Protein kinase, putative

Overview
NameProtein kinase, putative
Smed IDSMED30009287
Length (bp)2690
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase, putative (SMED30009287) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase, putative (SMED30009287) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase, putative (SMED30009287) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase, putative (SMED30009287) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009287

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009287SMESG000030829.1 Contig5846GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009287SMESG000074416.1 SMESG000074407.1 Contig6032newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009287SMESG000074416.1 SMESG000074407.1 Contig6032uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30009287SMESG000074416.1 SMESG000074407.1 Contig1629GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30009287SMESG000074416.1 SMESG000074407.1 Contig1629GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009287SMESG000074416.1 SMESG000074409.1 Contig5846GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior region of the whole animalSMED30009287SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074407.1 Contig6176newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074407.1 Contig6176uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000030829.1 Contig5846GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074407.1 Contig6032newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074407.1 Contig6032uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074409.1 Contig5846GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30009287SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009287SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009287SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009287SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009287SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009287SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009287SMESG000074416.1 SMESG000074409.1 SMESG000074407.1 dd_Smed_v4_7011_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009287SMESG000074416.1 SMESG000074409.1 SMESG000074407.1 dd_Smed_v4_7011_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30009287SMESG000074416.1 SMESG000074409.1 SMESG000074407.1 dd_Smed_v4_7011_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074407.1 Contig3811uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074407.1 Contig3811newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074415.1 SMESG000074407.1 Contig11841uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000074416.1 SMESG000074415.1 SMESG000074407.1 Contig11841newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000071859.1 SMESG000020398.1 Contig3811uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009287SMESG000071859.1 SMESG000020398.1 Contig3811newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30009287SMESG000074407.1 SMESG000074416.1 dd_Smed_v6_3361_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase, putative vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 87.0409 bits (214), Expect = 2.197e-18
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:   15 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 238          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 86.6557 bits (213), Expect = 3.955e-17
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  195 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 418          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 86.6557 bits (213), Expect = 7.585e-17
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  293 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 516          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 85.8853 bits (211), Expect = 1.005e-16
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  293 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 516          
BLAST of Protein kinase, putative vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 85.8853 bits (211), Expect = 1.075e-16
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  293 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 516          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 73.559 bits (179), Expect = 5.263e-13
Identity = 59/242 (24.38%), Postives = 118/242 (48.76%), Query Frame = 1
Query: 1501 ILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKY-----RYMAPEILSCDK----------YGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEY-DVEDIENELQGFMPLVNSCLKRIPEERAKMDSLLIKTKPN*AISY 2178
            I +E+ IF+    +++ V+     +  S + +  E+ S G L+  + + K+ +   R++++ +L  +++LH  ++IHRD+ P+NI+LD+   LKL             ++ ++   +VY   +      ++MAPEI S  +          YG+  DIW+ GA ++ ++TGK P+     +Q    +        Y D+ D   +++ F    ++C + +P +R     LL  T  N  I++
Sbjct: 1166 IESEINIFRQL-IHENLVKYYGVQVEDSDVIIFMEYCSQGTLER-ICHGKMDLKMVRQYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDF--------GCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGKVPFEGQTRHQIAFALCFRKQKPTYPDIADKRPDVKRFF---DNCFEFLPNDRPTAAELLQTTFANVNITF 1394          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 72.0182 bits (175), Expect = 9.046e-13
Identity = 59/217 (27.19%), Postives = 100/217 (46.08%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            E I+NE+ + +  K+  + V   D++L    L V  E+++ G L   +   ++          ++L  L+FLH + VIHRD+   NI L         S  L+ F      +    K++      Y +MAPE+++  +YG + D+WS G + I ++ G+ PY   +  +  I +I  NG  ++   D    L  F   V+S L+   E R     LL
Sbjct:  286 ELIINEILVMRENKH-ANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQLSPEQRKRTTMVGTPY-WMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLR-AIYLIATNGKPDFPGRDSMTLL--FKDFVDSALEVQVENRWSASQLL 492          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 72.7886 bits (177), Expect = 9.942e-13
Identity = 58/191 (30.37%), Postives = 93/191 (48.69%), Query Frame = 1
Query: 1600 TEFMSNGMLKTYLKNHK-VSVNEFRKWSHQILLGLKFLH--DQQVIHRDLNPSNIYLDEXXXXXX-XXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSE----YHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLLI 2148
            TE M++G LK YLK  K +++   + W  QIL GL FLH  +  VIHRDL   NI++             L+  ++   A SV+G           +MAPE+   + Y +  D+++FG  L+ ++TG+ PYSE       Y+ VI     +G        I  +      +++ C++   EER+ +  LL+
Sbjct:  416 TELMTSGTLKMYLKRFKRINIKVLKSWCRQILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTP--------EFMAPEMYE-EMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVI-----SGVKPECFSRIPAQYPEIREIIDRCIRVRREERSTVKQLLV 592          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 72.7886 bits (177), Expect = 9.942e-13
Identity = 58/191 (30.37%), Postives = 93/191 (48.69%), Query Frame = 1
Query: 1600 TEFMSNGMLKTYLKNHK-VSVNEFRKWSHQILLGLKFLH--DQQVIHRDLNPSNIYLDEXXXXXX-XXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSE----YHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLLI 2148
            TE M++G LK YLK  K +++   + W  QIL GL FLH  +  VIHRDL   NI++             L+  ++   A SV+G           +MAPE+   + Y +  D+++FG  L+ ++TG+ PYSE       Y+ VI     +G        I  +      +++ C++   EER+ +  LL+
Sbjct:  416 TELMTSGTLKMYLKRFKRINIKVLKSWCRQILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTP--------EFMAPEMYE-EMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVI-----SGVKPECFSRIPAQYPEIREIIDRCIRVRREERSTVKQLLV 592          
BLAST of Protein kinase, putative vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 72.7886 bits (177), Expect = 1.012e-12
Identity = 58/237 (24.47%), Postives = 115/237 (48.52%), Query Frame = 1
Query: 1501 ILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKY-----RYMAPEILSCDK----------YGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEY-DVEDIENELQGFMPLVNSCLKRIPEERAKMDSLLIKTKPN 2163
            I +E+ IF+    +++ V+     +  S + +  E+ S G L+  + + K+ +   R++++ +L  +++LH  ++IHRD+ P+NI+LD+   LKL             ++ ++   +VY   +      ++MAPEI S  +          YG+  DIW+ GA ++ ++TGK P+     +Q    +        Y D+ D   +++ F    ++C + +P +R     LL  T  N
Sbjct: 1166 IESEINIFRQL-IHENLVKYYGVQVEDSDVIIFMEYCSQGTLER-ICHGKMDLKMVRQYTNSLLRAVQYLHSHKIIHRDIKPANIFLDKCTVLKLGDF--------GCSSRLVESSTVYGEFQTTAGTPQFMAPEIYSYGEKDETTGSYSGYGRSVDIWALGATVVNMMTGKVPFEGQTRHQIAFALCFRKQKPTYPDIADKRPDVKRFF---DNCFEFLPNDRPTAAELLQTTFAN 1389          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: Gprk1 (gene:FBgn0260798 transcript:FBtr0345363)

HSP 1 Score: 74.3294 bits (181), Expect = 3.058e-13
Identity = 53/175 (30.29%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 1486 KGDEFILNELKIFQ--TTKYNQSFVQLCDT--FLTGSSLCVSTEFMSNGMLKTYLKNHKV-SVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXX-XXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIW-SFGAVLIRIITGKRPYSEY 1989
            +G+   LNE  + Q  +T  +  F+ +C T  F T   LC   + M+ G L  +L  H + S +E + ++ +++LGL+ +H + +++RDL P+NI LDE              F   K  ASV           + YMAPE+LS       C  W SFG +L +++ G  P+ ++
Sbjct:  231 QGEMLALNERNMLQAVSTGIDCPFI-VCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGIFSEDEMKFYAAEVILGLEHMHKRCIVYRDLKPANILLDENGHIRISDLGLACDFSKKKPHASVG---------THGYMAPEVLSKGTSYDSCADWFSFGCMLYKLLKGHSPFRQH 395          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: Gprk1 (gene:FBgn0260798 transcript:FBtr0302242)

HSP 1 Score: 74.3294 bits (181), Expect = 3.058e-13
Identity = 53/175 (30.29%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 1486 KGDEFILNELKIFQ--TTKYNQSFVQLCDT--FLTGSSLCVSTEFMSNGMLKTYLKNHKV-SVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXX-XXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIW-SFGAVLIRIITGKRPYSEY 1989
            +G+   LNE  + Q  +T  +  F+ +C T  F T   LC   + M+ G L  +L  H + S +E + ++ +++LGL+ +H + +++RDL P+NI LDE              F   K  ASV           + YMAPE+LS       C  W SFG +L +++ G  P+ ++
Sbjct:  231 QGEMLALNERNMLQAVSTGIDCPFI-VCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGIFSEDEMKFYAAEVILGLEHMHKRCIVYRDLKPANILLDENGHIRISDLGLACDFSKKKPHASVG---------THGYMAPEVLSKGTSYDSCADWFSFGCMLYKLLKGHSPFRQH 395          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: Gprk1 (gene:FBgn0260798 transcript:FBtr0111121)

HSP 1 Score: 74.3294 bits (181), Expect = 3.058e-13
Identity = 53/175 (30.29%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 1486 KGDEFILNELKIFQ--TTKYNQSFVQLCDT--FLTGSSLCVSTEFMSNGMLKTYLKNHKV-SVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXX-XXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIW-SFGAVLIRIITGKRPYSEY 1989
            +G+   LNE  + Q  +T  +  F+ +C T  F T   LC   + M+ G L  +L  H + S +E + ++ +++LGL+ +H + +++RDL P+NI LDE              F   K  ASV           + YMAPE+LS       C  W SFG +L +++ G  P+ ++
Sbjct:  231 QGEMLALNERNMLQAVSTGIDCPFI-VCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGIFSEDEMKFYAAEVILGLEHMHKRCIVYRDLKPANILLDENGHIRISDLGLACDFSKKKPHASVG---------THGYMAPEVLSKGTSYDSCADWFSFGCMLYKLLKGHSPFRQH 395          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 73.1738 bits (178), Expect = 6.942e-13
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVED-IENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            E I+NE+ + +  K+  + V   D++L    L V  E++  G L   +    +   +      ++L  L+FLH  QVIHRD+   NI L         S  L+ F      +    K++      Y +MAPE+++  +YG + D+WS G + I ++ G+ PY   +  +  + +I  NG  E   +D + +  Q F+   + CL+   + RA    LL
Sbjct:  470 ELIINEILVMRENKH-PNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLG-----LDGSVKLTDFGFCAQISPEQSKRTTMVGTPY-WMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLK-ALYLIATNGKPEIKEKDKLSSAFQDFL---DQCLEVEVDRRASALDLL 676          
BLAST of Protein kinase, putative vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 73.1738 bits (178), Expect = 6.942e-13
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVED-IENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            E I+NE+ + +  K+  + V   D++L    L V  E++  G L   +    +   +      ++L  L+FLH  QVIHRD+   NI L         S  L+ F      +    K++      Y +MAPE+++  +YG + D+WS G + I ++ G+ PY   +  +  + +I  NG  E   +D + +  Q F+   + CL+   + RA    LL
Sbjct:  470 ELIINEILVMRENKH-PNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLG-----LDGSVKLTDFGFCAQISPEQSKRTTMVGTPY-WMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLK-ALYLIATNGKPEIKEKDKLSSAFQDFL---DQCLEVEVDRRASALDLL 676          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 84.7297 bits (208), Expect = 1.431e-16
Identity = 68/239 (28.45%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  265 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELL 488          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 84.7297 bits (208), Expect = 1.431e-16
Identity = 68/239 (28.45%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  265 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELL 488          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 84.7297 bits (208), Expect = 1.431e-16
Identity = 68/239 (28.45%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  265 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELL 488          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 84.7297 bits (208), Expect = 1.514e-16
Identity = 68/239 (28.45%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  266 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELL 489          
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 84.3445 bits (207), Expect = 2.235e-16
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  327 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAVFRDFLNRCLEMDVEKRGSAKELL 550          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 85.5001 bits (210), Expect = 7.860e-17
Identity = 64/239 (26.78%), Postives = 112/239 (46.86%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K+  + V   D++L G  L V  E+++ G L   +    +   E      + L  L+FLH  QVIHRD+   NI L         +  L+ F      +    K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +  +  + +I  NGT +  +++ E +   F   ++ CL+   E+R     LL
Sbjct:  188 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENKHP-NIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGAVKLTDFGFCAQISPEQNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLL 411          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 86.2705 bits (212), Expect = 8.025e-17
Identity = 64/239 (26.78%), Postives = 112/239 (46.86%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K+  + V   D++L G  L V  E+++ G L   +    +   E      + L  L+FLH  QVIHRD+   NI L         +  L+ F      +    K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +  +  + +I  NGT +  +++ E +   F   ++ CL+   E+R     LL
Sbjct:  269 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENKH-PNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGAVKLTDFGFCAQISPEQNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLL 492          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 84.7297 bits (208), Expect = 1.517e-16
Identity = 60/217 (27.65%), Postives = 103/217 (47.47%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            E I+NE+ + +  K+  + V   D++L G  L V  E+++ G L   +    +   E      + L  L+FLH  QVIHRD+   NI L         +  L+ F      +    K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +  +  + +I  NGT +  +++ E +   F   ++ CL+   E+R     LL
Sbjct:  220 ELIINEILVMRENKH-PNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGAVKLTDFGFCAQISPEQNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLL 426          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 84.7297 bits (208), Expect = 2.031e-16
Identity = 60/217 (27.65%), Postives = 103/217 (47.47%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            E I+NE+ + +  K+  + V   D++L G  L V  E+++ G L   +    +   E      + L  L+FLH  QVIHRD+   NI L         +  L+ F      +    K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +  +  + +I  NGT +  +++ E +   F   ++ CL+   E+R     LL
Sbjct:  251 ELIINEILVMRENKH-PNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGAVKLTDFGFCAQISPEQNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLL 457          
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 84.7297 bits (208), Expect = 2.050e-16
Identity = 60/217 (27.65%), Postives = 103/217 (47.47%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            E I+NE+ + +  K+  + V   D++L G  L V  E+++ G L   +    +   E      + L  L+FLH  QVIHRD+   NI L         +  L+ F      +    K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +  +  + +I  NGT +  +++ E +   F   ++ CL+   E+R     LL
Sbjct:  244 ELIINEILVMRENKH-PNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGAVKLTDFGFCAQISPEQNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLL 450          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 86.2705 bits (212), Expect = 6.508e-17
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  292 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 515          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 86.2705 bits (212), Expect = 6.508e-17
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  292 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 515          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Pak2 (p21 (RAC1) activated kinase 2 [Source:MGI Symbol;Acc:MGI:1339984])

HSP 1 Score: 84.3445 bits (207), Expect = 2.312e-16
Identity = 67/239 (28.03%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  272 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MEGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELL 495          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 83.9593 bits (206), Expect = 3.610e-16
Identity = 67/239 (28.03%), Postives = 108/239 (45.19%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   + R     LL
Sbjct:  291 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPERLSAVFRDFLNRCLEMDVDRRGSAKELL 514          
BLAST of Protein kinase, putative vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 83.9593 bits (206), Expect = 3.610e-16
Identity = 67/239 (28.03%), Postives = 108/239 (45.19%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   + R     LL
Sbjct:  291 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPERLSAVFRDFLNRCLEMDVDRRGSAKELL 514          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q08E52|PAK1_BOVIN (Serine/threonine-protein kinase PAK 1 OS=Bos taurus OX=9913 GN=PAK1 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.840e-16
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  292 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 515          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q13153|PAK1_HUMAN (Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 5.163e-16
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  293 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 516          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|P35465|PAK1_RAT (Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus OX=10116 GN=Pak1 PE=1 SV=3)

HSP 1 Score: 85.8853 bits (211), Expect = 5.237e-16
Identity = 69/239 (28.87%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  292 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 515          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q6CVA2|STE20_KLULA (Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=STE20 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.065e-15
Identity = 70/238 (29.41%), Postives = 116/238 (48.74%), Query Frame = 1
Query: 1435 NILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEY-DVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            ++ +K  +LE   K      E I+NE+ + + +K+N + V   D++L    L V  E+M  G L   + +  ++  +    S + L GL+FLH + VIHRD+   NI L            L+ F        V  K++      Y +MAPE++S  +YG + DIWS G ++I +I G+ PY      +  + +I  NGT +  D  ++ +++  F+   N CL   PE+R     LL
Sbjct:  723 SVAIKQMNLEKQPKK-----ELIVNEILVMKGSKHN-NIVNFIDSYLFRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLS-----MNGDIKLTDFGFCAQINEVNLKRTTMVGTPY-WMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLR-ALYLIATNGTPKLKDPGNLSHKMAMFL---NWCLMVDPEDRGTAADLL 944          
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Match: sp|Q94C95|ATG1A_ARATH (Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana OX=3702 GN=ATG1A PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.275e-15
Identity = 65/210 (30.95%), Postives = 104/210 (49.52%), Query Frame = 1
Query: 1501 ILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNH-KVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQG-FMPLVNSCLKRIPEER 2124
            +L E+ I  T  +  + ++  +   TG  + +  E+ S G L  Y+  H KV     + +  Q+ LGL+ L ++  IHRDL P N+ L  K    L       F    T  S M +      L   YMAPEI+   KY  + D+WS GA+L +++TGK P+   ++ Q + + I+ +  +++  ED  NE+    + L  S L+R P ER
Sbjct:   54 LLKEISILSTIDH-PNIIRFYEAIETGDRIFLVLEYCSGGDLAGYINRHGKVPEAVAKHFMRQLALGLQVLQEKHFIHRDLKPQNLLLSSKEVTPLLKIGDFGFARSLTPES-MAETFCGSPL---YMAPEIIRNQKYDAKADLWSAGAILFQLVTGKPPFDGNNHIQ-LFHNIVRDTELKFP-EDTRNEIHPDCVDLCRSLLRRNPIER 256          
BLAST of Protein kinase, putative vs. TrEMBL
Match: Q069I6 (MAP kinase kinase OS=Oryza minuta OX=63629 GN=MKK1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.840e-16
Identity = 65/217 (29.95%), Postives = 106/217 (48.85%), Query Frame = 1
Query: 1501 ILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEF-RKWSHQILLGLKFLH-DQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            I  ELKI  +T+  Q  V  C  F     + +  E+M  G L  +LK  K     +      Q+L GL +LH ++++IHRDL PSNI ++   ++K+S      F      AS   ++  +    Y YMAPE +S  K+G   DIWS G V++ + TG+ PY     + +++  ++E+       +    E   F   V++CL++   +R+    LL
Sbjct:  108 IAQELKISLSTQC-QYVVACCQCFYVNGVISIVLEYMDGGSLSDFLKTVKTIPEPYLAAICKQVLKGLMYLHHEKRIIHRDLKPSNILINHMGEVKISD-----FGVSAIIASSSAQRDTFTG-TYNYMAPERISGQKHGYMSDIWSLGLVILELATGEFPYPRRESFYELLEAVVEHPPPSASADQFTEE---FCSFVSACLQKKASDRSSAQILL 314          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A2V1AIA8 (Non-specific serine/threonine protein kinase OS=[Candida] duobushaemulonis OX=1231522 GN=CXQ87_004531 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.279e-16
Identity = 70/244 (28.69%), Postives = 123/244 (50.41%), Query Frame = 1
Query: 1426 KGENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSS-LCVSTEFMSNGMLKTYLKNHKVSVNEFRKWS--HQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEY-DVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            +G+ + +K   L+   +      E I+NE+ + + +++  + V   D++L GSS L V  E+M  G L   ++N++  +NE +  +  H+ L GL+FLH +Q+IHRD+   N+ LD        +  ++ F           K++      Y +MAPE++   +Y  + D+WS G + I +I G+ PY      +  + +I  NGT E  + + +  E+  F+   + CL   PE R   DSLL
Sbjct:  493 RGQKVAIKQMDLKVQPRK-----ELIINEILVMKDSQH-ANIVNFLDSYLRGSSDLLVVMEYMEGGSLTEVIENNETKLNENQIATICHETLKGLQFLHRKQIIHRDIKSDNVLLD-----AKGNVKITDFGFCAKLTDQRSKRATMVGTPY-WMAPEVVKQREYDGKVDVWSLGIMTIEMIEGEPPYLNEEPLK-ALYLIATNGTPELKNPKAVSEEMMNFL---SCCLILQPEARGSTDSLL 720          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A1R2CWZ9 (Protein kinase domain-containing protein OS=Stentor coeruleus OX=5963 GN=SteCoe_3518 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.318e-16
Identity = 62/186 (33.33%), Postives = 103/186 (55.38%), Query Frame = 1
Query: 1603 EFMSNGMLKTYLKNHK-VSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXX-XXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHY-YQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLLIK 2151
            E++  G LK+ L  +K + ++  R +S Q+L GLK+LHD ++IHRDL P+N+ +     LKL+   +  +F+  ++  S   K S Y      +MAPE++  + +    D+WSFG +LI + +GK P+S Y    + V+ +I + G++  D+   E  LQ    ++  C+ R P ER     LL K
Sbjct:  143 EYVPGGSLKSILVKYKSLEISVIRNYSRQLLEGLKYLHDNKIIHRDLKPANVLISPTGVLKLTDFGSSKQFDDLESNLSRSLKGSPY------WMAPEVVRMEGHSFSADVWSFGCILIEMTSGKPPWSNYSNDSKIVMELISKEGSLP-DIPSTEPLLQ---EIITQCVNRNPNERPSPQELLEK 318          
BLAST of Protein kinase, putative vs. TrEMBL
Match: A0A1Y1JI41 (Serine/threonine-protein kinase Nek1 OS=Plasmodium gonderi OX=77519 GN=PGO_100550 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.532e-16
Identity = 53/166 (31.93%), Postives = 88/166 (53.01%), Query Frame = 1
Query: 1501 ILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHK-----VSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXX-XXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 1980
            ++NEL+       +   V+  + FL  ++LCV  ++ S G L  Y+K +K     +  ++ R+W  QI+  +KF+HD+++IHRDL  +NI+LDE    K+     +  FEH + A ++ G           YMAPEI     Y    DIWS G +L  +++ + P+
Sbjct:   55 VVNELRALVEVSMHPFIVRYKEAFLENNTLCVVMDYCSKGDLGQYIKRNKKMKTFIPESKIRRWLLQIITAIKFMHDKKLIHRDLKCNNIFLDEDERAKVGDFGLVKIFEHTEEAHTLCGTIG--------YMAPEICKNAPYSFPADIWSLGVILYELMSLRHPF 212          
BLAST of Protein kinase, putative vs. TrEMBL
Match: V4UFF0 (Protein kinase domain-containing protein OS=Citrus clementina OX=85681 GN=CICLE_v10008579mg PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.608e-16
Identity = 69/249 (27.71%), Postives = 121/249 (48.59%), Query Frame = 1
Query: 1471 VKDGWKGDEFILNELK----------IFQTTKYNQS----FVQLC-DTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEF-RKWSHQILLGLKFLH-DQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSE------YHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLLI 2148
            V+  W G  F L  ++          I Q  K NQS    +V +C  +F +  ++ +  E+M  G L  +LK  K    E+      Q+L GL +LH ++ +IHRDL PSN+ ++ + ++K++      F      AS  G+ + +    Y YM+PE +S  KYG + DIWS G VL+   TG+ PYS       +  + +++  I++        +    E   F   +++C+++ P++R     L++
Sbjct:   89 VQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLYLHHEKHIIHRDLKPSNLLINHRGEVKITD-----FGVSAIMASTSGQANTFVG-TYNYMSPERISGGKYGYKSDIWSLGLVLLECATGQFPYSPPEQQDGWTSFYELMEAIVDQPPPSAPSDQFSPE---FCSFISACVQKEPQQRLSAQELMV 328          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 83.5741 bits (205), Expect = 2.538e-16
Identity = 64/217 (29.49%), Postives = 101/217 (46.54%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  261 ELIINEILVMKELK-NPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELL 467          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 82.8037 bits (203), Expect = 4.478e-16
Identity = 67/239 (28.03%), Postives = 108/239 (45.19%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  ++  E     F   +  CL+   E+R     LL
Sbjct:  237 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQSPEKLSPIFRDFLARCLEMDVEKRGSSKELL 460          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 83.1889 bits (204), Expect = 5.905e-16
Identity = 68/239 (28.45%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  360 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELL 583          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 78.1814 bits (191), Expect = 1.473e-14
Identity = 66/239 (27.62%), Postives = 105/239 (43.93%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K           +L G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   NI L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  254 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK----------PYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELL 468          
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Match: si:ch73-340m8.2 (tyrosine-protein kinase SRK3-like [Source:NCBI gene;Acc:103039108])

HSP 1 Score: 77.7962 bits (190), Expect = 1.834e-14
Identity = 60/215 (27.91%), Postives = 101/215 (46.98%), Query Frame = 1
Query: 1501 ILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHK----VSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIIT-GKRPYSEYHYYQDVINMI--MENGTIEYDVEDIENELQGFMPLVNSCLKRIPEER 2124
            I  E+KI +  K+ +  ++L          C+ TE M NG LK YL +H+    ++ +    ++ Q+  G+ +L  + ++HRDL   NI L +    K++   L+ F  P    S    K     +  ++MAPEI     Y  +CD+WSFG +L  I+T G  PY +    +D +  I  +  G   Y +E  +        ++  C +  P+ER
Sbjct:  245 IQTEIKIMKEYKH-ERLLKLYGVCTVSEPFCLITELMKNGSLKKYLISHRERKDIAFSLMIDFAVQVTEGMAYLESKNIVHRDLRADNILLTDMQFCKIADFGLADFTLPGDRESTFAVK-----VPIKWMAPEIFDNQVYTSKCDVWSFGILLTEIVTYGNDPYPD----KDKLACIQAIRRG---YRMEQPQACPSSLYEIMKLCWRTDPDER 446          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 72.0182 bits (175), Expect = 2.974e-13
Identity = 40/138 (28.99%), Postives = 78/138 (56.52%), Query Frame = 1
Query: 1585 SLCVSTEFMSNGMLKTYLKNH-KVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYR--YMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEY 1989
            +L +  E+M  G +K  L+ +  ++ N  RK++ QIL G+ FLH   ++HRD+  +NI  D   ++KL       F   K   ++  + +   ++     +M+PE+++ + YG++ DIWS G  ++ ++T K P++E+
Sbjct:  435 TLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGD-----FGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEF 567          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 69.3218 bits (168), Expect = 4.183e-13
Identity = 47/160 (29.38%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 1510 ELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNG-MLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNI-YLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYS 1983
            E++I      + + + L D +  G S+ + TE M  G +L   L+    S  E       I   +++LH Q V+HRDL PSNI Y+DE  + +        F     A + +     Y      ++APE+L    Y   CDIWS G +L  ++ G  P++
Sbjct:   54 EIEILLRYGQHPNVITLKDVYDDGKSVYLVTELMKGGELLDKILRQKFFSEREASAVLQTIARTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQLRAENGLLMTPCYTA---NFVAPEVLKRQGYDAACDIWSLGVLLYTMLAGHTPFA 210          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 68.1662 bits (165), Expect = 1.046e-12
Identity = 48/170 (28.24%), Postives = 80/170 (47.06%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLK-NHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYR-------YMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 1980
            E  L E +I      +     L  TF T   L    E+++ G L  +++   +  ++    ++ +I+ GL+FLHDQ +I+RDL   NI LD+               H K A   M K+++  +++         Y+APEI+   KY    D WSFG +L  ++ G+ P+
Sbjct:   32 ECTLVEKRILSLAWGHPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDG-------------HVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPF 188          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 69.707 bits (169), Expect = 1.273e-12
Identity = 75/250 (30.00%), Postives = 116/250 (46.40%), Query Frame = 1
Query: 1420 NQKGENILLKIYSLESHV-----KDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKW---SHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIIT-GKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 2142
             Q GE + + IY+  + V     K G    E  L+E  + +T ++ +  V+L    +T   + + TEFM NG L  YLK+ + S     K    + QI  G+ F+  +  IHRDL  +NI ++E+L  K++   L++        +  G K        ++ APE ++   +  + D+WSFG +L  IIT G+ PY       DVI   +E G      E    +L G M     C K  PEER   + L
Sbjct:  191 GQFGE-VWMGIYNNRTKVAIKTMKPGSMSPEAFLDEANLMKTLQHPR-LVRLY-AVVTQEPIYIVTEFMENGSLLDYLKSTEGSTLPMPKMIDMAAQIAEGMAFIERKNYIHRDLRAANILVNEQLASKIADFGLARIIEDNEYTAREGAK-----FPIKWTAPEAINYGSFSIKSDVWSFGILLTEIITFGRIPYPGMS-NSDVIRQ-LERGYRMPCPEQAPKQLYGVM---MDCWKERPEERPTFEYL 427          
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001965.1 (pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 gene:ENSPMAG00000001777.1 transcript:ENSPMAT00000001965.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.921e-12
Identity = 48/138 (34.78%), Postives = 73/138 (52.90%), Query Frame = 1
Query: 1585 SLCVSTEFMSNGMLKTYLKNHKV-SVNEFRKWSHQILLGLKFLHDQ--QVIHRDLNPSNIYL-DEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSE 1986
            S+ + TE M++G LKTYLK  KV      + W  QIL GL FLH +   +IHRDL   NI++      +K+    L+  +    A SV+G           +MAPE+   + Y +  D+++FG  ++ + T + PYSE
Sbjct:   45 SIVLVTELMTSGTLKTYLKRFKVMKTKVLQSWCRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTP--------EFMAPEMYE-EHYDEAVDVYAFGMCMLEMATSEYPYSE 173          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 79.337 bits (194), Expect = 1.707e-15
Identity = 66/238 (27.73%), Postives = 116/238 (48.74%), Query Frame = 1
Query: 1435 NILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEY-DVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            ++ +K  +LE   K      E I+NE+ + + +K+  + V   D+++    L V  E+M  G L   + +  ++  +      + L GL+FLH + V+HRD+   NI L            L+ F        +  K++      Y +MAPE++S  +YG + DIWS G ++I +I G+ PY      +  + +I  NGT +  + E++ + L+ F+   + CL   PE+RA    LL
Sbjct:  645 SVAIKQMNLEKQPKK-----ELIINEILVMKGSKH-PNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLS-----MEGDIKLTDFGFCAQINELNLKRTTMVGTPY-WMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLR-ALYLIATNGTPKLKEPENLSSSLKKFL---DWCLCVEPEDRASATELL 866          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 76.6406 bits (187), Expect = 6.515e-15
Identity = 63/232 (27.16%), Postives = 105/232 (45.26%), Query Frame = 1
Query: 1516 KIFQTTKYNQSF-----VQLCDTFL--TGSSLCVSTEFMSNGMLKTYLKN-----HKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDV-----INMIMENGTIEYDVEDIENEL-----QGFMPLVNSCLKRIPEERAKMDSLL 2145
            +IF+  ++N+SF     VQ    F     SS+ ++ E+M    L+   KN      ++S     K +  +L GL +LH+++VIHRD+ P NI L+E          +   +   +  +V      +    + YMAPE +    Y   CD+WS G  L+ +  G+ P+      Q+V     + MI+   T    ++D E EL     + F   ++ CLK+   ER     +L
Sbjct:  257 QIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNE-------KGEIKLCDFGVSGEAVNSLAMTFTGTSF-YMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMIL---TFSPQLKD-EPELDISWSKTFRSFIDYCLKKDARERPSPRQML 476          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 70.0922 bits (170), Expect = 7.403e-13
Identity = 66/226 (29.20%), Postives = 100/226 (44.25%), Query Frame = 1
Query: 1498 FILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWS---HQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSC--DKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMP-----LVNSCLKRIPEERAKMDSLL 2145
            F L ELK    T Y         T L   S+ +  E+   G     LK   V+     K S   H++ LGLK+LH+Q+ IHRD+  +NI L+E+  +KL    +S   H ++      K+  +    Y +MAPE++ C  D Y ++ DIWS G     ++ G  P S+Y   + + N+                +LQG         V  CL + P +R    +LL
Sbjct:   66 FFLAELKSPLITNY-------IATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSG--HIRSTL----KRDTFVGTPY-WMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPP----------KLQGPFSDAAKDFVAGCLVKTPADRPSAYNLL 267          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 69.707 bits (169), Expect = 8.124e-13
Identity = 62/225 (27.56%), Postives = 104/225 (46.22%), Query Frame = 1
Query: 1420 NQKGENILLKIYSLESHVKDGWKGD----EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGML-KTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNI-YLDEXXXXXXXXXXXXXFEHPKTAA--SVMGKKSVYENLKYR------YMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVE 2052
             + GE++ +KI      +K   KG+    E + +EL I Q   ++ + V   D F +     + T+    G L    LK  K +  +  +   +IL  +K++H Q ++HRDL P N+ Y+D+              E P   A   +  +    E L Y+      Y+APE+L+ D +G+ CDIWS G +   ++ G   YS +   + V + + E  T EY V+
Sbjct:   57 TETGEDVAVKIL-----IKKALKGNKVQLEALYDELDILQRL-HHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSD------------ESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCG---YSAFR-AERVQDFLDECTTGEYPVK 259          
BLAST of Protein kinase, putative vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 69.3218 bits (168), Expect = 1.723e-12
Identity = 60/188 (31.91%), Postives = 98/188 (52.13%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNE--FRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYR---------YMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY---SEYHYYQDVINM 2016
            +++  E    Q    + S V+L  TF   SSL    E+  NG   + +K +  S++E   R ++ QI+  + +LH   +IHRD+ P NI LD ++ +KL+    +K  +P T  SV   K  Y+ L  R         Y++PE+L+       CDIW+FG +L ++I GK P+   +EY  +Q V+ +
Sbjct:  222 KYVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG-SLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNP-TNNSV--SKPEYD-LSTRSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKV 404          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 80.8777 bits (198), Expect = 1.355e-15
Identity = 62/221 (28.05%), Postives = 101/221 (45.70%), Query Frame = 1
Query: 1495 EFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFR-KWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENL--KYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENEL-QGFMPLVNSCLKRIPEERAKMDSLL 2145
            + I++E+ I    K+      L  T  TG    +  E+M+ G +   L  +         ++  QIL G+ +LH+ QV+HRD+  +NI +D        +   +     + A  + G       L     +MAPE+L  + YG+ CD+WS G VLI + TGK P++  H + + + +I +         DI   L  G   +V  CL+  PE+R     LL
Sbjct:  623 QTIMDEIAILARLKHPHLIKCLGATRHTGH-FNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAA---RLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNA-HEHSNHLALIFKIAC-AIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLL 837          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 75.485 bits (184), Expect = 6.658e-15
Identity = 48/168 (28.57%), Postives = 80/168 (47.62%), Query Frame = 1
Query: 1501 ILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFR-KWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENL--KYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHY 1995
            I++E+ I    K+      L  T  TG    +  E+M+ G +   L  +         ++  QIL G+ +LH+ QV+HRD+  +NI +D        +   +     + A  + G       L     +MAPE+L  + YG+ CD+WS G VLI + TGK P++ + +
Sbjct:   87 IMDEIAILARLKHPHLIKCLGATRHTGH-FNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAA---ARLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEH 250          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 76.2554 bits (186), Expect = 2.392e-14
Identity = 56/204 (27.45%), Postives = 92/204 (45.10%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIE 2040
            G  + +K  +L    K      E I+NE+ + +  K+  + V   D++L G  L V  E+++ G L   +    +   +      + L  L+FLH   VIHRD+   NI L            L+ F    T      K+S      Y +MAPE+++  +YG   D+WS G + I ++ G+ PY   +  +  + +I  NGT E
Sbjct:  249 GHEVAIKQMNLSQQPKK-----ELIINEILVMRENKH-PNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLG-----MDGQVKLTDFGFCATITPEQNKRSTMVGTPY-WMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE 439          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 72.4034 bits (176), Expect = 6.186e-14
Identity = 41/131 (31.30%), Postives = 79/131 (60.31%), Query Frame = 1
Query: 1603 EFMSNGMLKTYLKNHKVSVNE--FRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEY 1989
            E++  G +  ++K H  ++NE   RK+S QIL G+ +LH  +++HRD+  +NI  D  L   +  ++    +  +T  S  G +SV+    Y +MAPE+++ + YG++ D+WS G  ++ ++T K P++++
Sbjct:   84 EYLPGGSIHEHIKQHG-ALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRD--LYGNVKLADFGASKRLQTIRSKTGFRSVH-GTPY-WMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADF 209          
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 72.4034 bits (176), Expect = 9.149e-14
Identity = 66/245 (26.94%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 1414 TQNQKGENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMI-MENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            T  + G  + +K   L+   +      E + NE+ I +   +  + V++  + L G  L V  EF+  G L   + +  +S  +       +L  L FLH Q VIHRD+   +I L         +  LS F         M ++       Y +MAPE++S   YG E DIWS G +++ ++ G+ PY      Q +  +  +E  T    ++ I   LQ F+   ++ L R P  RA    LL
Sbjct:   47 TDKRTGRQVAVKKMDLKKQQRR-----ELLFNEVVIMRDYPH-PNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILL-----TSNGTVKLSDFGFCAQVTEDMPRRKSLVGTPY-WMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQ-ISPRLQSFL---DNALIRDPLYRATAFELL 275          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 85.5001 bits (210), Expect = 6.688e-17
Identity = 67/239 (28.03%), Postives = 111/239 (46.44%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      ++L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   ++ CL+   E+R     LL
Sbjct:  225 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELL 448          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: pak2b (p21 (RAC1) activated kinase 2 [Source:NCBI gene;Acc:101167280])

HSP 1 Score: 84.7297 bits (208), Expect = 6.982e-17
Identity = 68/239 (28.45%), Postives = 110/239 (46.03%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      + L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   +N CL+   E+R     LL
Sbjct:  171 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLMGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPVFRDFLNRCLEMDVEKRGGGKELL 394          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000028689.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 85.1149 bits (209), Expect = 1.100e-16
Identity = 67/239 (28.03%), Postives = 111/239 (46.44%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      ++L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   ++ CL+   E+R     LL
Sbjct:  262 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELL 485          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000043480.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 85.1149 bits (209), Expect = 1.100e-16
Identity = 67/239 (28.03%), Postives = 111/239 (46.44%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      ++L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   ++ CL+   E+R     LL
Sbjct:  262 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELL 485          
BLAST of Protein kinase, putative vs. Ensembl Medaka
Match: ENSORLT00000030173.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 85.1149 bits (209), Expect = 1.100e-16
Identity = 67/239 (28.03%), Postives = 111/239 (46.44%), Query Frame = 1
Query: 1429 GENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLL 2145
            G+ + +K  +L+   K      E I+NE+ + +  K N + V   D+FL G  L V  E+++ G L   +    +   +      ++L  L+FLH  QVIHRD+   N+ L         S  L+ F           K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +  +  + +I  NGT E  +++ E     F   ++ CL+   E+R     LL
Sbjct:  262 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLG-----MDGSVKLTDFGFCAQITPEQSKRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR-ALYLIATNGTPE--LQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELL 485          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 1170.99 bits (3028), Expect = 0.000e+0
Identity = 639/692 (92.34%), Postives = 652/692 (94.22%), Query Frame = 1
Query:   82 MIKXXXXXXXXXXXXXNGLDPPGICFEQTPFRLNDQTCGKFEDICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVLLNRTQQFVGNGTNSIFYRNQGASEXXXXXXXXXXXXXXXXXEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFEXXXXXXXXXXXX---TQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNGRILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK-ITNNRKLVRMKDKDVFVDGDELIVVEKTVGVFLIRSILN-DETFDKDYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 2142
            MIKLIISFVLIL+VLVNGLDPPGICFEQTPFRLNDQTCGKFE+ICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIV LNRTQQF+GNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFE   +           TQ I+ K IL +EEP+QLN + NIK+  F  Q  EGKR+K  YNGRILDNNE LLDCINSRNSF NCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK ITNNRKLVRMKDKDVFVDGDELIVVEKT G F IRSILN ++  DK+YENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQK ENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFE PKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL
Sbjct:    1 MIKLIISFVLILMVLVNGLDPPGICFEQTPFRLNDQTCGKFEEICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVPLNRTQQFIGNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFERFNEKMETKFTEFENTQLITTKLILGEEEPVQLNKKGNIKQ--FDSQKYEGKRIKFCYNGRILDNNEFLLDCINSRNSFNNCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFKEITNNRKLVRMKDKDVFVDGDELIVVEKTNGKFKIRSILNYEKIIDKEYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 690          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 1170.22 bits (3026), Expect = 0.000e+0
Identity = 624/676 (92.31%), Postives = 636/676 (94.08%), Query Frame = 1
Query:  130 NGLDPPGICFEQTPFRLNDQTCGKFEDICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVLLNRTQQFVGNGTNSIFYRNQGASEXXXXXXXXXXXXXXXXXEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFEXXXXXXXXXXXX---TQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNGRILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK-ITNNRKLVRMKDKDVFVDGDELIVVEKTVGVFLIRSILN-DETFDKDYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 2142
            NGLDPPGICFEQTPFRLNDQTCGKFE+ICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIV LNRTQQF+GNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFE   +           TQ I+ K IL +EEP+QLN + NIK+  F  Q  EGKR+K  YNGRILDNNE LLDCINSRNSF NCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK ITNNRKLVRMKDKDVFVDGDELIVVEKT G F IRSILN ++  DK+YENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQK ENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFE PKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL
Sbjct:    5 NGLDPPGICFEQTPFRLNDQTCGKFEEICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVPLNRTQQFIGNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFERFNEKMETKFTEFENTQLITTKLILGEEEPVQLNKKGNIKQ--FDSQKYEGKRIKFCYNGRILDNNEFLLDCINSRNSFNNCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFKEITNNRKLVRMKDKDVFVDGDELIVVEKTNGKFKIRSILNYEKIIDKEYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 678          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 1167.91 bits (3020), Expect = 0.000e+0
Identity = 635/687 (92.43%), Postives = 646/687 (94.03%), Query Frame = 1
Query:  130 NGLDPPGICFEQTPFRLNDQTCGKFEDICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVLLNRTQQFVGNGTNSIFYRNQGASEXXXXXXXXXXXXXXXXXEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFEX--------------XXXXXXXXXXXTQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNGRILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK-ITNNRKLVRMKDKDVFVDGDELIVVEKTVGVFLIRSILN-DETFDKDYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 2142
            NGLDPPGICFEQTPFRLNDQTCGKFE+ICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIV LNRTQQF+GNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFE               LLKSSSNGSKNTQ I+ K IL +EEP+QLN + NIK+  F  Q  EGKR+K  YNGRILDNNE LLDCINSRNSF NCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK ITNNRKLVRMKDKDVFVDGDELIVVEKT G F IRSILN ++  DK+YENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQK ENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFE PKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL
Sbjct:   17 NGLDPPGICFEQTPFRLNDQTCGKFEEICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVPLNRTQQFIGNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFERFNEKMETKFTEFENLLKSSSNGSKNTQLITTKLILGEEEPVQLNKKGNIKQ--FDSQKYEGKRIKFCYNGRILDNNEFLLDCINSRNSFNNCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFKEITNNRKLVRMKDKDVFVDGDELIVVEKTNGKFKIRSILNYEKIIDKEYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 701          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 1166.76 bits (3017), Expect = 0.000e+0
Identity = 635/687 (92.43%), Postives = 646/687 (94.03%), Query Frame = 1
Query:  130 NGLDPPGICFEQTPFRLNDQTCGKFEDICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVLLNRTQQFVGNGTNSIFYRNQGASEXXXXXXXXXXXXXXXXXEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFEX--------------XXXXXXXXXXXTQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNGRILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK-ITNNRKLVRMKDKDVFVDGDELIVVEKTVGVFLIRSILN-DETFDKDYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 2142
            NGLDPPGICFEQTPFRLNDQTCGKFE+ICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIV LNRTQQF+GNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFE               LLKSSSNGSKNTQ I+ K IL +EEP+QLN + NIK+  F  Q  EGKR+K  YNGRILDNNE LLDCINSRNSF NCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFK ITNNRKLVRMKDKDVFVDGDELIVVEKT G F IRSILN ++  DK+YENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQK ENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFE PKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL
Sbjct:    5 NGLDPPGICFEQTPFRLNDQTCGKFEEICIKTGDDQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVPLNRTQQFIGNGTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFERFNEKMETKFTEFENLLKSSSNGSKNTQLITTKLILGEEEPVQLNKKGNIKQ--FDSQKYEGKRIKFCYNGRILDNNEFLLDCINSRNSFNNCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFKEITNNRKLVRMKDKDVFVDGDELIVVEKTNGKFKIRSILNYEKIIDKEYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSL 689          
BLAST of Protein kinase, putative vs. Planmine SMEST
Match: SMESG000074407.1 (SMESG000074407.1)

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 487/518 (94.02%), Postives = 495/518 (95.56%), Query Frame = 1
Query:  493 ITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFEXXXXXXXXXXXXTQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNGRILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFKITNNRKLVRMKDKDVFVDGDELIVVEKTVGVFLIRSILNDETFDKDYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYL---KNHKVSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEXXXXXXXXXXXXXFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTI 2037
            ITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKF EFE+FN+ +E KFTEFENLLKSSSNGSKNTQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNGRILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFKITNNRKLVRMKDKDVFVDGDELIVVEKTVGVFLIRSILN ETFDKDYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINP F+VPDKPISQNKIFKLY TQNQKGENILLKIYSLESHVKDGWKGDEFILNELK FQTTK N+ FVQLCDTF  GSSLCVS E+MSNGMLKTYL   KN KVS  EFRKWS+QILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEY  YQDVINMIME   +
Sbjct:    9 ITKLFFCRSIKERSKYNLVNSRKRFQIEEFNKNMETKFTEFERFNEKMEAKFTEFENLLKSSSNGSKNTQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNGRILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNININQTLEEVETMIKSISNVDKLAIFKITNNRKLVRMKDKDVFVDGDELIVVEKTVGVFLIRSILNVETFDKDYENTDFISSLAPKENVDFILFHNKEKLDQDKFIFEYKIPSGSTLDCYTFEINPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIMEKARL 526          
The following BLAST results are available for this feature:
BLAST of Protein kinase, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK12.197e-1828.87p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK13.955e-1728.87p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK17.585e-1728.87p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK11.005e-1628.87p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK11.075e-1628.87p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtk-15.263e-1324.38MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
pak-19.046e-1327.19Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
wnk-19.942e-1330.37Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-19.942e-1330.37Serine/threonine-protein kinase WNK [Source:UniPr... [more]
mtk-11.012e-1224.47MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gprk13.058e-1330.29gene:FBgn0260798 transcript:FBtr0345363[more]
Gprk13.058e-1330.29gene:FBgn0260798 transcript:FBtr0302242[more]
Gprk13.058e-1330.29gene:FBgn0260798 transcript:FBtr0111121[more]
Pak6.942e-1327.06gene:FBgn0267698 transcript:FBtr0334539[more]
Pak6.942e-1327.06gene:FBgn0267698 transcript:FBtr0081714[more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2a1.431e-1628.45p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.431e-1628.45p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.431e-1628.45p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.514e-1628.45p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak12.235e-1628.87p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox27.860e-1726.78quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox28.025e-1726.78quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox21.517e-1627.65quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox22.031e-1627.65quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox22.050e-1627.65quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak16.508e-1728.87p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak16.508e-1728.87p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak22.312e-1628.03p21 (RAC1) activated kinase 2 [Source:MGI Symbol;A... [more]
Pak33.610e-1628.03p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak33.610e-1628.03p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of Protein kinase, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08E52|PAK1_BOVIN4.840e-1628.87Serine/threonine-protein kinase PAK 1 OS=Bos tauru... [more]
sp|Q13153|PAK1_HUMAN5.163e-1628.87Serine/threonine-protein kinase PAK 1 OS=Homo sapi... [more]
sp|P35465|PAK1_RAT5.237e-1628.87Serine/threonine-protein kinase PAK 1 OS=Rattus no... [more]
sp|Q6CVA2|STE20_KLULA1.065e-1529.41Serine/threonine-protein kinase STE20 OS=Kluyverom... [more]
sp|Q94C95|ATG1A_ARATH1.275e-1530.95Serine/threonine-protein kinase ATG1a OS=Arabidops... [more]
back to top
BLAST of Protein kinase, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q069I61.840e-1629.95MAP kinase kinase OS=Oryza minuta OX=63629 GN=MKK1... [more]
A0A2V1AIA82.279e-1628.69Non-specific serine/threonine protein kinase OS=[C... [more]
A0A1R2CWZ92.318e-1633.33Protein kinase domain-containing protein OS=Stento... [more]
A0A1Y1JI412.532e-1631.93Serine/threonine-protein kinase Nek1 OS=Plasmodium... [more]
V4UFF02.608e-1627.71Protein kinase domain-containing protein OS=Citrus... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2a2.538e-1629.49p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2b4.478e-1628.03p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
pak2a5.905e-1628.45p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak11.473e-1427.62p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
si:ch73-340m8.21.834e-1427.91tyrosine-protein kinase SRK3-like [Source:NCBI gen... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.974e-1328.99mitogen-activated protein kinase kinase kinase 2 [... [more]
RPS6KA34.183e-1329.38ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
PRKCD1.046e-1228.24protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
hck1.273e-1230.00HCK proto-oncogene, Src family tyrosine kinase [So... [more]
ENSPMAT00000001965.11.921e-1234.78pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 g... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE201.707e-1527.73Cdc42p-activated signal transducing kinase; involv... [more]
MKK26.515e-1527.16MAPKK involved in the protein kinase C signaling p... [more]
SPS17.403e-1329.20Putative protein serine/threonine kinase; localize... [more]
CMK18.124e-1327.56Calmodulin-dependent protein kinase; may play a ro... [more]
PKH21.723e-1231.91Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361501.355e-1528.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279766.658e-1528.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336672.392e-1427.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414106.186e-1431.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458469.149e-1426.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015480.26.688e-1728.03serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
pak2b6.982e-1728.45p21 (RAC1) activated kinase 2 [Source:NCBI gene;Ac... [more]
ENSORLT00000028689.11.100e-1628.03serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000043480.11.100e-1628.03serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000030173.11.100e-1628.03serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
back to top
BLAST of Protein kinase, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074416.10.000e+092.34SMESG000074416.1[more]
SMESG000074416.10.000e+092.31SMESG000074416.1[more]
SMESG000074416.10.000e+092.43SMESG000074416.1[more]
SMESG000074416.10.000e+092.43SMESG000074416.1[more]
SMESG000074407.10.000e+094.02SMESG000074407.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009287 ID=SMED30009287|Name=Protein kinase, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2690bp
TATATCTTTGTTTTACTGTGTTATTTTTATAACCTTGAAAATTTTAAAAC
GAAAAATTAGTTAGGAACAAGAAAATTTAGAATGATTAAATTAATAATTT
CATTTGTTTTGATTTTAATAGTGCTCGTAAATGGACTTGATCCACCTGGA
ATTTGCTTTGAACAGACTCCATTCAGATTAAATGACCAAACTTGCGGCAA
ATTCGAGGATATTTGCATTAAAACAGGAGACGATCAATGCATACAACTCC
TCAATTCATGCAAACAGTGTCCCCCAAATAACATCACTATTACCATTCTA
TTAAAGATTTGGAATTCTTTAAAATCATTTACGGAAAGCCAAATCGTTTT
ATTGAACAGAACTCAGCAGTTTGTGGGAAATGGGACGAATTCCATCTTTT
ATCGGAATCAAGGAGCATCGGAAATCATTGCAGTTCTAATATTAGTAATA
ATAATTCTTATTCTCCTAATTGTTGAAATGAGATTCAAAATAATAACAAA
ATTATTTTTTTGTCGTTCTATAAAAGAAAGGTCAAAATACAATCTTGTCA
ATAGCAGAAAACGATTCCAAATAGAAGAATTTAATAAAAATATGGAGACA
AAATTTAGAGAATTTGAAAAATTTAATAAAAATTTGGAGACAAAATTTAC
AGAATTTGAAAATTTGTTAAAGAGTAGCAGTAATGGATCGAAAAATACCC
AGCCCATATCAATCAAATTCATTCTGGATAAAGAAGAACCAATTCAGTTA
AATATACAAAAAAACATAAAAAAAGTTAAATTTTATCCGCAAATAAGTGA
GGGGAAAAGAATGAAATTGTACTATAATGGCCGCATTCTCGATAATAATG
AATGTTTATTAGACTGTATTAACAGCCGAAATTCTTTTATTAATTGCTAT
GTTGACTTCACAATAAATATCAAGGACATGATTGTTGTGAAATTGAAAAG
TGAAATGGAATTGCCGGAAACTCTGAATATAAATATAAACCAAACACTAG
AGGAGGTAGAGACTATGATAAAGAGCATTTCCAATGTAGATAAATTAGCA
ATATTCAAAATAACTAATAATCGAAAATTAGTTCGAATGAAAGATAAAGA
TGTTTTTGTTGATGGAGACGAACTGATTGTGGTTGAGAAGACCGTTGGAG
TGTTTTTGATTAGATCAATACTAAATGATGAGACATTCGACAAGGATTAT
GAGAATACTGATTTTATTTCATCTCTTGCACCGAAGGAAAATGTTGATTT
TATATTATTTCATAATAAAGAAAAATTAGATCAGGATAAATTCATATTTG
AATACAAAATTCCCAGTGGTTCAACTCTTGATTGTTATACATTCGAAATA
AATCCTGGTTTTGAAGTTCCTGATAAACCGATCAGTCAGAATAAAATATT
TAAACTTTATCATACTCAAAACCAAAAAGGCGAAAATATATTATTGAAAA
TCTATTCACTTGAATCACATGTCAAAGACGGATGGAAAGGTGACGAGTTT
ATACTAAATGAGTTGAAGATATTCCAGACTACAAAATATAACCAAAGCTT
TGTCCAGCTATGCGATACATTTTTAACGGGTTCAAGTTTATGTGTTTCAA
CGGAGTTCATGTCTAATGGAATGCTGAAGACATATCTAAAAAATCACAAG
GTGTCAGTAAATGAATTTCGCAAATGGTCACATCAAATTTTGTTAGGATT
GAAGTTTCTCCATGATCAACAAGTCATTCACAGAGATTTGAACCCGTCAA
ACATTTATTTGGATGAAAAACTAGATTTGAAATTATCCAGTTCAAATCTT
TCGAAATTCGAGCACCCCAAAACTGCAGCCTCAGTGATGGGGAAAAAATC
CGTATATGAAAATCTAAAATATAGATATATGGCACCTGAAATATTATCGT
GCGACAAATATGGTCAAGAATGTGACATTTGGTCGTTTGGCGCGGTGTTG
ATCAGGATTATTACCGGAAAAAGGCCTTATTCGGAATATCATTATTACCA
AGACGTGATAAATATGATAATGGAAAACGGCACGATTGAATATGATGTAG
AGGATATTGAGAATGAATTGCAAGGCTTCATGCCTTTGGTTAATTCATGT
TTGAAAAGGATACCAGAGGAAAGAGCAAAAATGGATAGCTTACTTATAAA
AACAAAGCCAAATTAAGCAATAAGTTATATATAATTCATATAAAGATTCT
ATCAATTATTATTTGGTGCTTGAATTTCGTTTCGACAATCGTGATTAGTT
TTATTAATTATGTTAAATAACTTGTTCAATAAAATGAGTTTTGGATTTGT
TTTATCTCGAGGTGACTTTGACTTGTCTTTTAAAAATTTCGAATGCTAGG
AAACTGACTCTTCATTTTACTCCTGTAGAATTTTCTTTATTATCCTTTAT
GTTCACGACTTTGATCACTAGTTATTAGCAAATCCTTTACGTATCACACA
ATTTTATTTTGACAAATTATTTGCTTCTTTTCCTATCTCAAAATATTCAA
CTTTTAAATTTGTAGATGTCATGAAGGTTTTCCGGTAAATATATTTGAAC
TTCAGTATGAATACAAACAACAAATCAAAGGCTGTTTACCCTCATATTCT
TAGATTTACTTATGCATCATTTTTTGATAATTTGTTCTGTTAAACGACTT
ATAATATTTTATAGCTTAAAATGTTGAAAATAAATATTCA
back to top

protein sequence of SMED30009287-orf-1

>SMED30009287-orf-1 ID=SMED30009287-orf-1|Name=SMED30009287-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=695bp
MIKLIISFVLILIVLVNGLDPPGICFEQTPFRLNDQTCGKFEDICIKTGD
DQCIQLLNSCKQCPPNNITITILLKIWNSLKSFTESQIVLLNRTQQFVGN
GTNSIFYRNQGASEIIAVLILVIIILILLIVEMRFKIITKLFFCRSIKER
SKYNLVNSRKRFQIEEFNKNMETKFREFEKFNKNLETKFTEFENLLKSSS
NGSKNTQPISIKFILDKEEPIQLNIQKNIKKVKFYPQISEGKRMKLYYNG
RILDNNECLLDCINSRNSFINCYVDFTINIKDMIVVKLKSEMELPETLNI
NINQTLEEVETMIKSISNVDKLAIFKITNNRKLVRMKDKDVFVDGDELIV
VEKTVGVFLIRSILNDETFDKDYENTDFISSLAPKENVDFILFHNKEKLD
QDKFIFEYKIPSGSTLDCYTFEINPGFEVPDKPISQNKIFKLYHTQNQKG
ENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTG
SSLCVSTEFMSNGMLKTYLKNHKVSVNEFRKWSHQILLGLKFLHDQQVIH
RDLNPSNIYLDEKLDLKLSSSNLSKFEHPKTAASVMGKKSVYENLKYRYM
APEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENG
TIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLLIKTKPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0019901protein kinase binding
GO:0000166nucleotide binding
GO:0003824catalytic activity
GO:0004674protein serine/threonine kinase activity
GO:0004709MAP kinase kinase kinase activity
GO:0005515protein binding
GO:0005518collagen binding
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006887exocytosis
GO:0006915apoptotic process
GO:0007264small GTPase mediated signal transduction
GO:0008152metabolic process
GO:0008284positive regulation of cell proliferation
GO:0010033response to organic substance
GO:0010763positive regulation of fibroblast migration
GO:0016310phosphorylation
GO:0021549cerebellum development
GO:0030010establishment of cell polarity
GO:0030335positive regulation of cell migration
GO:0031532actin cytoskeleton reorganization
GO:0032869cellular response to insulin stimulus
GO:0032956regulation of actin cytoskeleton organization
GO:0033138positive regulation of peptidyl-serine phosphorylation
GO:0033148positive regulation of intracellular estrogen receptor signaling pathway
GO:0035556intracellular signal transduction
GO:0042060wound healing
GO:0043507positive regulation of JUN kinase activity
GO:0045773positive regulation of axon extension
GO:0046777protein autophosphorylation
GO:0048754branching morphogenesis of an epithelial tube
GO:0048812neuron projection morphogenesis
GO:0051496positive regulation of stress fiber assembly
GO:0060244negative regulation of cell proliferation involved in contact inhibition
GO:0061052negative regulation of cell growth involved in cardiac muscle cell development
GO:0090314positive regulation of protein targeting to membrane
GO:1904707positive regulation of vascular smooth muscle cell proliferation
GO:1904754positive regulation of vascular associated smooth muscle cell migration
GO:2001275positive regulation of glucose import in response to insulin stimulus
GO:0000165MAPK cascade
GO:0000186activation of MAPKK activity
GO:0001666response to hypoxia
GO:0001934positive regulation of protein phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0014704intercalated disc
GO:0016020membrane
GO:0030018Z disc
GO:0030027lamellipodium
GO:0030054cell junction
GO:0030424axon
GO:0030425dendrite
GO:0031965nuclear membrane
GO:0032587ruffle membrane
GO:0042995cell projection
GO:0043234protein complex
GO:0071437invadopodium
GO:0001726ruffle
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005911cell-cell junction
GO:0005925focal adhesion