e-85
Identity = 175/457 (38.29%), Postives = 261/457 (57.11%), Query Frame = 2
Query:  275 SLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSF--SSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKG 1639
            +L+ +   VEA + KL A + RL +EN WLREE++  Q RL  +E+   +LE + +  +   +LRKYD             D+ +  E     G  ++   +++       +S+     + ++   +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  +  AE ++KE+LT  HER        N    KP+WV  E+R         ++  + ++ LP   +    +  + DS+  ++T+  L   Y+ QGK   A+ L++  SRS K++  G
Sbjct:   87 ALASHLGSVEAEKQKLRAQVRRLCQENAWLREELATAQQRLQRSEQSVAQLEEENRHLQFMGQLRKYD-------------DEASPPEE--KDGESSKEPLDDLFPNDEDEQSSSMTQSRGMSGAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAGNLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVETYYRRALDIYLLQLGTDDPNVAKTKNNLASCYLKQGKYKDAEALYKEILTRAHEREFGSVDGEN----KPIWVHAEERE--------QSKGKQKEALPCGEYGGWYKSGKIDSYTVTNTLKNLSALYRRQGKFEAAETLEECASRSRKKNITG 497          
BLAST of kinesin light chain vs. Ensembl Sea Lamprey
Match: klc1a (kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1599])

HSP 1 Score: 259.996 bits (663), Expect = 2.543e-78
Identity = 171/454 (37.67%), Postives = 261/454 (57.49%), Query Frame = 2
Query:  275 SLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            +L+ +   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++++KYD  +         S +  +SE       L +   NE + +  GS+ +  N + +     +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA +LLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG  HPDVAKQL NLALLCQNQ +YEEVE  Y++AL IY    G D+ NV KT+NN+A  +LKQ  + +AE ++K++LT  HE+        N    KP+W+  E+R         +   + ++  P   + +  +  + DS    +T+  L   Y+ QGKL  A+ L++  +RS +Q 
Sbjct:   45 ALTSHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQRSEQAVAQLEEEKKHLEFMNQMKKYDDDI-------SPSQEEKVSEPCKE--PLDDLFPNEEDEQEQGSQPS-HNAVNSAA--AAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAASLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKVHPDVAKQLNNLALLCQNQSKYEEVEHYYQRALDIYQSQLGPDDPNVAKTKNNLASCYLKQGKYKEAEGLYKDILTRAHEKEFGSVDGEN----KPIWMHAEERE--------EQKGKHKESPPYGEYGSWYKACKVDSPTVGTTLKNLSALYRRQGKLEAAETLEECAARSRRQG 455          
BLAST of kinesin light chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001329.1 (pep scaffold:Pmarinus_7.0:GL484789:104:2647:1 gene:ENSPMAG00000001191.1 transcript:ENSPMAT00000001329.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 1.829e-24
Identity = 69/184 (37.50%), Postives = 97/184 (52.72%), Query Frame = 2
Query: 1100 LGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDR---SVFGSGQILK-----NSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQ 1627
            LG +HPDVAKQL NLALLCQNQ +Y EVE  Y++AL IY    G D+ NV KT+NN  Y          AE ++KE+LT  HER        N    KP+W+  E+R    V  +G  ++     N+ +        S ++        + ++T+  L   Y+ QGKL  A+ L+++ S S KQ
Sbjct:    1 LGKDHPDVAKQLNNLALLCQNQSKYGEVEHYYQRALDIYEGRLGPDDPNVAKTKNNRKYK--------AAEALYKEILTRAHEREFGAINGEN----KPIWMHAEEREETKVCVAGGAVRQGKGWNAVKENGWYRTCSINS-------PTLATTLKNLGALYRRQGKLEAAETLEEFASHSRKQ 165          
BLAST of kinesin light chain vs. Ensembl Sea Lamprey
Match: nphp3 (nephronophthisis 3 [Source:NCBI gene;Acc:562601])

HSP 1 Score: 72.4034 bits (176), Expect = 1.868e-13
Identity = 81/293 (27.65%), Postives = 132/293 (45.05%), Query Frame = 2
Query:  659 NTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNE----------SDPY--SLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPK-----KPLWVL-VEDRSVFGSGQILKNSAEIQKLLPL 1483
            N + +D P   + L +L   +   GR E A +L +QA       L ++++   E  N  G             + P   S D A   N   ++Y  QGN         +SLT+RE +LG +HP  A +LNN+A L    G+   A+ +  RAL  R++ L  NHP +A  +  LALL +  G+ E+   +Y+  + I     G ++ +V     N+A V+ +     +A  +++  L       T ED    + P+     + L VL  E   V G+ ++ K + EI+   PL
Sbjct:  390 NAHGHDDPRVARHLDALAALHHKHGRLEQAESLRRQA-------LKIRQKAAAERGNVSGFELLRRRLLQLEEAPPGGESADAARSLNELGVLYYLQGNPDFMRLFFQRSLTMREKVLGPDHPDCAQSLNNLASLCGERGESERAQCLYERALHSRQRALSRNHPALAYTVKQLALLYKKGGKLEKALPLYQLTVEIREKASGPNHPSVATALVNLAVVYSQLKRHDEALPLYERALR------TYEDSLGPLHPRVAETLRNLAVLRYEQGDVAGAAELYKRATEIRGGEPL 669          

HSP 2 Score: 50.0618 bits (118), Expect = 1.712e-6
Identity = 28/94 (29.79%), Postives = 52/94 (55.32%), Query Frame = 2
Query: 1052 EAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELL 1333
            +A  M +R+L +RE  L  +HP VA  L  LA +  +  +    +Q+Y++AL++  + +G D+  V +  + +A +H K     QAE + ++ L
Sbjct:  334 QAVLMLQRSLELRETALDPDHPSVAGTLHRLAAVYLSWRKPGPAQQLYEQALALVQNAHGHDDPRVARHLDALAALHHKHGRLEQAESLRRQAL 427          
BLAST of kinesin light chain vs. Ensembl Nematostella
Match: EDO43009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV0])

HSP 1 Score: 258.07 bits (658), Expect = 1.504e-78
Identity = 173/452 (38.27%), Postives = 248/452 (54.87%), Query Frame = 2
Query:  275 SLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFG-SGQILKNSAEIQKL-LPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRS 1618
            +L  +   VEA + KL A + RL +EN WLREE+S TQ +L  +E+   +LE + K  E  + L+KYD             D   +   I S          +I S+       +   L   +   +  +  Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA NLL+ +LT+RE  LG +HP +A TLNN+A+L  + GK ++AE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+Y+EVEQ Y++AL IY    G D+ NV KT+NN+A  +LKQ  +  AE ++K++LT  HER                         FG SG+ L++  +  K   P   +    +  + DS   ++T+  L   Y+ QGK   A+ L+D   RS
Sbjct:   81 ALCSHLSTVEAEKQKLRAQVKRLCQENAWLREELSVTQQKLQESEQSVAQLEEEKKHLEFMNSLKKYD-------------DDEGIENDISS----------DILSQDEDDHDVDDETLSQTSNVSASTSGVYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLHDALTIREKTLGEDHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEQYYQRALEIYTTKLGPDDPNVAKTKNNLASAYLKQGKYKAAETLYKQVLTRAHER------------------------EFGTSGESLEDDGKRGKDNAPYGEYGGWHKAAKVDSPTVTTTLRNLGALYRRQGKFEAAETLEDCALRS 466          
BLAST of kinesin light chain vs. Ensembl Nematostella
Match: EDO37603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFC9])

HSP 1 Score: 75.8702 bits (185), Expect = 3.825e-14
Identity = 56/181 (30.94%), Postives = 96/181 (53.04%), Query Frame = 2
Query:  788 TLSLKKQILGETNNTGGVNESDPYSLDIA-TLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKE 1327
            +L+++++ILGE +             ++A +L N+ AL Y D   Y +A  L  ++L +R       H  +A T+ ++A L  + GK  +AE + R+AL  RE+  G NHP V   L NLA++   Q + E+   +Y++AL IY ++ G  +  V +   N+A V+  Q    +A  ++KE
Sbjct: 1132 SLAMREEILGEDHP------------EVAQSLHNLAAL-YNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDAIPLYERALRIYEESLGPQHPRVAEVLVNLAKVYYDQGALGEAVRLYKE 1299          

HSP 2 Score: 73.9442 bits (180), Expect = 1.289e-13
Identity = 69/227 (30.40%), Postives = 115/227 (50.66%), Query Frame = 2
Query:  680 PDH---LKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTL-----SLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENL-LGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELL 1333
            PDH    +SLH L   YS  G F  A A  KQAI+   N L     SL K + G +       +++ YSL  +  +   A+  R +      V  + + +   E L LG     ++ +LN I +L         +++  +R+LA+RE+ LG +HP+VA+ L NLA L  +  +Y++ E +YK+AL I    +  ++  V  T  ++A ++ KQ  F +AE ++++ L
Sbjct:  996 PDHPLVAQSLHYLAELYSHWGNFSAAEAFFKQAIEITQNALGADHFSLIKDLEGLSIL---YKKNEKYSLAESCHKRAIAI--RQKSGVLIGVQAMKRKIIQVEELSLGPGSQELSRSLNEIGVLYYLQNNHEASKSFFQRSLAMREEILGEDHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPLYRQAL 1217          

HSP 3 Score: 70.8626 bits (172), Expect = 1.309e-12
Identity = 55/180 (30.56%), Postives = 87/180 (48.33%), Query Frame = 2
Query:  674 DLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSI 1213
            D P+  +SLH+L   Y+   +++ A  L K+A+   +   S                   P    +A+     A +YR QG + +A  L  ++L  RE + G NHP +   L+N+A++     K  +A  +  RAL I E+ LG  HP VA+ L NLA +  +QG   E  ++YK+A  I
Sbjct: 1143 DHPEVAQSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFS-------------------PEHSCVASTVKHLATLYRKQGKFDKAEPLYRQALEAREKIFGDNHPGVGTALHNLAVVLCLQNKQEDAIPLYERALRIYEESLGPQHPRVAEVLVNLAKVYYDQGALGEAVRLYKEASDI 1303          

HSP 4 Score: 58.151 bits (139), Expect = 1.095e-8
Identity = 66/276 (23.91%), Postives = 122/276 (44.20%), Query Frame = 2
Query:  842 NESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTR--------------------NNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEF----DSFSSTISYLIRAYKAQGKLCEADLL 1597
            NE  P S+ IA L        +  G  ++A   L K+L +RE++L  +HPL+A +L+ +A L +  G    AE   ++A+ I +  LG++H  + K L  L++L +   +Y   E  +K+A++I   +     +  MK +                    N I  ++  QNN   ++  F+  L    E +  ED                 +S+     +  ++ +  K  PLY  + +++++ F       +ST+ +L   Y+ QGK  +A+ L
Sbjct:  951 NEDQP-SVLIANLYVAVGQFLKYLGLLSQAAPSLQKALEIRESVLDPDHPLVAQSLHYLAELYSHWGNFSAAEAFFKQAIEITQNALGADHFSLIKDLEGLSILYKKNEKYSLAESCHKRAIAIRQKSGVLIGVQAMKRKIIQVEELSLGPGSQELSRSLNEIGVLYYLQNNHEASKSFFQRSLAM-REEILGEDHPEVA------------QSLHNLAALYNDNKQYDKAEPLYKRALDIRLKAFSPEHSCVASTVKHLATLYRKQGKFDKAEPL 1212          
BLAST of kinesin light chain vs. Ensembl Nematostella
Match: EDO49938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFD0])

HSP 1 Score: 49.6766 bits (117), Expect = 4.199e-6
Identity = 42/174 (24.14%), Postives = 78/174 (44.83%), Query Frame = 2
Query:  854 PYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSS 1375
            P   DIAT     A V+    + A+AV    K++ V E +LG +HP   I   ++A+     G    A  +  RA  +     G  HPD++    N+ L+   Q  ++  E+  +KAL++    +G ++     + + +A      N+F  A +  K   + + ++  +ED  +
Sbjct:  934 PLHPDIATCYRAIARVHYLADDAAQAVGYQKKAVLVCERVLGVDHPETIIAFVHLALYCHSAGLASVALKLMYRARYLALLVFGEGHPDMSTFDSNIGLILHGQREFKISEKFMEKALNVQLKYHGNNSTQTAMSYHLLARAKACVNDFRAALMNEKSAYSVYKDKFGEEDPRT 1107          
BLAST of kinesin light chain vs. Ensembl Medaka
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:101163537])

HSP 1 Score: 273.863 bits (699), Expect = 2.556e-83
Identity = 196/500 (39.20%), Postives = 279/500 (55.80%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPL-PXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            LD L+ T      DE     EEKS  ++KSLE +ELG+ E +++++LS +   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD+ L PS    S  S +           +    I        +GS +             +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+Y+EVE  Y +AL IY    G D+ NV KT+NN+A  +LKQ+ F QAE ++KE+LT  HER        N    KP+W+  E+R     G+   +S       P   +    +  + DS   ++T+  L   YK QGK   A+ L++   RS KQ 
Sbjct:   46 LDGLLGTLRCLKQDEEGVLVEEKSHMIRKSLEMLELGLSEAQVMMALSTHLSSVESEKQKLRAQVRRLCQENQWLRDELAGTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDEDLSPSEEKDSDSSKETLDDLFPDDQDDQAPGI-----QPAHGSAAAA-----------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEYYYMRALEIYQTQLGPDDPNVAKTKNNLASCYLKQSKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREEKSKGKQKDSS-------PFGEYGGWYKACKVDSPTVTTTLKNLGALYKRQGKFEAAETLEEAAMRSRKQG 499          
BLAST of kinesin light chain vs. Ensembl Medaka
Match: klc1a (kinesin light chain 1 [Source:NCBI gene;Acc:101163537])

HSP 1 Score: 273.478 bits (698), Expect = 3.993e-82
Identity = 196/500 (39.20%), Postives = 279/500 (55.80%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPL-PXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            LD L+ T      DE     EEKS  ++KSLE +ELG+ E +++++LS +   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD+ L PS    S  S +           +    I        +GS +             +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++                 T G +  D     +AT+ NI ALVYRDQ  Y EA NLLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG +HPDVAKQL NLALLCQNQG+Y+EVE  Y +AL IY    G D+ NV KT+NN+A  +LKQ+ F QAE ++KE+LT  HER        N    KP+W+  E+R     G+   +S       P   +    +  + DS   ++T+  L   YK QGK   A+ L++   RS KQ 
Sbjct:   46 LDGLLGTLRCLKQDEEGVLVEEKSHMIRKSLEMLELGLSEAQVMMALSTHLSSVESEKQKLRAQVRRLCQENQWLRDELAGTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDEDLSPSEEKDSDSSKETLDDLFPDDQDDQAPGI-----QPAHGSAAAA-----------AAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED--------------LEKTSGHDHPD-----VATMLNILALVYRDQNKYKEAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEYYYMRALEIYQTQLGPDDPNVAKTKNNLASCYLKQSKFKQAETLYKEILTRAHEREFGSVDDEN----KPIWMHAEEREEKSKGKQKDSS-------PFGEYGGWYKACKVDSPTVTTTLKNLGALYKRQGKFEAAETLEEAAMRSRKQG 499          
BLAST of kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000010217.2 (kinesin light chain 2 [Source:NCBI gene;Acc:101159385])

HSP 1 Score: 271.166 bits (692), Expect = 1.856e-81
Identity = 190/480 (39.58%), Postives = 282/480 (58.75%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPL-PXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            +EKS  L+KSLE IELG+ E ++I++LS +   VE+ + KL A + RL +EN WLR+E++ATQ +LH +E+   +LE + K  E  ++++K+D    P+   +    D     E+  S  +L +   N+ +       +    D+       +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        + G +  D     +AT+ NI ALVYRDQ  Y EA +LLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IR + LG  HPDVAKQL NLALLCQNQG+Y+EVE  Y +AL IY    G D+ NV KT+NN+A  +LKQ  F  AE+++KE+LT  HE+      + N    KP+W+  E+R    S  + K+S       P   + +  +  + DS   ++T+  L   Y+ QGKL  A+ L++  SRS KQ 
Sbjct:   55 QEKSGLLRKSLEDIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELAATQHKLHCSEQSVAQLEEEKKHLEFMNQIKKFDDDASPAEEKNQSCGDGAGAGEA--SKDSLDDLFPNDDDQ----GPAQPSGDV-------AAQHAGYEIPVRLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------SSGHDHPD-----VATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRVKVLGKLHPDVAKQLNNLALLCQNQGKYDEVEYYYTQALEIYVSQLGPDDPNVAKTKNNLATCYLKQGKFKDAEVLYKEILTRAHEKEFGSVNNDN----KPIWMHAEEREE--SKGLRKDSG------PYVEYGSWYKACKVDSPTVNTTLKSLAALYRRQGKLEAAETLEECASRSRKQG 490          
BLAST of kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000016251.2 (kinesin light chain 1 [Source:NCBI gene;Acc:101171520])

HSP 1 Score: 271.166 bits (692), Expect = 2.219e-81
Identity = 189/499 (37.88%), Postives = 287/499 (57.52%), Query Frame = 2
Query:  140 LDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            L +L+ T      DE      EK+  L+KS+E IELG+ E +++++LS++   VE+ + KL A + RL +EN WLR+E++ TQ +L  +E+   +LE + K  E  ++L+KYD+ +     + +  D+    +S+       + ++   + + N     + N        +      Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K        T G +  D     +AT+ NI ALVYRDQ  Y EA +LLN +L++RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IRE+ LG  HPDVAKQL NLALLCQNQG+YEEVE  Y +AL IY    G D+ NV KT+NN+A   LKQ  + +AEI++KE+LT  HE+      + N    KP+W+  E+R     G+   N+       P   +    +  + +S   ++T+  L   Y+ QGKL  A+ L++   RS KQ 
Sbjct:   42 LHSLLETIKCLKKDEEANLVHEKANLLRKSVEMIELGLGEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQNVAQLEEEKKHLEFMNQLKKYDEDV---SPTQEEKDRETPKDSL-------DDLFPNEDEENNQGMQHQHNSAAVAAAQQG----GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK--------TSGHDHPD-----VATMLNILALVYRDQNKYKEAAHLLNDALSIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKEHPDVAKQLNNLALLCQNQGKYEEVEYYYCRALEIYECRLGPDDPNVAKTKNNLASCFLKQGKYKEAEILYKEILTRAHEKEFGSVDAEN----KPIWMHAEEREEMSKGKHRDNT-------PYGEYGGWYKACKVNSPTVNTTLRNLGALYRRQGKLEAAETLEECAVRSRKQG 496          
BLAST of kinesin light chain vs. Ensembl Medaka
Match: ENSORLT00000010213.2 (kinesin light chain 2 [Source:NCBI gene;Acc:101159385])

HSP 1 Score: 270.781 bits (691), Expect = 3.406e-81
Identity = 193/480 (40.21%), Postives = 281/480 (58.54%), Query Frame = 2
Query:  200 EEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPL-PXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDS--FSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQS 1630
            +EKS  L+KSLE IELG+ E ++I++LS +   VE+ + KL A + RL +EN WLR+E++ATQ +LH +E+   +LE + K  E  ++++K+D    P+   +    D     E+  S  +L +   N+ +       +    D+       +     Y++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K              S     D+AT+ NI ALVYRDQ  Y EA +LLN +L +RE  LG +HP +A TLNN+A+L  + GK +EAE +C+RAL IR + LG  HPDVAKQL NLALLCQNQG+Y+EVE  Y +AL IY    G D+ NV KT+NN+A  +LKQ  F  AE+++KE+LT  HE   KE  S N    KP+W+  E+R    S  + K+S       P   + +  +  + DS   ++T+  L   Y+ QGKL  A+ L++  SRS KQ 
Sbjct:   55 QEKSGLLRKSLEDIELGLGEAQVIIALSGHLSAVESEKQKLRAQVRRLCQENQWLRDELAATQHKLHCSEQSVAQLEEEKKHLEFMNQIKKFDDDASPAEEKNQSCGDGAGAGEA--SKDSLDDLFPNDDDQ----GPAQPSGDV-------AAQHAGYEIPVRLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEKS-------------SGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRVKVLGKLHPDVAKQLNNLALLCQNQGKYDEVEYYYTQALEIYVSQLGPDDPNVAKTKNNLATCYLKQGKFKDAEVLYKEILTRAHE---KEFGSVN-NDNKPIWMHAEEREE--SKGLRKDSG------PYVEYGSWYKACKVDSPTVNTTLKSLAALYRRQGKLEAAETLEECASRSRKQG 490          
BLAST of kinesin light chain vs. Planmine SMEST
Match: SMESG000007554.1 (SMESG000007554.1)

HSP 1 Score: 1038.87 bits (2685), Expect = 0.000e+0
Identity = 585/587 (99.66%), Postives = 585/587 (99.66%), Query Frame = 2
Query:   65 MKSSTTIIXXXXXXXXXXXXXXSDHLDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSETSSKYSFXXXXXXXXXXXXXXXXQVISSPDDSDFLISTKNPNSLSCKEYGQKC 1825
            MKSSTTIIRLAKTSLLALKSLRSDHLDNLILTNSPYSIDELVTFKEEKSQRLKKSLEKIELGIDEIELILSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPL SSYSSSQISDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPLIAITLNNIAILQAR GKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSETSSKYSFRRISNKISSKFKSIRSQVISSPDDSDFLISTKNPNSLSCKEYGQKC
Sbjct:    1 MKSSTTIIRLAKTSLLALKSLRSDHLDNLILTNSPYSIDELVTFKEEKSQRLKKSLEKIELGIDEIELILSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLLSSYSSSQISDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPLIAITLNNIAILQARIGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSETSSKYSFRRISNKISSKFKSIRSQVISSPDDSDFLISTKNPNSLSCKEYGQKC 587          
BLAST of kinesin light chain vs. Planmine SMEST
Match: SMESG000007554.1 (SMESG000007554.1)

HSP 1 Score: 943.34 bits (2437), Expect = 0.000e+0
Identity = 520/524 (99.24%), Postives = 520/524 (99.24%), Query Frame = 2
Query:   65 MKSSTTIIXXXXXXXXXXXXXXSDHLDNLILTNSPYSIDELVTFKEEKSQRLKKSXXXXXXXXXXXXXXXSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQSNK 1636
            MKSSTTIIRLAKTSLLALKSLRSDHLDNLILTNSPYSIDELVTFKEEKSQRLKKSLEKIELGIDEIELILSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPL SSYSSSQISDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPLIAITLNNIAILQAR GKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQ  K
Sbjct:    1 MKSSTTIIRLAKTSLLALKSLRSDHLDNLILTNSPYSIDELVTFKEEKSQRLKKSLEKIELGIDEIELILSLSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLLSSYSSSQISDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPLIAITLNNIAILQARIGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRSIKQHKK 524          
BLAST of kinesin light chain vs. Planmine SMEST
Match: SMESG000010732.1 (SMESG000010732.1)

HSP 1 Score: 273.478 bits (698), Expect = 7.786e-84
Identity = 183/449 (40.76%), Postives = 266/449 (59.24%), Query Frame = 2
Query:  278 LSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQV-NLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS-YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRS 1618
            L ++ +I E+ + KL   I RL++EN WLR+E++ TQ RL  +E+   +LE + K     +E+RKYD P      S   SD+V NLS  +      T+             K  E ND+   +   S++  S +++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K       N+G      P   D+AT+ NI ALVYRDQG Y EA NLLN +L +RE  LG  H  +A TLNN+A+L  + G+ +EAE +C+RAL IRE+ LGS+HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+ N+A  +LKQN F +AE ++KE+LT +HE+   +D       +KP+WVL E+R      +    + EI  L     +    +++   +  +T+  L   Y+ Q K   A+ +++W+SRS
Sbjct:   77 LYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDL----GFTDE-----------DKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK-------NSG---HDHP---DVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQ----QKPIWVLAEERQ-----ECFTKNKEIPYLSSDNCWHKSSRIDN-STVYTTLKNLSALYRRQNKTEAAETVENWISRS 481          
BLAST of kinesin light chain vs. Planmine SMEST
Match: SMESG000010732.1 (SMESG000010732.1)

HSP 1 Score: 273.478 bits (698), Expect = 4.241e-83
Identity = 183/449 (40.76%), Postives = 266/449 (59.24%), Query Frame = 2
Query:  278 LSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQV-NLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS-YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRS 1618
            L ++ +I E+ + KL   I RL++EN WLR+E++ TQ RL  +E+   +LE + K     +E+RKYD P      S   SD+V NLS  +      T+             K  E ND+   +   S++  S +++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K       N+G      P   D+AT+ NI ALVYRDQG Y EA NLLN +L +RE  LG  H  +A TLNN+A+L  + G+ +EAE +C+RAL IRE+ LGS+HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+ N+A  +LKQN F +AE ++KE+LT +HE+   +D       +KP+WVL E+R      +    + EI  L     +    +++   +  +T+  L   Y+ Q K   A+ +++W+SRS
Sbjct:   77 LYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDL----GFTDE-----------DKDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK-------NSG---HDHP---DVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQ----QKPIWVLAEERQ-----ECFTKNKEIPYLSSDNCWHKSSRIDN-STVYTTLKNLSALYRRQNKTEAAETVENWISRS 481          
BLAST of kinesin light chain vs. Planmine SMEST
Match: SMESG000010732.1 (SMESG000010732.1)

HSP 1 Score: 273.863 bits (699), Expect = 5.794e-83
Identity = 184/449 (40.98%), Postives = 266/449 (59.24%), Query Frame = 2
Query:  278 LSDYFEIVEANQMKLTAMIDRLSEENIWLREEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPXXXXXXXXXDQV-NLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNTYS-YDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQILGETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVRENLLGTNHPXXXXXXXXXXXXQARNGKLREAENMCRRALAIREQHLGSNHPDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRNNIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVEDRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYKAQGKLCEADLLDDWLSRS 1618
            L ++ +I E+ + KL   I RL++EN WLR+E++ TQ RL  +E+   +LE + K     +E+RKYD P      S   SD+V NLS  +   G   E             K  E ND+   +   S++  S +++P  L++LH+LV  Y+SQGR+EVA+ LCKQA+++      L+K       N+G      P   D+AT+ NI ALVYRDQG Y EA NLLN +L +RE  LG  H  +A TLNN+A+L  + G+ +EAE +C+RAL IRE+ LGS+HPDVAKQL NLALLCQNQG+YEEVE  Y++AL IY    G D+ NV KT+ N+A  +LKQN F +AE ++KE+LT +HE+   +D       +KP+WVL E+R      +    + EI  L     +    +++   +  +T+  L   Y+ Q K   A+ +++W+SRS
Sbjct:   77 LYEFLQISESERNKLKVQIGRLNQENNWLRDELTTTQFRLEASEKNVCQLEEENKQISFMNEMRKYDTPDSGKDPSINGSDKVDNLSSDL---GFTDED------------KDQEPNDVMMQSQSSSVSHGSGFEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALED------LEK-------NSG---HDHP---DVATMLNILALVYRDQGKYREAANLLNDALAIREKTLGPKHSAVAATLNNLAVLYGKRGRYKEAEPLCKRALLIREEALGSDHPDVAKQLNNLALLCQNQGKYEEVEMYYQRALEIYLQKSGPDDPNVAKTKTNLATAYLKQNKFSKAESLYKEILTRFHEQEFGKDNPQ----QKPIWVLAEERQ-----ECFTKNKEIPYLSSDNCWHKSSRIDN-STVYTTLKNLSALYRRQNKTEAAETVENWISRS 481          
The following BLAST results are available for this feature:
BLAST of kinesin light chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KLC41.291e-8037.42kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC41.291e-8037.42kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC41.291e-8037.42kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC41.927e-8037.22kinesin light chain 4 [Source:HGNC Symbol;Acc:HGNC... [more]
KLC13.105e-7840.93kinesin light chain 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of kinesin light chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc-21.007e-7737.61Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-21.007e-7737.61Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-21.399e-7737.61Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-21.399e-7737.61Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
klc-22.788e-7737.61Kinesin light chain [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of kinesin light chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Klc7.924e-8237.66gene:FBgn0010235 transcript:FBtr0331556[more]
Klc8.757e-8237.66gene:FBgn0010235 transcript:FBtr0075951[more]
Klc8.757e-8237.66gene:FBgn0010235 transcript:FBtr0331555[more]
back to top
BLAST of kinesin light chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc1a7.744e-8138.64kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc1a8.533e-8138.64kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
klc42.108e-7636.88kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc42.108e-7636.88kinesin light chain 4 [Source:ZFIN;Acc:ZDB-GENE-05... [more]
klc31.493e-7440.64kinesin light chain 3 [Source:ZFIN;Acc:ZDB-GENE-06... [more]
back to top
BLAST of kinesin light chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hira4.283e-7144.58histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira8.005e-7144.58histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira3.586e-7044.58histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira4.579e-7044.58histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
hira6.890e-7045.20histone cell cycle regulator [Source:Xenbase;Acc:X... [more]
back to top
BLAST of kinesin light chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klc42.967e-8338.29kinesin light chain 4 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc42.967e-8338.29kinesin light chain 4 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc13.346e-7940.93kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc17.765e-7940.93kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Klc17.885e-7941.40kinesin light chain 1 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of kinesin light chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DBS5|KLC4_MOUSE2.075e-8238.29Kinesin light chain 4 OS=Mus musculus OX=10090 GN=... [more]
sp|P46825|KLC_DORPE2.801e-8239.17Kinesin light chain OS=Doryteuthis pealeii OX=1051... [more]
sp|P46824|KLC_DROME8.778e-8137.66Kinesin light chain OS=Drosophila melanogaster OX=... [more]
sp|Q9NSK0|KLC4_HUMAN6.201e-8037.42Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=K... [more]
sp|Q5PQM2|KLC4_RAT1.517e-7937.88Kinesin light chain 4 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of kinesin light chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2Z6331.354e-8639.57TPR_REGION domain-containing protein OS=Ciona savi... [more]
A0A4S2LDN01.715e-8539.20TPR_REGION domain-containing protein OS=Opisthorch... [more]
A0A210QE778.626e-8539.47Kinesin light chain OS=Mizuhopecten yessoensis OX=... [more]
A0A1S3IGZ41.155e-8439.58kinesin light chain isoform X10 OS=Lingula unguis ... [more]
A0A1S3IGY91.480e-8439.58kinesin light chain isoform X5 OS=Lingula unguis O... [more]
back to top
BLAST of kinesin light chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc1a5.789e-8439.46kinesin light chain 1 [Source:NCBI gene;Acc:103045... [more]
klc1a2.845e-8339.46kinesin light chain 1 [Source:NCBI gene;Acc:103045... [more]
klc1a7.136e-8339.46kinesin light chain 1 [Source:NCBI gene;Acc:103045... [more]
ENSAMXT00000003218.23.442e-8137.11kinesin light chain 1-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000055945.17.271e-8038.54kinesin light chain 2-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of kinesin light chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009139.18.112e-8538.29pep scaffold:Pmarinus_7.0:GL480151:1445:19017:1 ge... [more]
klc1a2.543e-7837.67kinesin light chain 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000001329.11.829e-2437.50pep scaffold:Pmarinus_7.0:GL484789:104:2647:1 gene... [more]
nphp31.868e-1327.65nephronophthisis 3 [Source:NCBI gene;Acc:562601][more]
back to top
BLAST of kinesin light chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of kinesin light chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO430091.504e-7838.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376033.825e-1430.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499384.199e-624.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of kinesin light chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klc1a2.556e-8339.20kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
klc1a3.993e-8239.20kinesin light chain 1 [Source:NCBI gene;Acc:101163... [more]
ENSORLT00000010217.21.856e-8139.58kinesin light chain 2 [Source:NCBI gene;Acc:101159... [more]
ENSORLT00000016251.22.219e-8137.88kinesin light chain 1 [Source:NCBI gene;Acc:101171... [more]
ENSORLT00000010213.23.406e-8140.21kinesin light chain 2 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of kinesin light chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007554.10.000e+099.66SMESG000007554.1[more]
SMESG000007554.10.000e+099.24SMESG000007554.1[more]
SMESG000010732.17.786e-8440.76SMESG000010732.1[more]
SMESG000010732.14.241e-8340.76SMESG000010732.1[more]
SMESG000010732.15.794e-8340.98SMESG000010732.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009297 ID=SMED30009297|Name=kinesin light chain|organism=Schmidtea mediterranea sexual|type=transcript|length=2050bp
TGCAAATTTTAAATCATTAAATAAACATTGAAATTATTAATAAATTTTGA
ATTATAAATTATAGATGAAAAGCTCAACAACCATAATAAGACTTGCAAAA
ACATCATTATTAGCTTTAAAATCGCTAAGATCAGATCACCTTGATAATCT
TATCTTAACAAATTCTCCTTATTCTATTGATGAGTTAGTAACTTTTAAAG
AAGAAAAGTCTCAGCGATTGAAAAAATCATTGGAAAAAATTGAACTTGGA
ATTGATGAAATAGAACTAATTTTAAGTCTTTCCGATTATTTTGAAATCGT
TGAAGCCAACCAAATGAAGTTAACTGCAATGATAGACCGATTATCTGAAG
AAAATATCTGGCTACGAGAAGAGATTAGCGCTACTCAATCACGATTACAT
GTTACTGAAGAGCAAAACATCGAGTTAGAAAGTCAAATTAAAGATTATGA
ATTGAAATCGGAACTGAGAAAATATGATCAGCCTCTACCAAGTAGTTATT
CTAGTAGTCAGATATCTGATCAAGTTAATCTTTCCGAGTCAATAATTTCT
GGAGGTAACCTTACAGAAAGCATATATAACGAAATTAATTCAAAAAGAAA
TGGTAGTAAATCTACGGAAAGAAATGATTTGAAAAATATAAATTGTCCAG
AAAGTTTAAATACATACAGTTATGATTTACCCGATCATTTGAAAAGTTTA
CATTCATTGGTCACTGATTATTCTAGCCAAGGTCGGTTTGAAGTTGCCAT
GGCACTCTGCAAACAAGCCATTCAAAATGAAGTGAATACTCTATCATTAA
AAAAGCAAATATTGGGTGAAACTAACAATACAGGTGGTGTTAATGAATCG
GACCCATACAGTTTAGATATTGCCACACTACAAAATATATTTGCTTTAGT
TTATAGAGATCAAGGAAATTATGCGGAAGCTGTTAATCTTTTGAATAAAT
CTCTTACTGTTAGAGAAAATCTGCTAGGAACAAATCATCCACTTATCGCC
ATAACTTTGAACAACATTGCGATTCTTCAAGCTAGAAATGGAAAGCTACG
AGAAGCAGAAAATATGTGTAGGAGGGCTTTAGCTATTCGTGAACAACATT
TGGGTAGCAATCATCCTGATGTGGCTAAGCAATTATTCAATTTAGCACTT
TTATGTCAAAATCAAGGAAGATATGAAGAAGTGGAACAAATTTATAAGAA
AGCATTATCAATATATGCGGATAATTACGGTGCTGATAATATCAATGTTA
TGAAAACTCGTAATAATATAGCATACGTACATTTGAAACAAAATAATTTT
TTACAAGCTGAAATTATTTTTAAAGAGTTATTGACATGCTGGCATGAAAG
ACTTACAAAGGAAGATAAATCAAGTAATGTTTTTCCCAAGAAACCGCTTT
GGGTTTTAGTTGAAGATAGATCCGTGTTTGGTTCTGGCCAAATTTTAAAA
AATTCAGCAGAAATTCAGAAATTACTACCTCTTTATTCCTTCTCAGCTGA
ATTGCAAATGGAAGAATTCGACTCATTTTCCTCTACTATCTCATACTTAA
TTCGTGCTTATAAAGCCCAAGGAAAATTATGTGAAGCTGATCTTTTAGAC
GATTGGTTATCCCGATCAATAAAACAGAGTAACAAGGGTGCTTCGGTTGT
CGATACACTTTCTGAAACGTCTTCCAAGTATTCATTTCGTCGAATTAGTA
ATAAAATTTCATCAAAATTCAAATCCATCCGTTCTCAAGTAATTTCTAGT
CCAGATGATAGCGATTTTCTCATCAGCACAAAAAATCCAAATTCACTTAG
TTGTAAAGAATATGGTCAAAAATGTTGAAGATGTTTGACATTTAAAATCC
GGGTTTGAACTATTTTTATGCAATTTGTTTAAAAAAATATAATTGAATAA
AGTTTATCTTAAATGTAGTTTATTCGTTTTAGTGCATGTTAATTATATAT
TTTATTGATCTAATTTGTAACTGTTATATTGAATTGTTTTAAGGATTTGA
TTATTTCAGATTTTTGTTGAATGCTAATAAAATTATTTAAACTATAATCA
back to top

protein sequence of SMED30009297-orf-1

>SMED30009297-orf-1 ID=SMED30009297-orf-1|Name=SMED30009297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=588bp
MKSSTTIIRLAKTSLLALKSLRSDHLDNLILTNSPYSIDELVTFKEEKSQ
RLKKSLEKIELGIDEIELILSLSDYFEIVEANQMKLTAMIDRLSEENIWL
REEISATQSRLHVTEEQNIELESQIKDYELKSELRKYDQPLPSSYSSSQI
SDQVNLSESIISGGNLTESIYNEINSKRNGSKSTERNDLKNINCPESLNT
YSYDLPDHLKSLHSLVTDYSSQGRFEVAMALCKQAIQNEVNTLSLKKQIL
GETNNTGGVNESDPYSLDIATLQNIFALVYRDQGNYAEAVNLLNKSLTVR
ENLLGTNHPLIAITLNNIAILQARNGKLREAENMCRRALAIREQHLGSNH
PDVAKQLFNLALLCQNQGRYEEVEQIYKKALSIYADNYGADNINVMKTRN
NIAYVHLKQNNFLQAEIIFKELLTCWHERLTKEDKSSNVFPKKPLWVLVE
DRSVFGSGQILKNSAEIQKLLPLYSFSAELQMEEFDSFSSTISYLIRAYK
AQGKLCEADLLDDWLSRSIKQSNKGASVVDTLSETSSKYSFRRISNKISS
KFKSIRSQVISSPDDSDFLISTKNPNSLSCKEYGQKC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
Vocabulary: INTERPRO
TermDefinition
IPR002151Kinesin_light
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005515protein binding
GO:0015631tubulin binding
Vocabulary: cellular component
TermDefinition
GO:0005871kinesin complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0016020membrane
GO:0030424axon
GO:0030426growth cone
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
GO:0042995cell projection
GO:0043005neuron projection
GO:0043025neuronal cell body
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0035418protein localization to synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 104..131
NoneNo IPR availablePFAMPF13424TPR_12coord: 268..344
e-value: 6.8E-19
score: 67.9
coord: 358..423
e-value: 2.0E-11
score: 44.0
NoneNo IPR availablePANTHERPTHR45783FAMILY NOT NAMEDcoord: 6..537
IPR002151Kinesin light chainPRINTSPR00381KINESINLIGHTcoord: 88..105
score: 49.44
coord: 303..324
score: 34.09
coord: 268..288
score: 40.0
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 396..429
e-value: 51.0
score: 8.8
coord: 312..345
e-value: 0.0066
score: 25.7
coord: 270..303
e-value: 0.21
score: 20.7
coord: 354..387
e-value: 0.0012
score: 28.1
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 270..303
score: 7.788
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 354..387
score: 8.319
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 312..345
score: 6.431
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 191..522
e-value: 2.1E-76
score: 258.8
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 213..426
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 270..387
score: 14.718