Hsp70

Overview
NameHsp70 (ADW66122.1)
Smed IDSMED30009284
Length (bp)2619
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hsp70 (SMED30009284) t-SNE clustered cells

Violin plots show distribution of expression levels for Hsp70 (SMED30009284) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hsp70 (SMED30009284) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hsp70 (SMED30009284) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009284

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009284SMESG000056256.1 SmedASXL_007884SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009284SMESG000056256.1 dd_Smed_v4_424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009284SMESG000056256.1 Contig37924uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009284SMESG000056256.1 Contig37924newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009284SMESG000056256.1 Contig45824uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009284SMESG000056256.1 Contig45824newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30009284SMESG000056256.1 dd_Smed_v6_424_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30009284SMESG000056256.1 dd_Smed_v6_424_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009284SMESG000056256.1 GU591875smed_ncbi_20200123PMID:21356107
Fernández-Taboada et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30009284SMESG000056256.1 Hsp70smed_ncbi_20200123PMID:26711341
Duncan et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30009284SMESG000056256.1 Hsp70smed_ncbi_20200123PMID:26711341
Duncan et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hsp70 vs. Ensembl Human
Match: HSPA9 (heat shock protein family A (Hsp70) member 9 [Source:HGNC Symbol;Acc:HGNC:5244])

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 488/608 (80.26%), Postives = 558/608 (91.78%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + +KG V+GIDLGTTNSCV+VM+GK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NT +ATKRLIGRRYD+PEVQKD+KNV +KIVRASNGDAWVEA  K+YSPSQIGAFVL+KMKETAE+YLG T KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK++DK+IAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD++GPKHL++KLTR++ E +V  LI+RTI PC+KA++DAEV  S+I EV+LVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNKLLGQF+LIGIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++K++ VE VN AE I++DTE+K++EFK QLPA+EC KLK+ I  +R+ LA KD+ET E+I++A + LQQ+SLKLFEMAYKKMA
Sbjct:   49 EAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMA 656          
BLAST of Hsp70 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 522.702 bits (1345), Expect = 3.539e-175
Identity = 298/564 (52.84%), Postives = 400/564 (70.92%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVR-ASNGDAWVE--AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQ 1788
            KG  +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+  VQ DMK+  + +V  A      VE   + K + P ++ + VL KMKE AE+YLG TV NAVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + + EFKR+   D++++  A++R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA++DA++  S+I +++LVGG TR+PK+Q+ +Q  F G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DVTPLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D+K+RD V   N  ES  ++ ++ +++ K Q
Sbjct:    3 KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGID------FYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQ 559          
BLAST of Hsp70 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 522.702 bits (1345), Expect = 3.539e-175
Identity = 298/564 (52.84%), Postives = 400/564 (70.92%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVR-ASNGDAWVE--AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQ 1788
            KG  +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+  VQ DMK+  + +V  A      VE   + K + P ++ + VL KMKE AE+YLG TV NAVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + + EFKR+   D++++  A++R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA++DA++  S+I +++LVGG TR+PK+Q+ +Q  F G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DVTPLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D+K+RD V   N  ES  ++ ++ +++ K Q
Sbjct:    3 KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGID------FYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQ 559          
BLAST of Hsp70 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 522.702 bits (1345), Expect = 3.539e-175
Identity = 298/564 (52.84%), Postives = 400/564 (70.92%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVR-ASNGDAWVE--AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQ 1788
            KG  +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+  VQ DMK+  + +V  A      VE   + K + P ++ + VL KMKE AE+YLG TV NAVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + + EFKR+   D++++  A++R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA++DA++  S+I +++LVGG TR+PK+Q+ +Q  F G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DVTPLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D+K+RD V   N  ES  ++ ++ +++ K Q
Sbjct:    3 KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGID------FYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQ 559          
BLAST of Hsp70 vs. Ensembl Human
Match: HSPA6 (heat shock protein family A (Hsp70) member 6 [Source:HGNC Symbol;Acc:HGNC:5239])

HSP 1 Score: 518.079 bits (1333), Expect = 1.728e-173
Identity = 300/613 (48.94%), Postives = 411/613 (67.05%), Query Frame = 1
Query:  148 IGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAY 1938
            +GIDLGTT SCV V      ++L N +G RTTPS VAFT D ERLVG  AK QA +N  NT+   KRLIGR++ +  VQ DMK+  +++V +  G   V      ++K + P +I + VL KMKETAE+YLG  VK+AV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLD+    ++ + +FDLGGGTFD+SVL I  GVFEVK+T+GDT LGGEDFDN L+ + + EF+R+ G D++ +  AL+R+R A E+AK  LSS+ Q  + +  L   +D          +TR++ E+L   L + T++P EKA++DA++  ++I +V+LVGG TR+PKVQ+ +Q  F G+  +KS+NPDEAVA GAA+Q  VL GD  + +      DV PLSLG+ET GGV T LI RN TIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI++V+A D+ TGK  +I I +  G LSK+E+E M+ +AE+    D+ +RD V   N  E+ V+  +  + E   + ++P E+  K++   + V   L +      E  +    EL+Q    +F   Y
Sbjct:    9 VGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFT-DTERLVGDAAKSQAALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVV-SEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVD------FYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLY 613          
BLAST of Hsp70 vs. Ensembl Celegans
Match: hsp-6 (Heat shock 70 kDa protein F, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P11141])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 491/615 (79.84%), Postives = 553/615 (89.92%), Query Frame = 1
Query:  109 NVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK-TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + R   DK KGHVIGIDLGTTNSCVS+M+GKTPKV+ENAEG RTTPS VAFT+DGERLVG PAKRQAV NSANTL ATKRLIGRRY++PEVQKD+K V YKIV+ASNGDAWVEAQ K+YSPSQ+GAFVL+KMKETAESYLGTTV NAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK   DKIIAV+DLGGGTFD+S+LEIQKGVFEVKST+GDTFLGGEDFD+ L+ ++V EFK+EQGVD+ KDP A+QR+REAAEKAK ELSS  QTDINLPY+TMD +GPKHL+LKLTR+K EQ+V  LIKRTI+PC KA+ DAEVK+S+I +VLLVGGM+RMPKVQ TVQ++FG+VPSK+VNPDEAVAMGAAIQG VLAGDVTDVLLLDVTPLSLGIETLGG+ TKLI RNTTIPTKKSQVFSTAADGQTQV+IKV QGEREMA  NKLLGQFSL+GIPPAPRG+PQVEVTFDIDANGIVNVSARD+GTGKEQQIVIQSSGGLSKD+IENMI++AE+NA  D K++++VEV+NQAE I++DTE+K+ EF  QLP +ECE L+  I   +  L NKDNET E+IK+A N LQQ SLKLFE AYK MA
Sbjct:   21 SARSLSDKPKGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEAQGKVYSPSQVGAFVLMKMKETAESYLGTTVNNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKDAGDKIIAVYDLGGGTFDVSILEIQKGVFEVKSTNGDTFLGGEDFDHALVHHLVGEFKKEQGVDLTKDPQAMQRLREAAEKAKCELSSTTQTDINLPYITMDQSGPKHLNLKLTRAKFEQIVGDLIKRTIEPCRKALHDAEVKSSQIADVLLVGGMSRMPKVQATVQEIFGKVPSKAVNPDEAVAMGAAIQGAVLAGDVTDVLLLDVTPLSLGIETLGGIMTKLITRNTTIPTKKSQVFSTAADGQTQVQIKVFQGEREMATSNKLLGQFSLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDRGTGKEQQIVIQSSGGLSKDQIENMIKEAEKNAAEDAKRKELVEVINQAEGIIHDTEAKMTEFADQLPKDECEALRTKIADTKKILDNKDNETPEAIKEACNTLQQQSLKLFEAAYKNMA 635          
BLAST of Hsp70 vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 310/612 (50.65%), Postives = 427/612 (69.77%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSV-MDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD--DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLK 1920
            K + +GIDLGTT SCV V M GK  +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++D+P VQ DMK+  +K++ A      V+     +NK+++P +I + VL+KMKETAE++LGTTVK+AVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ +   EFKR+   D+  +P AL+R+R A E+AK  LSS+ Q  I +  L   +D          +TR++ E+L   L + T+DP EK+++DA++  S++ +++LVGG TR+PKVQ+ +  LF G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DV PLSLGIET GGV T LI RNTTIPTK +Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSKD+IE M+ +AE+   +D+ ++D +   N  ES  ++ +  I++   K ++  E+ +K++     +   L +  N+T+E   K   E QQ  L+
Sbjct:    3 KHNAVGIDLGTTYSCVGVFMHGKV-EIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGID------FYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDS--NQTAE---KEEFEHQQKDLE 601          
BLAST of Hsp70 vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 310/612 (50.65%), Postives = 427/612 (69.77%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSV-MDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD--DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLK 1920
            K + +GIDLGTT SCV V M GK  +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++D+P VQ DMK+  +K++ A      V+     +NK+++P +I + VL+KMKETAE++LGTTVK+AVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ +   EFKR+   D+  +P AL+R+R A E+AK  LSS+ Q  I +  L   +D          +TR++ E+L   L + T+DP EK+++DA++  S++ +++LVGG TR+PKVQ+ +  LF G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DV PLSLGIET GGV T LI RNTTIPTK +Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSKD+IE M+ +AE+   +D+ ++D +   N  ES  ++ +  I++   K ++  E+ +K++     +   L +  N+T+E   K   E QQ  L+
Sbjct:    3 KHNAVGIDLGTTYSCVGVFMHGKV-EIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGID------FYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDS--NQTAE---KEEFEHQQKDLE 601          
BLAST of Hsp70 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 530.791 bits (1366), Expect = 9.987e-179
Identity = 303/592 (51.18%), Postives = 412/592 (69.59%), Query Frame = 1
Query:  145 VIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKG-VFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLI-QTVR----DRLANKD 1860
             IGIDLGTT SCV +      ++L N+EG +TTPS VAFT D ERLVG  AK QA  N  NT+   KRLIGRR+DE  VQ D K+  +  V+   G   +E     + + ++P +I A VL KMKETAE+YLG TVK+AV+TVPAYFNDSQRQATKDA  I+GLN +R+INEPTAAALAYGLDK   D+K + +FDLGGGTFD+S+L I +G +FEVKST+GDT LGGEDFD  +LQ+ +NEFKR+ G D++ +P A++R+R A E+AK  LSS+ +  + +  L   +D      L  K+TR++ E+L   L ++T++P EKA++DA++  S+I EV+LVGG TR+PK+Q+ ++  F G+  + S+NPDEAVA GAA+Q  VL+G   + +      DV PLSLGIET GGV T LI+RNT IPTK  + F+T AD Q  V I+V++GER M  DN  LG F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK  +I IQ+  G L++ +I+ M+ +A++  + D ++R+ V+  NQ E+  +  +  +DE+ S+L  E+  + K+ + +T+R    + LA KD
Sbjct:    6 AIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFT-DTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFG-VKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGID------LCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDEYSSKLSTEDASRAKEAVDETLRWLDSNSLAEKD 589          
BLAST of Hsp70 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 530.791 bits (1366), Expect = 9.987e-179
Identity = 303/592 (51.18%), Postives = 412/592 (69.59%), Query Frame = 1
Query:  145 VIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKG-VFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLI-QTVR----DRLANKD 1860
             IGIDLGTT SCV +      ++L N+EG +TTPS VAFT D ERLVG  AK QA  N  NT+   KRLIGRR+DE  VQ D K+  +  V+   G   +E     + + ++P +I A VL KMKETAE+YLG TVK+AV+TVPAYFNDSQRQATKDA  I+GLN +R+INEPTAAALAYGLDK   D+K + +FDLGGGTFD+S+L I +G +FEVKST+GDT LGGEDFD  +LQ+ +NEFKR+ G D++ +P A++R+R A E+AK  LSS+ +  + +  L   +D      L  K+TR++ E+L   L ++T++P EKA++DA++  S+I EV+LVGG TR+PK+Q+ ++  F G+  + S+NPDEAVA GAA+Q  VL+G   + +      DV PLSLGIET GGV T LI+RNT IPTK  + F+T AD Q  V I+V++GER M  DN  LG F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK  +I IQ+  G L++ +I+ M+ +A++  + D ++R+ V+  NQ E+  +  +  +DE+ S+L  E+  + K+ + +T+R    + LA KD
Sbjct:    6 AIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFT-DTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFG-VKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGID------LCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDEYSSKLSTEDASRAKEAVDETLRWLDSNSLAEKD 589          
BLAST of Hsp70 vs. Ensembl Fly
Match: Hsc70-5 (gene:FBgn0001220 transcript:FBtr0339969)

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 485/623 (77.85%), Postives = 561/623 (90.05%), Query Frame = 1
Query:   85 NGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQN-KMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            NG+   S  +R    +VKG VIGIDLGTTNSC++VM+GK  KV+ENAEGARTTPS VAFT DGERLVG PAKRQAV NSANT +ATKRLIGRR+D+PEV+KD+ N+SYK+V+ASNGDAWV + + K+YSPSQIGAF+L+KMKETAE+YL T VKNAVVTVPAYFNDSQRQATKDAGQI+GLNVLRVINEPTAAALAYG+DKT+DKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDT LGGEDFDN ++ ++V EFK++ G+D+ KD +A+QR++EAAEKAK ELSS+ QTDINLPYLTMD  GP+H++LKLTRSKLE LV  LIKRTI PC+KA+ DAEV  SEI EVLLVGGMTRMPKVQ TVQ+LFGR PS+SVNPDEAVA+GAA+QGGVLAGDVTDVLLLDVTPLSLGIETLGGVFT+LI+RNTTIPTKKSQVFSTA+DGQTQVEIKVHQGEREMA DNKLLG F+L+GIPPAPRG+PQ+EV FDIDANGIV+VSA+DKGTGKEQQIVIQSSGGLSKDEIENMI+KAEE A  DK+KR+++E+VNQ ESIV+DTE+K++EFKSQLPAEECEKLK+ I  +R  LANK+    E ++KAT+ LQQSSLKLFE+AYKKM+
Sbjct:   37 NGI---SSQLRYKSGEVKGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTNSANTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVSSTDGKVYSPSQIGAFILMKMKETAEAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKTEDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTLLGGEDFDNHIVNFLVAEFKKDSGIDIRKDNIAMQRLKEAAEKAKCELSSSQQTDINLPYLTMDAAGPQHMNLKLTRSKLESLVGDLIKRTIQPCQKALSDAEVSKSEIGEVLLVGGMTRMPKVQSTVQELFGRQPSRSVNPDEAVAVGAAVQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTRLISRNTTIPTKKSQVFSTASDGQTQVEIKVHQGEREMANDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAKDKGTGKEQQIVIQSSGGLSKDEIENMIKKAEEYATADKQKRELIEIVNQGESIVHDTETKMEEFKSQLPAEECEKLKKEIADLRTLLANKETADLEEVRKATSSLQQSSLKLFELAYKKMS 656          
BLAST of Hsp70 vs. Ensembl Fly
Match: Hsc70-5 (gene:FBgn0001220 transcript:FBtr0087568)

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 485/623 (77.85%), Postives = 561/623 (90.05%), Query Frame = 1
Query:   85 NGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQN-KMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            NG+   S  +R    +VKG VIGIDLGTTNSC++VM+GK  KV+ENAEGARTTPS VAFT DGERLVG PAKRQAV NSANT +ATKRLIGRR+D+PEV+KD+ N+SYK+V+ASNGDAWV + + K+YSPSQIGAF+L+KMKETAE+YL T VKNAVVTVPAYFNDSQRQATKDAGQI+GLNVLRVINEPTAAALAYG+DKT+DKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDT LGGEDFDN ++ ++V EFK++ G+D+ KD +A+QR++EAAEKAK ELSS+ QTDINLPYLTMD  GP+H++LKLTRSKLE LV  LIKRTI PC+KA+ DAEV  SEI EVLLVGGMTRMPKVQ TVQ+LFGR PS+SVNPDEAVA+GAA+QGGVLAGDVTDVLLLDVTPLSLGIETLGGVFT+LI+RNTTIPTKKSQVFSTA+DGQTQVEIKVHQGEREMA DNKLLG F+L+GIPPAPRG+PQ+EV FDIDANGIV+VSA+DKGTGKEQQIVIQSSGGLSKDEIENMI+KAEE A  DK+KR+++E+VNQ ESIV+DTE+K++EFKSQLPAEECEKLK+ I  +R  LANK+    E ++KAT+ LQQSSLKLFE+AYKKM+
Sbjct:   37 NGI---SSQLRYKSGEVKGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTNSANTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVSSTDGKVYSPSQIGAFILMKMKETAEAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKTEDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTLLGGEDFDNHIVNFLVAEFKKDSGIDIRKDNIAMQRLKEAAEKAKCELSSSQQTDINLPYLTMDAAGPQHMNLKLTRSKLESLVGDLIKRTIQPCQKALSDAEVSKSEIGEVLLVGGMTRMPKVQSTVQELFGRQPSRSVNPDEAVAVGAAVQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTRLISRNTTIPTKKSQVFSTASDGQTQVEIKVHQGEREMANDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAKDKGTGKEQQIVIQSSGGLSKDEIENMIKKAEEYATADKQKRELIEIVNQGESIVHDTETKMEEFKSQLPAEECEKLKKEIADLRTLLANKETADLEEVRKATSSLQQSSLKLFELAYKKMS 656          
BLAST of Hsp70 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 517.694 bits (1332), Expect = 1.856e-173
Identity = 295/559 (52.77%), Postives = 394/559 (70.48%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEA----QNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXX----XXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE 1776
            K   +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N   T+   KRLIGR++D+  VQ DMK+  +++V A +G   +E     + K + P +I + VL KMKETAE+YLG TV NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I  G+FEVKST+GDT LGGEDFDN L+ + V EFKR+   D+  +  AL+R+R A E+AK  LSS+ Q  I +  L  + T        +TR++ E+L   L + T+DP EKA++DA++  S I +++LVGG TR+PKVQ  +Q LF G+  +KS+NPDEAVA GAA+Q        + +V D+LLLDVTPLSLGIET GGV + LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NV+A ++ T KE +I I +  G LSK++IE M+ +AE+    D+K+++ +   N  ES  ++ ++ +DE
Sbjct:    3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSA-DGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSL-FEGT---DFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE 555          
BLAST of Hsp70 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 517.694 bits (1332), Expect = 1.856e-173
Identity = 295/559 (52.77%), Postives = 394/559 (70.48%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEA----QNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXX----XXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE 1776
            K   +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N   T+   KRLIGR++D+  VQ DMK+  +++V A +G   +E     + K + P +I + VL KMKETAE+YLG TV NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I  G+FEVKST+GDT LGGEDFDN L+ + V EFKR+   D+  +  AL+R+R A E+AK  LSS+ Q  I +  L  + T        +TR++ E+L   L + T+DP EKA++DA++  S I +++LVGG TR+PKVQ  +Q LF G+  +KS+NPDEAVA GAA+Q        + +V D+LLLDVTPLSLGIET GGV + LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NV+A ++ T KE +I I +  G LSK++IE M+ +AE+    D+K+++ +   N  ES  ++ ++ +DE
Sbjct:    3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSA-DGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSL-FEGT---DFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE 555          
BLAST of Hsp70 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 517.694 bits (1332), Expect = 1.856e-173
Identity = 295/559 (52.77%), Postives = 394/559 (70.48%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEA----QNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXX----XXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE 1776
            K   +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N   T+   KRLIGR++D+  VQ DMK+  +++V A +G   +E     + K + P +I + VL KMKETAE+YLG TV NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I  G+FEVKST+GDT LGGEDFDN L+ + V EFKR+   D+  +  AL+R+R A E+AK  LSS+ Q  I +  L  + T        +TR++ E+L   L + T+DP EKA++DA++  S I +++LVGG TR+PKVQ  +Q LF G+  +KS+NPDEAVA GAA+Q        + +V D+LLLDVTPLSLGIET GGV + LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NV+A ++ T KE +I I +  G LSK++IE M+ +AE+    D+K+++ +   N  ES  ++ ++ +DE
Sbjct:    3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSA-DGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSL-FEGT---DFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE 555          
BLAST of Hsp70 vs. Ensembl Zebrafish
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 553/608 (90.95%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + ++G VIGIDLGTTNSCV+VMDGK  KVLENAEGARTTPSVVAFTSDGERLVG PAKRQAV N  NTL+ATKRLIGRR+D+ EVQKD+KNV YKIVRASNGDAW+E   KMYSPSQ GAF+LIKMKETAESYLG +VKNAVVTVPAYFNDSQRQATKDAGQI+GLNVLRVINEPTAAALAYGLDKT DKIIAV+DLGGGTFDISVLEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFK+E GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD +GPKHL++KLTRS+ E +V  LI+RT+ PC+KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSKSVNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNK+LGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++++D VE VN AE IV+DTESK++EFK QLPA+EC KLK+ I  VR+ L+ KD ET E+IK+A   LQQ+SLKLFEMAYKKMA
Sbjct:   52 EAIRGAVIGIDLGTTNSCVAVMDGKNAKVLENAEGARTTPSVVAFTSDGERLVGMPAKRQAVTNPNNTLYATKRLIGRRFDDAEVQKDLKNVPYKIVRASNGDAWLEVHGKMYSPSQAGAFILIKMKETAESYLGQSVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGLDKTQDKIIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFLGGEDFDQHLLRHIVKEFKKESGVDLMKDNMALQRVREAAEKAKCELSSSLQTDINLPYLTMDASGPKHLNMKLTRSQFEGIVADLIRRTVAPCQKAMQDAEVSKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKSVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMATDNKVLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRRKDRVEAVNMAEGIVHDTESKMEEFKDQLPADECNKLKEEISKVRELLSRKDTETGENIKQAATSLQQASLKLFEMAYKKMA 659          
BLAST of Hsp70 vs. Ensembl Zebrafish
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 553/608 (90.95%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + ++G VIGIDLGTTNSCV+VMDGK  KVLENAEGARTTPSVVAFTSDGERLVG PAKRQAV N  NTL+ATKRLIGRR+D+ EVQKD+KNV YKIVRASNGDAW+E   KMYSPSQ GAF+LIKMKETAESYLG +VKNAVVTVPAYFNDSQRQATKDAGQI+GLNVLRVINEPTAAALAYGLDKT DKIIAV+DLGGGTFDISVLEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFK+E GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD +GPKHL++KLTRS+ E +V  LI+RT+ PC+KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSKSVNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNK+LGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++++D VE VN AE IV+DTESK++EFK QLPA+EC KLK+ I  VR+ L+ KD ET E+IK+A   LQQ+SLKLFEMAYKKMA
Sbjct:   52 EAIRGAVIGIDLGTTNSCVAVMDGKNAKVLENAEGARTTPSVVAFTSDGERLVGMPAKRQAVTNPNNTLYATKRLIGRRFDDAEVQKDLKNVPYKIVRASNGDAWLEVHGKMYSPSQAGAFILIKMKETAESYLGQSVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGLDKTQDKIIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFLGGEDFDQHLLRHIVKEFKKESGVDLMKDNMALQRVREAAEKAKCELSSSLQTDINLPYLTMDASGPKHLNMKLTRSQFEGIVADLIRRTVAPCQKAMQDAEVSKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKSVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMATDNKVLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRRKDRVEAVNMAEGIVHDTESKMEEFKDQLPADECNKLKEEISKVRELLSRKDTETGENIKQAATSLQQASLKLFEMAYKKMA 659          
BLAST of Hsp70 vs. Ensembl Zebrafish
Match: hsp70.2 (heat shock cognate 70-kd protein, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110405-1])

HSP 1 Score: 535.413 bits (1378), Expect = 2.182e-180
Identity = 304/607 (50.08%), Postives = 414/607 (68.20%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWV----EAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI--DEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQ 1908
            KG  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+P VQ DMK+ S+K+V +  G   V    + +NK ++P +I + VL+KMKE AE+YLG  V NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK  + ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN ++ + V EFKR+   D++++  AL+R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA++DA++  ++I +++LVGG TR+PK+Q+ +Q  F GR  +KS+NPDEAVA GAA+Q  +L GD +  +      DV PLSLGIET GGV T LI RNTTIPTK++Q FST +D Q  V I+V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSK+EIE M+++A+     D  +R+ +   N  ES  ++ ++ +  D  K ++  E+ +++ +        L N      E  +    EL++
Sbjct:    5 KGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFKVV-SDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKSSERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGID------FYTSITRARFEELCSDLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFSTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKQNKITITNDKGRLSKEEIERMVQEADNYKAEDDLQREKISAKNSLESYAFNMKNSVEDDNLKGKISEEDKKRVIEKCNEAVSWLENNQLADKEEYEHQLKELEK 603          
BLAST of Hsp70 vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 535.413 bits (1378), Expect = 2.278e-180
Identity = 304/607 (50.08%), Postives = 415/607 (68.37%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWV----EAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI--DEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQ 1908
            KG  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+P VQ DMK+ S+K+V +  G   V    + +NK ++P +I + VL+KMKE AE+YLG  V NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK  + ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN ++ + V EFKR+   D++++  AL+R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA+KDA++  ++I +++LVGG TR+PK+Q+ +Q  F GR  +KS+NPDEAVA GAA+Q  +L GD +  +      DV PLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSK+EIE M+++A++    D  +R+ +   N  ES  ++ ++ +  D  K ++  E+ +++ +        L N      E  +    EL++
Sbjct:    5 KGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFKVV-SDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKSSERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGID------FYTSITRARFEELCSDLFRGTLDPVEKALKDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKQNKITITNDKGRLSKEEIERMVQEADKYKAEDDLQREKISAKNSLESYAFNMKNSVEDDNLKGKISEEDKKRVIEKCNEAVSWLENNQLADKEEYEHQLKELEK 603          
BLAST of Hsp70 vs. Ensembl Zebrafish
Match: hsp70.3 (heat shock cognate 70-kd protein, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-110713-1])

HSP 1 Score: 534.643 bits (1376), Expect = 4.212e-180
Identity = 303/607 (49.92%), Postives = 415/607 (68.37%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWV----EAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI--DEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQ 1908
            KG  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+P VQ DMK+ S+K+V +  G   V    + +NK ++P +I + VL+KMKE AE+YLG  V NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK  + ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN ++ + V EFKR+   D++++  AL+R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA++DA++  ++I +++LVGG TR+PK+Q+ +Q  F GR  +KS+NPDEAVA GAA+Q  +L GD +  +      DV PLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSK+EIE M+++A++    D  +R+ +   N  ES  ++ ++ +  D  K ++  E+ +++ +        L N      E  +    EL++
Sbjct:    5 KGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFKVV-SDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKSSERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGID------FYTSITRARFEELCSDLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKQNKITITNDKGRLSKEEIERMVQEADKYKAEDDLQREKISAKNSLESYAFNMKNSVEDDNLKGKISEEDKKRVIEKCNEAVSWLENNQLADKEEYEHQLKELEK 603          
BLAST of Hsp70 vs. Ensembl Xenopus
Match: blvrb (biliverdin reductase B [Source:Xenbase;Acc:XB-GENE-1006837])

HSP 1 Score: 945.651 bits (2443), Expect = 0.000e+0
Identity = 490/641 (76.44%), Postives = 567/641 (88.46%), Query Frame = 1
Query:   31 TIFHISRIMLK-MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            ++ H+SRI+ K       Q+ L +  K      + +KG VIGIDLGTTNSCV++M+GK  KVLEN+EGARTTPSVVAF+SD ERLVG PAKRQAV N  NT +ATKRLIGRR+D+PEVQKD+KNV +KIV+ASNGDAW+E+  K+YSPSQIGAFVL+KMKETAE+YLG   KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK+DDKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LLQ+IV +FKRE GVD+ KD MALQRVREAAEKAK ELSSA+QTDINLPYLTMD +GPKHL++KLTR++ E +V  LIKRT+ P +KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLI RNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMA+DNKLLGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D+++++ VE VN AE I++DTESK++EFK QLPA+EC KLK+ I  V++ L  KD ET E+I+ A++ LQQ+SLKLFEMAYKKMA
Sbjct:   11 SLSHVSRILRKGCFNGLSQDVLQSVFKR-DYASESIKGAVIGIDLGTTNSCVAIMEGKQAKVLENSEGARTTPSVVAFSSDAERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDPEVQKDIKNVPFKIVKASNGDAWLESHGKLYSPSQIGAFVLMKMKETAENYLGHAAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSDDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLQHIVKQFKRESGVDLTKDNMALQRVREAAEKAKCELSSALQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVADLIKRTVAPSQKAMQDAEVGKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLIGRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMASDNKLLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRRKERVEAVNNAEGIIHDTESKMEEFKDQLPADECNKLKEEISKVKELLTRKDEETGETIRNASSTLQQASLKLFEMAYKKMA 650          
BLAST of Hsp70 vs. Ensembl Xenopus
Match: blvrb (biliverdin reductase B [Source:Xenbase;Acc:XB-GENE-1006837])

HSP 1 Score: 941.414 bits (2432), Expect = 0.000e+0
Identity = 482/608 (79.28%), Postives = 553/608 (90.95%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + +KG VIGIDLGTTNSCV++M+GK  KVLEN+EGARTTPSVVAF+SD ERLVG PAKRQAV N  NT +ATKRLIGRR+D+PEVQKD+KNV +KIV+ASNGDAW+E+  K+YSPSQIGAFVL+KMKETAE+YLG   KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK+DDKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LLQ+IV +FKRE GVD+ KD MALQRVREAAEKAK ELSSA+QTDINLPYLTMD +GPKHL++KLTR++ E +V  LIKRT+ P +KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLI RNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMA+DNKLLGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D+++++ VE VN AE I++DTESK++EFK QLPA+EC KLK+ I  V++ L  KD ET E+I+ A++ LQQ+SLKLFEMAYKKMA
Sbjct:   34 ESIKGAVIGIDLGTTNSCVAIMEGKQAKVLENSEGARTTPSVVAFSSDAERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDPEVQKDIKNVPFKIVKASNGDAWLESHGKLYSPSQIGAFVLMKMKETAENYLGHAAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSDDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLQHIVKQFKRESGVDLTKDNMALQRVREAAEKAKCELSSALQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVADLIKRTVAPSQKAMQDAEVGKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLIGRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMASDNKLLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRRKERVEAVNNAEGIIHDTESKMEEFKDQLPADECNKLKEEISKVKELLTRKDEETGETIRNASSTLQQASLKLFEMAYKKMA 641          
BLAST of Hsp70 vs. Ensembl Xenopus
Match: blvrb (biliverdin reductase B [Source:Xenbase;Acc:XB-GENE-1006837])

HSP 1 Score: 941.028 bits (2431), Expect = 0.000e+0
Identity = 488/640 (76.25%), Postives = 566/640 (88.44%), Query Frame = 1
Query:   31 TIFHISRIMLK-MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKM 1947
            ++ H+SRI+ K       Q+ L +  K      + +KG VIGIDLGTTNSCV++M+GK  KVLEN+EGARTTPSVVAF+SD ERLVG PAKRQAV N  NT +ATKRLIGRR+D+PEVQKD+KNV +KIV+ASNGDAW+E+  K+YSPSQIGAFVL+KMKETAE+YLG   KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK+DDKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LLQ+IV +FKRE GVD+ KD MALQRVREAAEKAK ELSSA+QTDINLPYLTMD +GPKHL++KLTR++ E +V  LIKRT+ P +KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLI RNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMA+DNKLLGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D+++++ VE VN AE I++DTESK++EFK QLPA+EC KLK+ I  V++ L  KD ET E+I+ A++ LQQ+SLKLFEMAYKK+
Sbjct:   11 SLSHVSRILRKGCFNGLSQDVLQSVFKR-DYASESIKGAVIGIDLGTTNSCVAIMEGKQAKVLENSEGARTTPSVVAFSSDAERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDPEVQKDIKNVPFKIVKASNGDAWLESHGKLYSPSQIGAFVLMKMKETAENYLGHAAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSDDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLQHIVKQFKRESGVDLTKDNMALQRVREAAEKAKCELSSALQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVADLIKRTVAPSQKAMQDAEVGKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLIGRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMASDNKLLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRRKERVEAVNNAEGIIHDTESKMEEFKDQLPADECNKLKEEISKVKELLTRKDEETGETIRNASSTLQQASLKLFEMAYKKL 649          
BLAST of Hsp70 vs. Ensembl Xenopus
Match: blvrb (biliverdin reductase B [Source:Xenbase;Acc:XB-GENE-1006837])

HSP 1 Score: 939.873 bits (2428), Expect = 0.000e+0
Identity = 488/640 (76.25%), Postives = 566/640 (88.44%), Query Frame = 1
Query:   31 TIFHISRIMLK-MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKM 1947
            ++ H+SRI+ K       Q+ L +  K      + +KG VIGIDLGTTNSCV++M+GK  KVLEN+EGARTTPSVVAF+SD ERLVG PAKRQAV N  NT +ATKRLIGRR+D+PEVQKD+KNV +KIV+ASNGDAW+E+  K+YSPSQIGAFVL+KMKETAE+YLG   KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK+DDKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LLQ+IV +FKRE GVD+ KD MALQRVREAAEKAK ELSSA+QTDINLPYLTMD +GPKHL++KLTR++ E +V  LIKRT+ P +KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLI RNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMA+DNKLLGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D+++++ VE VN AE I++DTESK++EFK QLPA+EC KLK+ I  V++ L  KD ET E+I+ A++ LQQ+SLKLFEMAYKK+
Sbjct:   11 SLSHVSRILRKGCFNGLSQDVLQSVFKR-DYASESIKGAVIGIDLGTTNSCVAIMEGKQAKVLENSEGARTTPSVVAFSSDAERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDPEVQKDIKNVPFKIVKASNGDAWLESHGKLYSPSQIGAFVLMKMKETAENYLGHAAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSDDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLQHIVKQFKRESGVDLTKDNMALQRVREAAEKAKCELSSALQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVADLIKRTVAPSQKAMQDAEVGKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLIGRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMASDNKLLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRRKERVEAVNNAEGIIHDTESKMEEFKDQLPADECNKLKEEISKVKELLTRKDEETGETIRNASSTLQQASLKLFEMAYKKV 649          
BLAST of Hsp70 vs. Ensembl Xenopus
Match: blvrb (biliverdin reductase B [Source:Xenbase;Acc:XB-GENE-1006837])

HSP 1 Score: 939.873 bits (2428), Expect = 0.000e+0
Identity = 488/639 (76.37%), Postives = 565/639 (88.42%), Query Frame = 1
Query:   31 TIFHISRIMLK-MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKK 1944
            ++ H+SRI+ K       Q+ L +  K      + +KG VIGIDLGTTNSCV++M+GK  KVLEN+EGARTTPSVVAF+SD ERLVG PAKRQAV N  NT +ATKRLIGRR+D+PEVQKD+KNV +KIV+ASNGDAW+E+  K+YSPSQIGAFVL+KMKETAE+YLG   KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK+DDKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LLQ+IV +FKRE GVD+ KD MALQRVREAAEKAK ELSSA+QTDINLPYLTMD +GPKHL++KLTR++ E +V  LIKRT+ P +KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLI RNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMA+DNKLLGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D+++++ VE VN AE I++DTESK++EFK QLPA+EC KLK+ I  V++ L  KD ET E+I+ A++ LQQ+SLKLFEMAYKK
Sbjct:   11 SLSHVSRILRKGCFNGLSQDVLQSVFKR-DYASESIKGAVIGIDLGTTNSCVAIMEGKQAKVLENSEGARTTPSVVAFSSDAERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDPEVQKDIKNVPFKIVKASNGDAWLESHGKLYSPSQIGAFVLMKMKETAENYLGHAAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSDDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLQHIVKQFKRESGVDLTKDNMALQRVREAAEKAKCELSSALQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVADLIKRTVAPSQKAMQDAEVGKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLIGRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMASDNKLLGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRRKERVEAVNNAEGIIHDTESKMEEFKDQLPADECNKLKEEISKVKELLTRKDEETGETIRNASSTLQQASLKLFEMAYKK 648          
BLAST of Hsp70 vs. Ensembl Mouse
Match: Hspa9 (heat shock protein 9 [Source:MGI Symbol;Acc:MGI:96245])

HSP 1 Score: 948.732 bits (2451), Expect = 0.000e+0
Identity = 493/628 (78.50%), Postives = 561/628 (89.33%), Query Frame = 1
Query:   79 GQNGLT----TYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            G NGL+     +        + +KG V+GIDLGTTNSCV+VM+GK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NT +ATKRLIGRRYD+PEVQKD KNV +KIVRASNGDAWVEA  K+YSPSQIGAFVL+KMKETAE+YLG T KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK++DK+IAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD +GPKHL++KLTR++ E +V  LIKRTI PC+KA++DAEV  S+I EV+LVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNKLLGQF+LIGIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++K++ VE VN AE I++DTE+K++EFK QLPA+EC KLK+ I  +R  LA KD+ET E+I++A + LQQ+SLKLFEMAYKKMA
Sbjct:   29 GWNGLSHEAFRFVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIKRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRALLAGKDSETGENIRQAASSLQQASLKLFEMAYKKMA 656          
BLAST of Hsp70 vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 522.702 bits (1345), Expect = 2.509e-175
Identity = 298/564 (52.84%), Postives = 400/564 (70.92%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVR-ASNGDAWVE--AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQ 1788
            KG  +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+  VQ DMK+  + +V  A      VE   + K + P ++ + VL KMKE AE+YLG TV NAVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + + EFKR+   D++++  A++R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA++DA++  S+I +++LVGG TR+PK+Q+ +Q  F G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DVTPLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D+K+RD V   N  ES  ++ ++ +++ K Q
Sbjct:    3 KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGID------FYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQ 559          
BLAST of Hsp70 vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 517.694 bits (1332), Expect = 2.601e-173
Identity = 294/603 (48.76%), Postives = 409/603 (67.83%), Query Frame = 1
Query:  139 GHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE-----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD-DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXX--IETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI---DEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQ 1908
            G V+GIDLGTT SCV V      +++ N +G R TPS VAFT +GERL+G  AK Q   N  NT+   KRLIGR +++P VQ+D+K + +K+V       +++      Q K ++P +I A VL KMKETAE+YLG  V +AVVTVPAYFND+QRQATKDAG I+GLNV+R+INEPTAAA+AYGLDK + +K I VFDLGGGTFD+S+L I  GVFEV +T+GDT LGGEDFD  ++++ +  +K++ G DV KD  A+Q++R   EKAK  LSS  Q  I +          +  S  LTR+K E+L   L + T+ P +K ++D+++K S+I E++LVGG TR+PK+Q+ V++ F G+ PS+ +NPDEAVA GAA+Q GVL+GD     L+ +    L   IET+GGV TKLI RNT +PTKKSQ+FSTA+D Q  V IKV++GER +  DN LLG F L GIPPAPRG+PQ+EVTF+ID NGI+ V+A DKGTG + +I I +    L+ +EIE M+  AE+ AE DKK ++ ++  N+ ES  Y  +++I   ++   +L +E+ E +++ ++   + L +  +   E  K    EL++
Sbjct:   29 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEG----EDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEE 626          
BLAST of Hsp70 vs. Ensembl Mouse
Match: Hspa5 (heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95835])

HSP 1 Score: 517.694 bits (1332), Expect = 2.601e-173
Identity = 294/603 (48.76%), Postives = 409/603 (67.83%), Query Frame = 1
Query:  139 GHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE-----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD-DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXX--IETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI---DEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQ 1908
            G V+GIDLGTT SCV V      +++ N +G R TPS VAFT +GERL+G  AK Q   N  NT+   KRLIGR +++P VQ+D+K + +K+V       +++      Q K ++P +I A VL KMKETAE+YLG  V +AVVTVPAYFND+QRQATKDAG I+GLNV+R+INEPTAAA+AYGLDK + +K I VFDLGGGTFD+S+L I  GVFEV +T+GDT LGGEDFD  ++++ +  +K++ G DV KD  A+Q++R   EKAK  LSS  Q  I +          +  S  LTR+K E+L   L + T+ P +K ++D+++K S+I E++LVGG TR+PK+Q+ V++ F G+ PS+ +NPDEAVA GAA+Q GVL+GD     L+ +    L   IET+GGV TKLI RNT +PTKKSQ+FSTA+D Q  V IKV++GER +  DN LLG F L GIPPAPRG+PQ+EVTF+ID NGI+ V+A DKGTG + +I I +    L+ +EIE M+  AE+ AE DKK ++ ++  N+ ES  Y  +++I   ++   +L +E+ E +++ ++   + L +  +   E  K    EL++
Sbjct:   29 GTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEG----EDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEE 626          
BLAST of Hsp70 vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 516.538 bits (1329), Expect = 3.193e-173
Identity = 298/598 (49.83%), Postives = 411/598 (68.73%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD----DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXX----XXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEECEKLKQLIQTV-----RDRLANKD 1860
            +G  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++++  VQ DMK+  +++V +  G   V+     + K + P +I + VL KMKE AE+YLG  V++AV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK      +K + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ ++  EFKR+   D+  +  A++R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T++P EKA++DA++   +I+E++LVGG TR+PK+Q+ +Q  F G+  +KS+NPDEAVA GAA+Q        + +V D+LLLDVTPLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q+ V ++V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NV+A DK TGKE +I I +  G LSKD+I+ M+++AE     D+  RD V   N  ES  Y+ +  +++   + ++  ++  K+    Q V     R+++A KD
Sbjct:    4 RGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVV-SEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVD------FYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKD 593          
BLAST of Hsp70 vs. UniProt/SwissProt
Match: sp|P11141|HSP7F_CAEEL (Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=hsp-6 PE=1 SV=2)

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 491/615 (79.84%), Postives = 553/615 (89.92%), Query Frame = 1
Query:  109 NVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK-TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + R   DK KGHVIGIDLGTTNSCVS+M+GKTPKV+ENAEG RTTPS VAFT+DGERLVG PAKRQAV NSANTL ATKRLIGRRY++PEVQKD+K V YKIV+ASNGDAWVEAQ K+YSPSQ+GAFVL+KMKETAESYLGTTV NAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK   DKIIAV+DLGGGTFD+S+LEIQKGVFEVKST+GDTFLGGEDFD+ L+ ++V EFK+EQGVD+ KDP A+QR+REAAEKAK ELSS  QTDINLPY+TMD +GPKHL+LKLTR+K EQ+V  LIKRTI+PC KA+ DAEVK+S+I +VLLVGGM+RMPKVQ TVQ++FG+VPSK+VNPDEAVAMGAAIQG VLAGDVTDVLLLDVTPLSLGIETLGG+ TKLI RNTTIPTKKSQVFSTAADGQTQV+IKV QGEREMA  NKLLGQFSL+GIPPAPRG+PQVEVTFDIDANGIVNVSARD+GTGKEQQIVIQSSGGLSKD+IENMI++AE+NA  D K++++VEV+NQAE I++DTE+K+ EF  QLP +ECE L+  I   +  L NKDNET E+IK+A N LQQ SLKLFE AYK MA
Sbjct:   21 SARSLSDKPKGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQAVTNSANTLFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEAQGKVYSPSQVGAFVLMKMKETAESYLGTTVNNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKDAGDKIIAVYDLGGGTFDVSILEIQKGVFEVKSTNGDTFLGGEDFDHALVHHLVGEFKKEQGVDLTKDPQAMQRLREAAEKAKCELSSTTQTDINLPYITMDQSGPKHLNLKLTRAKFEQIVGDLIKRTIEPCRKALHDAEVKSSQIADVLLVGGMSRMPKVQATVQEIFGKVPSKAVNPDEAVAMGAAIQGAVLAGDVTDVLLLDVTPLSLGIETLGGIMTKLITRNTTIPTKKSQVFSTAADGQTQVQIKVFQGEREMATSNKLLGQFSLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDRGTGKEQQIVIQSSGGLSKDQIENMIKEAEKNAAEDAKRKELVEVINQAEGIIHDTEAKMTEFADQLPKDECEALRTKIADTKKILDNKDNETPEAIKEACNTLQQQSLKLFEAAYKNMA 635          
BLAST of Hsp70 vs. UniProt/SwissProt
Match: sp|O35501|GRP75_CRIGR (Stress-70 protein, mitochondrial OS=Cricetulus griseus OX=10029 GN=HSPA9 PE=2 SV=1)

HSP 1 Score: 952.199 bits (2460), Expect = 0.000e+0
Identity = 493/628 (78.50%), Postives = 562/628 (89.49%), Query Frame = 1
Query:   79 GQNGLT----TYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            G NGL+     +        + +KG V+GIDLGTTNSCV+VM+GK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NT +ATKRLIGRRYD+PEVQKD KNV +KIVRASNGDAWVEA  K+YSPSQIGAFVL+KMKETAE+YLG T KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK++DKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD +GPKHL++KLTR++ E +V  LIKRTI PC+KA++DAEV  S+I EV+LVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNKLLGQF+LIGIPPAPRG+PQ+EVTFD+DANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++K++ VE VN AE I++DTE+K++EFK QLPA+EC KLK+ I  +R+ LA KD+ET E+I++A + LQQ+SLKLFEMAYKKMA
Sbjct:   29 GWNGLSHEAFRFVSRRDYASETIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIKRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDLDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMA 656          
BLAST of Hsp70 vs. UniProt/SwissProt
Match: sp|P38646|GRP75_HUMAN (Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2)

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 488/608 (80.26%), Postives = 558/608 (91.78%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + +KG V+GIDLGTTNSCV+VM+GK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NT +ATKRLIGRRYD+PEVQKD+KNV +KIVRASNGDAWVEA  K+YSPSQIGAFVL+KMKETAE+YLG T KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK++DK+IAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD++GPKHL++KLTR++ E +V  LI+RTI PC+KA++DAEV  S+I EV+LVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNKLLGQF+LIGIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++K++ VE VN AE I++DTE+K++EFK QLPA+EC KLK+ I  +R+ LA KD+ET E+I++A + LQQ+SLKLFEMAYKKMA
Sbjct:   49 EAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMA 656          
BLAST of Hsp70 vs. UniProt/SwissProt
Match: sp|Q3ZCH0|GRP75_BOVIN (Stress-70 protein, mitochondrial OS=Bos taurus OX=9913 GN=HSPA9 PE=2 SV=1)

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 494/628 (78.66%), Postives = 566/628 (90.13%), Query Frame = 1
Query:   79 GQNGLTTYSKNV---RLFG-DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            G NGL+  +  +   R +  + +KG V+GIDLGTTNSCV+VM+GK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NT +ATKRLIGRRYD+PEVQKD+KNV +KIVRASNGDAWVEA  K+YSPSQIGAFVL+KMKETAE+YLG T KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK++DKIIAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD +GPKHL++KLTR++ E +V  LI+RTI PC+KA++DAEV  S+I EV+LVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNKLLGQF+LIGIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++K++ VE VN AE I++DTE+K++EFK QLPA+EC KLK+ I  +R+ LA KD+ET E+I++A + LQQ+SLKLFEMAYKKMA
Sbjct:   29 GWNGLSHEAFRIVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMA 656          
BLAST of Hsp70 vs. UniProt/SwissProt
Match: sp|Q5R511|GRP75_PONAB (Stress-70 protein, mitochondrial OS=Pongo abelii OX=9601 GN=HSPA9 PE=2 SV=1)

HSP 1 Score: 951.044 bits (2457), Expect = 0.000e+0
Identity = 492/628 (78.34%), Postives = 567/628 (90.29%), Query Frame = 1
Query:   79 GQNGLTTYSKNV---RLFG-DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            G NGL+  +  +   R +  + +KG V+GIDLGTTNSCV+VM+GK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NT +ATKRLIGRRYD+PEVQKD+KNV +KIVRASNGDAWVEA  K+YSPSQIGAFVL+KMKETAE+YLG T KNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK++DK+IAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD++GPKHL++KL+R++ E +V  LI+RTI PC+KA++DAEV  S+I EV+LVGGMTRMPKVQ+TVQ LFGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNKLLGQF+LIGIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENM++ AE+ AE D++K++ VE VN AE I++DTE+K++EFK QLPA+EC KLK+ I  +R+ LA KD+ET E+I++A + LQQ+SLKLFEMAYKKMA
Sbjct:   29 GWNGLSHEAFRIVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLSRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMA 656          
BLAST of Hsp70 vs. TrEMBL
Match: F1AGC3 (Hsp70 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 599/600 (99.83%), Postives = 600/600 (100.00%), Query Frame = 1
Query:  148 IGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKM 1947
            IGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIRKAEENAENDKKKRDMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKK+
Sbjct:    1 IGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIRKAEENAENDKKKRDMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKV 600          
BLAST of Hsp70 vs. TrEMBL
Match: D1GJ91 (Mortalin-like protein OS=Dugesia japonica OX=6161 GN=mot PE=2 SV=1)

HSP 1 Score: 1126.69 bits (2913), Expect = 0.000e+0
Identity = 591/644 (91.77%), Postives = 615/644 (95.50%), Query Frame = 1
Query:   40 HISRIMLKMMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNV-------SARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            H SRIMLKMMKLFGQN L  Y KN+RL+ DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEG   T SVVAFT DGERLVGTPAKRQAVINSANTLHATKRLIGRR+DE EVQKDMKNVSYKIVRASNGDAWVEAQ KMYSPSQIGAFVL+KMKETAE+YLGT VKNAV+TVPAYFNDSQRQATKDAGQI+GLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFD+SVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIV+EFK+EQ VD+ KDPMA+QRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTI+PCEK IKDAEVKTSEI EVLLVGGMTRMP+VQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNK+LGQFSLIGIPPAPRG+PQ+EVTFDIDANGIVNV       SARDKGTGKEQQIVIQSSGGLSKDEIENMI++AEENAENDK+KR+MVEVVNQAE IVYDTESKIDEFKSQLPAEECEKLK LIQ VRD+LANKD ET+E+IKKATNELQQSSLKLFEMAYKKMA
Sbjct:   10 HTSRIMLKMMKLFGQNSLNNYCKNIRLYSDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGKNYT-SVVAFTGDGERLVGTPAKRQAVINSANTLHATKRLIGRRFDEHEVQKDMKNVSYKIVRASNGDAWVEAQRKMYSPSQIGAFVLMKMKETAENYLGTAVKNAVITVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDVSVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVSEFKKEQAVDITKDPMAMQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIEPCEKVIKDAEVKTSEITEVLLVGGMTRMPRVQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKILGQFSLIGIPPAPRGVPQIEVTFDIDANGIVNVSARDKGISARDKGTGKEQQIVIQSSGGLSKDEIENMIKRAEENAENDKRKREMVEVVNQAEGIVYDTESKIDEFKSQLPAEECEKLKNLIQQVRDKLANKDTETAENIKKATNELQQSSLKLFEMAYKKMA 652          
BLAST of Hsp70 vs. TrEMBL
Match: A0A293LZM4 (Heat shock 70 kDa protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 992.26 bits (2564), Expect = 0.000e+0
Identity = 506/606 (83.50%), Postives = 570/606 (94.06%), Query Frame = 1
Query:  133 VKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            VKG VIGIDLGTTNSCV+VM+GKTPKV+ENAEG+RTTPSVVAFT+DGERLVG PAKRQAV N+ANTL ATKRLIGR++++PEV+KDMK  SYKIVRASNGDAWVEA  KMYSPSQIGAFVL+KMKETAE YLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYG+DKTDDKIIAV+DLGGGTFDISVLEIQKGVFEVKST+GDTFLGGEDFDN L++++  EFKR+QG+DV KD MA+QR++EAAEKAKIELSS++QTDINLPYLTMD +GPKH++LKL+R+K E LV  LIKRT++PC+KA++DAEVK ++I EVLLVGGMTRMPKVQETVQ++FG+ PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMA DNKLLGQFSL+GIPPAPRG+PQ+EVTFDIDANGIV+VSARDKGTGKEQQIVIQSSGGLSK+EIENMI+ AE  AE D++K+++VE VNQAE I++DTESK+DEFK QLPAEEC KL++ I  VR+ LANKD E+SESIK+ATN+LQQ+SLKLFEMAYKKMA
Sbjct:   54 VKGAVIGIDLGTTNSCVAVMEGKTPKVIENAEGSRTTPSVVAFTADGERLVGMPAKRQAVTNAANTLSATKRLIGRKFEDPEVKKDMKTSSYKIVRASNGDAWVEAHGKMYSPSQIGAFVLMKMKETAEGYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGMDKTDDKIIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFLGGEDFDNALVKFLSQEFKRDQGIDVTKDNMAMQRLKEAAEKAKIELSSSVQTDINLPYLTMDQSGPKHMNLKLSRAKFEGLVADLIKRTVEPCKKAMQDAEVKRTDIGEVLLVGGMTRMPKVQETVQEIFGKQPSKAVNPDEAVAVGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMACDNKLLGQFSLVGIPPAPRGVPQIEVTFDIDANGIVHVSARDKGTGKEQQIVIQSSGGLSKEEIENMIKNAERYAEEDRQKKEVVEAVNQAEGIIHDTESKMDEFKDQLPAEECAKLREKISKVREILANKDKESSESIKQATNDLQQASLKLFEMAYKKMA 659          
BLAST of Hsp70 vs. TrEMBL
Match: Q5DGY9 (Heat shock 70kDa protein 9B OS=Schistosoma japonicum OX=6182 GN=HSPA9B PE=2 SV=1)

HSP 1 Score: 988.793 bits (2555), Expect = 0.000e+0
Identity = 511/629 (81.24%), Postives = 575/629 (91.41%), Query Frame = 1
Query:   64 MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            MMK F    L ++      +    KGHV+GIDLGTTNSCV+VM+GK PKVLEN+EG+RTTPSVVAFTSDGERLVG PAKRQAV NS+NT  ATKRLIGRR+++PEVQKDMKN ++KI++ASNGDAW+EA  K YSPSQIGAFVLIKMKETAESYLG+ VKN V+TVPAYFNDSQRQATKDAG+I+G+ VLRVINEPTAAALAYGLD+TDDK IAV+DLGGGTFDISVLEIQKGVFEVKST+GDTFLGGEDFDN LL+++V EF+REQG+DV KDPMALQRV+EAAEKAKIELSS++QTDINLPYLTMD  GPKH+ LKLTR+KLE LVE LIKRTIDPC KA+KDAEVK S+I E++LVGGMTRMPKVQETV+K+FG+ PSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGV TKLINRNTTIPTKKSQVFSTAADGQTQVEIKV+QGEREMA DNKLLGQFSL+GIPPAPRG+PQ+EVTFDIDANGIVNV+ARDKGTGKEQQIVI+S GGLSKDEIENM+R AE+ AE DKK+RD+VE VNQAESIV+DTESKI+E+K QLPA+E EKL  LI+ +R RL+NKD+ET+ESIK+ATNELQQ+SLKLFEMAY+KMA
Sbjct:   11 MMKFFRLRQLCSF------YSSGPKGHVVGIDLGTTNSCVAVMEGKQPKVLENSEGSRTTPSVVAFTSDGERLVGAPAKRQAVTNSSNTFSATKRLIGRRFNDPEVQKDMKNAAFKIIKASNGDAWLEAHGKAYSPSQIGAFVLIKMKETAESYLGSKVKNVVITVPAYFNDSQRQATKDAGKIAGMEVLRVINEPTAAALAYGLDRTDDKTIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFLGGEDFDNELLRFLVKEFQREQGIDVTKDPMALQRVKEAAEKAKIELSSSLQTDINLPYLTMDKAGPKHMHLKLTRAKLEHLVEPLIKRTIDPCNKALKDAEVKASDIGEIILVGGMTRMPKVQETVEKIFGKTPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVMTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVYQGEREMAGDNKLLGQFSLVGIPPAPRGVPQIEVTFDIDANGIVNVAARDKGTGKEQQIVIRSGGGLSKDEIENMVRNAEQYAEIDKKRRDLVESVNQAESIVHDTESKINEYKDQLPADEREKLTALIEKLRSRLSNKDSETAESIKEATNELQQASLKLFEMAYRKMA 633          
BLAST of Hsp70 vs. TrEMBL
Match: A0A2R5LMH1 (Putative molecular chaperone dnak OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 504/606 (83.17%), Postives = 570/606 (94.06%), Query Frame = 1
Query:  133 VKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            VKG VIGIDLGTTNSCV+VM+GKTPKV+ENAEG+RTTPSVVAFT+DGERLVG PAKRQAV N+ANTL ATKRLIGR++++PEV+KDMK  SYKIV+ASNGDAWVEA  KMYSPSQIGAFVL+KMKETAE Y+GTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYG+DKTDDKIIAV+DLGGGTFDISVLEIQKGVFEVKST+GDTFLGGEDFDN L++++  EFKR+QG+DV KD MA+QR++EAAEKAKIELSS++QTDINLPYLTMD +GPKH++LKL+R+K E LV  LIKRT+DPC+KA++DAEVK +EI EVLLVGGMTRMPKVQETVQ++FG+ PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMA DNKLLGQFSL+GIPPAPRG+PQ+EVTFDIDANGIV+VSARDKGTGKEQQIVIQSSGGLSK+EIENMI+ AE  AE D++K+++VE VNQAE I++DTESK+DEFK QLPAEEC KL++ I  VR+ LANK+ E+SE+IK+ATN+LQQ+SLKLFEMAYKKMA
Sbjct:   54 VKGAVIGIDLGTTNSCVAVMEGKTPKVIENAEGSRTTPSVVAFTADGERLVGMPAKRQAVTNAANTLSATKRLIGRKFEDPEVKKDMKTSSYKIVKASNGDAWVEAHGKMYSPSQIGAFVLMKMKETAEGYMGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGMDKTDDKIIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFLGGEDFDNALVKFLSQEFKRDQGLDVTKDNMAMQRLKEAAEKAKIELSSSVQTDINLPYLTMDQSGPKHMNLKLSRAKFEGLVADLIKRTVDPCKKAMQDAEVKRTEIGEVLLVGGMTRMPKVQETVQEIFGKQPSKAVNPDEAVAVGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMACDNKLLGQFSLVGIPPAPRGVPQIEVTFDIDANGIVHVSARDKGTGKEQQIVIQSSGGLSKEEIENMIKNAERYAEEDRQKKEVVEAVNQAEGIIHDTESKMDEFKDQLPAEECTKLREKIAKVREILANKEKESSETIKQATNDLQQASLKLFEMAYKKMA 659          
BLAST of Hsp70 vs. Ensembl Cavefish
Match: hspa9 (heat shock protein family A (Hsp70) member 9 [Source:NCBI gene;Acc:103036922])

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 493/608 (81.09%), Postives = 555/608 (91.28%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + +KG VIGIDLGTTNSCV+VMDGK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NTL+ATKRLIGRR+++ EVQKD+KNV +KIVRASNGDAW+EA  K+YSPSQ+GAFVL+KMKETAESYLG  VKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT DK+IAV+DLGGGTFDISVLEIQKGVFEVKST+GDTFLGGEDFD  LLQ+IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD++GPKHL++KLTR++ E +V  LI+RT+ PC+KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSKSVNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKK QVFSTAADGQTQVEIKV QGEREMAADNK+LGQF+L+GIPPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENMI+ AE+ AE D++++D VE VN AE IV+DTESK++EFK QLPA+EC KLK+ I  VRD L+ K+ ET E+IK+A   LQQ+SLKLFE+AYKKMA
Sbjct:   47 EAIKGAVIGIDLGTTNSCVAVMDGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPKNTLYATKRLIGRRFEDAEVQKDLKNVPFKIVRASNGDAWIEAHGKLYSPSQVGAFVLMKMKETAESYLGHNVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTQDKVIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFLGGEDFDQHLLQHIVKEFKRESGVDLTKDNMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVSDLIRRTVAPCQKAMQDAEVSKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKSVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKGQVFSTAADGQTQVEIKVCQGEREMAADNKILGQFTLVGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMIKNAEKYAEEDRRRKDRVEAVNMAEGIVHDTESKMEEFKDQLPADECNKLKEEITKVRDLLSRKETETGENIKQAATNLQQASLKLFEVAYKKMA 654          
BLAST of Hsp70 vs. Ensembl Cavefish
Match: hspa9 (heat shock protein family A (Hsp70) member 9 [Source:NCBI gene;Acc:103036922])

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 480/610 (78.69%), Postives = 541/610 (88.69%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQ---FSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKM 1947
            + +KG VIGIDLGTTNSCV+VMDGK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NTL+ATKRLIGRR+++ EVQKD+KNV +KIVRASNGDAW+EA  K+YSPSQ+GAFVL+KMKETAESYLG  VKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT DK+IAV+DLGGGTFDISVLEIQKGVFEVKST+GDTFLGGEDFD  LLQ+IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD++GPKHL++KLTR++ E +V  LI+RT+ PC+KA++DAEV  S+I EVLLVGGMTRMPKVQ+TVQ LFGR PSKSVNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKK QVFSTAADGQTQVEIKV QGEREMAADNK+LGQ   F+             +EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKD+IENMI+ AE+ AE D++++D VE VN AE IV+DTESK++EFK QLPA+EC KLK+ I  VRD L+ K+ ET E+IK+A   LQQ+SLKLFE+AYKK+
Sbjct:   54 EAIKGAVIGIDLGTTNSCVAVMDGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPKNTLYATKRLIGRRFEDAEVQKDLKNVPFKIVRASNGDAWIEAHGKLYSPSQVGAFVLMKMKETAESYLGHNVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTQDKVIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFLGGEDFDQHLLQHIVKEFKRESGVDLTKDNMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVSDLIRRTVAPCQKAMQDAEVSKSDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKSVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKGQVFSTAADGQTQVEIKVCQGEREMAADNKILGQNIEFT-------------IEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMIKNAEKYAEEDRRRKDRVEAVNMAEGIVHDTESKMEEFKDQLPADECNKLKEEITKVRDLLSRKETETGENIKQAATNLQQASLKLFEVAYKKV 650          
BLAST of Hsp70 vs. Ensembl Cavefish
Match: ENSAMXT00000055474.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:150188:156169:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000055474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 527.324 bits (1357), Expect = 9.281e-178
Identity = 297/577 (51.47%), Postives = 404/577 (70.02%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNK----MYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQL 1824
            KG  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++D+P VQ DMK+  +++V +  G   V+ ++K     + P +I + VL+KMKE AE+YLG  V NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK  T ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN L+ + V EFKR+   D++++  AL+R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E++   L + T++P EKA++DA++  S+I E++LVGG TR+PK+Q+ +Q  F GR  +KS+NPDEAVA GAA+Q  +L GD +  +      DV PLSLGIET GGV T LI RNTTIPTK++Q F+T AD Q  V ++V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSK+EIE M+++A++    D  +R+ +   N  ES  ++ ++ +++   +    E +K K+L
Sbjct:    5 KGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVV-SDGGKPKVQVEHKGEQKTFYPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKTGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGVD------FYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYADNQPGVLVQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVQEADQYKAEDDLQREKIAAKNSLESFAFNMKNSVEDENLKGKISEDDKKKEL 573          
BLAST of Hsp70 vs. Ensembl Cavefish
Match: ENSAMXT00000031477.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:148482:152871:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000031477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 527.324 bits (1357), Expect = 9.281e-178
Identity = 297/577 (51.47%), Postives = 404/577 (70.02%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNK----MYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQL 1824
            KG  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++D+P VQ DMK+  +++V +  G   V+ ++K     + P +I + VL+KMKE AE+YLG  V NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK  T ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN L+ + V EFKR+   D++++  AL+R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E++   L + T++P EKA++DA++  S+I E++LVGG TR+PK+Q+ +Q  F GR  +KS+NPDEAVA GAA+Q  +L GD +  +      DV PLSLGIET GGV T LI RNTTIPTK++Q F+T AD Q  V ++V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSK+EIE M+++A++    D  +R+ +   N  ES  ++ ++ +++   +    E +K K+L
Sbjct:    5 KGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVV-SDGGKPKVQVEHKGEQKTFYPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKTGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGVD------FYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYADNQPGVLVQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVQEADQYKAEDDLQREKIAAKNSLESFAFNMKNSVEDENLKGKISEDDKKKEL 573          
BLAST of Hsp70 vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 525.783 bits (1353), Expect = 1.146e-176
Identity = 301/594 (50.67%), Postives = 413/594 (69.53%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEE----CEKLKQLIQTVR-DRLANKD 1860
            KG  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++D+P VQ DMK+  +++V +  G   V+     + K ++P +I + VL+KMKE AE+YLG  V NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN L+ + V EFKR+   D++++  AL+R+R A E+AK  LSS+ Q  I +  L   + G    +  +TR++ E++   L + T++P EKA++DA++  S+I E++LVGG TR+PK+Q+ +Q  F GR  +KS+NPDEAVA GAA+Q  +L GD +  +      DV PLSLGIET GGV   LI RNTTIPTK++Q FST AD Q  V I+V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGK+ +I I +  G LSK+EIE M+++A++    D  +R+ +   N  ES  ++ ++ +++   K ++  ++     EK  Q I  +  ++LA+K+
Sbjct:    5 KGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVV-SDGGKPKVQVEYKGEQKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKKGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSL---HEGVDFYT-SITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMATLIKRNTTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVQEADQYKAEDDLQREKIAAKNSLESFAFNMKNSVEDENLKGKISEDDKKKVIEKCNQAISWLENNQLADKE 592          
BLAST of Hsp70 vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 488/606 (80.53%), Postives = 555/606 (91.58%), Query Frame = 1
Query:  133 VKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            ++G VIGIDLGTTNSCV+VM+GK  KVLENAEGARTTPSVVAFT+DGERLVG PAKRQAV N  NT +ATKRLIGRR+D+ +VQKDM N+SYKIVRASNGDAWVEA  KMYSPSQIGAFVL+KMKETAE+++GT+VKNAV+TVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK DDK+IAV+DLGGGTFDIS+LEIQKGVFEVKST+GDTFLGGEDFDN LL+YIV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD++GPKHL++KLTRS+ E +V  LI++TI PC+KA++D EV  S+I +V+LVGGMTRMPKVQ+TVQ++FGR PSK+VNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNK LGQF+L+G+PPAPRG+PQ+EVTFDIDANGIV+VSA+DKGTG+EQQIVIQSSGGLSKDEIENM++ AE+ AE D++++D VE VNQAE IV+D ESK++EFK QLPA+EC KLK+ I  VR+ L  KD ET E+IK+A + LQQSSLKLFEMAYKKMA
Sbjct:   51 IRGAVIGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRASNGDAWVEAHGKMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEEFKDQLPADECTKLKEEIAKVRELLTRKDTETGEAIKQAASTLQQSSLKLFEMAYKKMA 656          
BLAST of Hsp70 vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 513.457 bits (1321), Expect = 2.443e-172
Identity = 296/604 (49.01%), Postives = 411/604 (68.05%), Query Frame = 1
Query:  139 GHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE-----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD-DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINL-PYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXX--XXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI---DEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQ 1908
            G VIGIDLGTT SCV V      +++ N +G R TPS VAFT++GERL+G  AK Q   N  NT+   KRLIGR + +P VQ D+K   + ++    G   ++      ++K ++P +I A VL KMKETAE+YLG  V +AVVTVPAYFND+QRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK + +K I VFDLGGGTFD+S+L I  GVFEV +T+GDT LGGEDFD  ++++ +  +K++ G DV KD  A+Q++R   EKAK  LS+  Q  I++  +   D+      S  LTR+K E+L   L + T+ P +K ++D+++K ++I E++LVGG TR+PK+Q+ V++LF G+ PS+ +NPDEAVA GAA+Q GVL+G+     L+ +    L+LGIET+GGV TKLI RNT +PTKKSQ+FSTAAD Q  V I+V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTF+ID NGI+ VSA DKGTG + +I I +    L+ +EIE M+  AE  A++DK+ ++ VE  N+ ES  Y  +++I   ++   +L  E+ E +++ ++     L       ++  K    EL++
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLE-KKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDD-----FSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDNTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEE 630          
BLAST of Hsp70 vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 221.861 bits (564), Expect = 4.985e-64
Identity = 144/421 (34.20%), Postives = 216/421 (51.31%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKV--LENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKD-------MKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDD-KIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINL-------------------------PYLTMDNTGPKHLSLKL-------------TRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQ 1254
            K  ++GIDLGTT   + V      +V  L +A+G R  PSVVA  SDG  L G PA +QA  N   TL+  KR IGR +   E++++       ++ VS ++V    G    E   +  +P  +GA +L +++  AE  LG  V+ AV+ VPA F++ QR +T  A  ++GL VLRV+NEPTAAALAYGL + +    + V DLGGGT D+S+L  Q G+F  ++ +G+  LGG+DF   L++++        G          Q +REAAE AK+EL+   +  ++L                         P  T  N       LKL             TR + E L E L ++ ++P  + ++   +   ++  V+LVGG TR+P+V+  +   FG  P  SV+P+ AV  G A+Q
Sbjct:   30 KPRIVGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAE---QTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVSSVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYFGSEPDTSVDPELAVVTGVAVQ 447          
BLAST of Hsp70 vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 184.882 bits (468), Expect = 1.635e-50
Identity = 114/379 (30.08%), Postives = 203/379 (53.56%), Query Frame = 1
Query:  148 IGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQN----KMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGL--DKTDDKI-IAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLT--MDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQ 1254
            +G+ LG+T +CV++       V+ N  G R TP++VAF  D E++VG  AK+  + N+  T+   KR++G R+++  VQK + + S  ++   +G       N    K  +  ++   +L KMKETA   +G   K+AV+T P  F   Q    + A + +G NVLR+++EP AA LA+G+  + +  K  + V+ LGG     + +E+  G++ V  +  D  +GGE+F   L +Y+  EF++    D+  +  A+ ++   AE AK  LS+   ++  +  L   +D          +TR++ + L   L ++++ P    +    + TS+ ++V+L GG  R+PK+Q+ +Q+ F G     S+  DE +A+GAA +
Sbjct:    4 VGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAF-RDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIE-KDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLD------FECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAAE 374          
BLAST of Hsp70 vs. Ensembl Yeast
Match: SSC1 (Hsp70 family ATPase; constituent of the import motor component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); involved in protein translocation and folding; subunit of SceI endonuclease; SSC1 has a paralog, ECM10, that arose from the whole genome duplication [Source:SGD;Acc:S000003806])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 406/633 (64.14%), Postives = 511/633 (80.73%), Query Frame = 1
Query:   55 MLKMMKLFGQNGLTT-YSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRD---RLANKDNETSESIKKATNELQQSSLKLFEMAYK 1941
            ML    +  ++ L++ +    RL   KV+G VIGIDLGTTNS V++M+GK PK++ENAEG+RTTPSVVAFT +GERLVG PAKRQAV+N  NTL ATKRLIGRR+++ EVQ+D+K V YKIV+ SNGDAWVEA+ + YSP+QIG FVL KMKETAE+YLG  VKNAVVTVPAYFNDSQRQATKDAGQI GLNVLRV+NEPTAAALAYGL+K+D K++AVFDLGGGTFDIS+L+I  GVFEVKST+GDT LGGEDFD  LL+ IV+ FK E G+D+  D MA+QR+REAAEKAKIELSS + T+INLP++T D +GPKH+++K +R++ E L   L+KRT+DP +KA+KDA + TS+I EVLLVGGM+RMPKV ETV+ LFG+ PSK+VNPDEAVA+GAA+QG VL+G+VTDVLLLDVTPLSLGIETLGGVFT+LI RNTTIPTKKSQ+FSTAA GQT VEI+V QGERE+  DNKL+G F+L GIPPAP+G+PQ+EVTFDIDA+GI+NVSARDK T K+  I +  S GLS++EIE M+  AE+    D+ ++  +E  N+A+ +  DTE+ + EF+ ++   E +K++  I ++++   R+   +   +E +K  T ELQ SS+KLFE  YK
Sbjct:    1 MLAAKNILNRSSLSSSFRIATRLQSTKVQGSVIGIDLGTTNSAVAIMEGKVPKIIENAEGSRTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFEDAEVQRDIKQVPYKIVKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYLGKPVKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKTETGIDLENDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTAPLVKRTVDPVKKALKDAGLSTSDISEVLLVGGMSRMPKVVETVKSLFGKDPSKAVNPDEAVAIGAAVQGAVLSGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIFSTAAAGQTSVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVTFDIDADGIINVSARDKATNKDSSITVAGSSGLSENEIEQMVNDAEKFKSQDEARKQAIETANKADQLANDTENSLKEFEGKVDKAEAQKVRDQITSLKELVARVQGGEEVNAEELKTKTEELQTSSMKLFEQLYK 633          
BLAST of Hsp70 vs. Ensembl Yeast
Match: ECM10 (Heat shock protein of the Hsp70 family; localized in mitochondrial nucleoids, plays a role in protein translocation, interacts with Mge1p in an ATP-dependent manner; overexpression induces extensive mitochondrial DNA aggregations; ECM10 has a paralog, SSC1, that arose from the whole genome duplication [Source:SGD;Acc:S000000756])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 387/612 (63.24%), Postives = 489/612 (79.90%), Query Frame = 1
Query:  115 RLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANK---DNETSESIKKATNELQQSSLKLFEMAYK 1941
            R    K+   VIGIDLGTTNS V++M+GK P+++ENAEG+RTTPSVVAFT DGERLVG PAKRQ+VINS NTL ATKRLIGRR+++ EVQ+D+  V +KIV+ SNGDAWVEA+N+ YSP+QIG F+L KMKETAE+YL  +VKNAVVTVPAYFND+QRQATKDAGQI GLNVLRV+NEPTAAALAYGLDK++ K+IAVFDLGGGTFDIS+L+I  G+FEVKST+GDT LGGEDFD  LLQ I++ FK+E G+D++ D MA+QR+REAAEKAKIELSS + T+INLP++T D  GPKH+ +  +R +LE +   LI RT+DP +KA+KDA +  S+I +VLLVGGM+RMPKV +TV+KLFG+  SK+VNPDEAVA+GAAIQ  VL+G+VTDVLLLDVTPLSLGIETLGGVFTKLI RN+TIP KKSQ+FSTAA GQT VE+KV QGERE+  DNKL+G F+L GIPPAP+G PQ+EVTFDIDANGI+NVSA+D  + K+  I +  + GLS  EI+ M+ +AE     D+ +R+ +E  N+A+ +  DTE+ I EF+ +L   + ++LK  I ++R+ ++     D    + +    + L+ SS+KLFE  YK
Sbjct:   19 RFQSTKIPDAVIGIDLGTTNSAVAIMEGKVPRIIENAEGSRTTPSVVAFTKDGERLVGEPAKRQSVINSENTLFATKRLIGRRFEDAEVQRDINQVPFKIVKHSNGDAWVEARNRTYSPAQIGGFILNKMKETAEAYLAKSVKNAVVTVPAYFNDAQRQATKDAGQIIGLNVLRVVNEPTAAALAYGLDKSEPKVIAVFDLGGGTFDISILDIDNGIFEVKSTNGDTHLGGEDFDIYLLQEIISHFKKETGIDLSNDRMAVQRIREAAEKAKIELSSTLSTEINLPFITADAAGPKHIRMPFSRVQLENITAPLIDRTVDPVKKALKDARITASDISDVLLVGGMSRMPKVADTVKKLFGKDASKAVNPDEAVALGAAIQAAVLSGEVTDVLLLDVTPLSLGIETLGGVFTKLIPRNSTIPNKKSQIFSTAASGQTSVEVKVFQGERELVKDNKLIGNFTLAGIPPAPKGTPQIEVTFDIDANGIINVSAKDLASHKDSSITVAGASGLSDTEIDRMVNEAERYKNQDRARRNAIETANKADQLANDTENSIKEFEGKLDKTDSQRLKDQISSLRELVSRSQAGDEVNDDDVGTKIDNLRTSSMKLFEQLYK 630          
BLAST of Hsp70 vs. Ensembl Yeast
Match: SSQ1 (Mitochondrial hsp70-type molecular chaperone; required for assembly of iron/sulfur clusters into proteins at a step after cluster synthesis, and for maturation of Yfh1p, which is a homolog of human frataxin implicated in Friedreich's ataxia [Source:SGD;Acc:S000004361])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 326/654 (49.85%), Postives = 456/654 (69.72%), Query Frame = 1
Query:   58 LKMMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVM----DGKTPKVLENAEGARTTPSVVAFTSDG--------ERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRA-SNGDAWVEAQNKMY-SPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD-KTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGV----DVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEE-----CEKLKQLIQTVRDRLANKDNETSE--SIKKATNELQQSSLKLFEMAYK 1941
            L  +KL   N    YS N +L        VIGIDLGTTNS V+ +    D K+  ++EN EG RTTPS+VAF            + LVG  AKRQ  INS NT  ATKRLIGR +++ EVQ+DM  + YKIV+  SNG A++   N +  SPSQI + +L  +K+T+E YLG  V  AV+TVPAYFNDSQRQATKDAG+++GLNVLRVINEPTAAAL++G+D K ++ +IAV+DLGGGTFDIS+L+I+ GVFEV++T+GDT LGGEDFDNV++ YI++ F  E       ++ K+   +QR+++ +E+AKI+LS   +T I LP++       KHL + +T  +L+ +   LI RTI P ++A+KDA+++  +I EV+LVGGMTRMPK++  V+ LFG+ P+ SVNPDE VA+GAAIQGG+L+G++ +VLLLDVTPL+LGIET GG F+ LI RNTT+P KK+++FST  DGQ  V+IKV QGER +  +NKL+G   L GI P P+GIPQ+ VTFDIDA+GI+NVSA +K +GK+Q I +  + GLS++EI  +I +A  N   D   R  +E++++A+ ++ DTE+    ++  + +E+      E +K L Q +++  AN+++ + +   IKKAT+ LQ  +LKLF+ A K
Sbjct:    7 LNFLKL-NINSRLLYSTNPQL-----TKKVIGIDLGTTNSAVAYIRDSNDKKSATIIENDEGQRTTPSIVAFDVKSSPQNKDQMKTLVGMAAKRQNAINSENTFFATKRLIGRAFNDKEVQRDMAVMPYKIVKCESNGQAYLSTSNGLIQSPSQIASILLKYLKQTSEEYLGEKVNLAVITVPAYFNDSQRQATKDAGKLAGLNVLRVINEPTAAALSFGIDDKRNNGLIAVYDLGGGTFDISILDIEDGVFEVRATNGDTHLGGEDFDNVIVNYIIDTFIHENPEITREEITKNRETMQRLKDVSERAKIDLSHVKKTFIELPFVYKS----KHLRVPMTEEELDNMTLSLINRTIPPVKQALKDADIEPEDIDEVILVGGMTRMPKIRSVVKDLFGKSPNSSVNPDETVALGAAIQGGILSGEIKNVLLLDVTPLTLGIETFGGAFSPLIPRNTTVPVKKTEIFSTGVDGQAGVDIKVFQGERGLVRNNKLIGDLKLTGITPLPKGIPQIYVTFDIDADGIINVSAAEKSSGKQQSITVIPNSGLSEEEIAKLIEEANANRAQDNLIRQRLELISKADIMISDTENLFKRYEKLISSEKEYSNIVEDIKALRQAIKNFKANENDMSIDVNGIKKATDALQGRALKLFQSATK 650          
BLAST of Hsp70 vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 305/604 (50.50%), Postives = 417/604 (69.04%), Query Frame = 1
Query:  142 HVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD--DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQ 1905
              +GIDLGTT SCV+       +++ N +G RTTPS VAFT D ERL+G  AK QA IN  NT+   KRLIGR++D+PEV  D K+  +K++ + +G   V+     + K ++P +I + VL KMKETAE+YLGTTV +AVVTVPAYFNDSQRQATKDAG I+G+NVLR+INEPTAAA+AYGLDK    +  + +FDLGGGTFD+S+L I +GVFEVK+T+GDT LGGEDFDN L+ ++  EFKR+   D++ +  +L+R+R AAE+AK  LSS+ QT I +  L   MD          LTR++ E+L   L + T++P EK +KD+++  S+I E++LVGG TR+PK+Q+ V   F G+ P++S+NPDEAVA GAA+Q  +L GD +         DV PLSLGIET GG+ TKLI RN+TIPTKKS+ FST AD Q  V I+V +GER    DN LLG+F L GIPPAPRG+PQ++VTFDIDANGI+NVSA +KGTGK  +I I +  G LSKD+I+ M+ +AE+   +D+++ + V+  NQ ES  +  ++ I+E  FK ++  ++ ++L+   Q   D L      +++  K    EL+
Sbjct:    3 RAVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVI-SRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMD------FYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGEDDAKRLETASQETIDWLDASQAASTDEYKDRQKELE 598          
BLAST of Hsp70 vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 530.02 bits (1364), Expect = 2.581e-179
Identity = 303/603 (50.25%), Postives = 411/603 (68.16%), Query Frame = 1
Query:  145 VIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDK--IIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQ 1905
             +GIDLGTT SCV+       +++ N +G RTTPS VAFT D ERL+G  AK QA +N  NT+   KRLIGR++D+PEV  D K+  +K++    G   V+     + K ++P +I + +L KMKETAE++LGT VK+AVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK   K   + +FDLGGGTFD+S+L I +GVFEVK+T+GDT LGGEDFD+ L+ ++  EFKR+   D+  +  +L+R+R AAE+AK  LSS+ QT I +  L   +D          +TR++ E+L   L + T++P EK + D+++  S+I E++LVGG TR+PKVQ+ V   F G+ P++S+NPDEAVA GAA+Q  +L GD +         DV PLSLGIET GG+ TKLI RN+TIPTKKS+VFST AD Q  V I+V +GER    DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA +KGTGK  +I I +  G LSK++I+ M+ +AE+    D+++   V+  NQ ES  +  ++ + E  FK ++  E+  KL+   Q   + L      ++E  K+   EL+
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVID-KGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGID------FYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELE 598          
BLAST of Hsp70 vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 945.651 bits (2443), Expect = 0.000e+0
Identity = 483/612 (78.92%), Postives = 555/612 (90.69%), Query Frame = 1
Query:  115 RLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            R   + V+G V GIDLGTTNSCV+VMDGKTPKV+ENAEG+RTTPSVVAFT +GERLVG PA+RQA+ N  NTL+ATKR IGRR+D PE++KD+KNVSYKIVRASNGDAW E   K+YSPSQ+GAFVL+KMKETAESYLGT V NAVVTVPAYFNDSQRQATKDAGQI+GLNVLRVINEPTAAALAYG+DKT+DKIIAV+DLGGGTFDIS+LEIQKGVFEVK+T+GDT+LGGEDFDN LL++++ EFK+E GVD++KD MALQR+REAAEKAKIELSS++QTDINLPY+T+D +GPKHL++KL+RSK E LV  LI RT+ PC+K ++DAE+   EI +VLLVGGMTRMPKVQ+TVQ +FGRVPSK+VNPDEAVA+GAAIQGGVLAGDV DVLLLDVTPLSLGIETLGGVFTKLI RNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNKLLGQF L+GIPPAPRG+PQVEVTFDIDANGIVNVSARDKGTG+EQQIVIQSSGGLSKD IENMI++AE+ AE DK+K++  E VNQAE +++DTE+K++EFK QLP+EE EKLK+ I  VR+ LANKDNET E+I++A +ELQQ SLKLFEMAYKKMA
Sbjct:    4 RSSSESVRGAVCGIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNGDAWFEVAGKVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKTEDKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLPYITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIFGRVPSKAVNPDEAVAIGAAIQGGVLAGDVKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGGLSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEEFKDQLPSEEVEKLKEEIAKVREVLANKDNETGETIRQAYSELQQKSLKLFEMAYKKMA 615          
BLAST of Hsp70 vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 522.702 bits (1345), Expect = 8.733e-176
Identity = 302/604 (50.00%), Postives = 410/604 (67.88%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIV-RASNGDAWVE--AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSE-IKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDE--FKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQ 1905
            K   IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERLVG  AK Q  +N  NT+   KRLIGRR+D+P V+ DMK+ S+++V  A      VE   + K +   +I + VL KMKETAE+YLG  V +AVVTVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+SVL I+ G+FEVKST GDT LGGEDFDN ++ + V +FK++   D+  +  AL+R+R A E+AK  LSS+ Q  I +  L  D          +TR++ E++  HL K+T++P EKAIKD+++++ E I E+++VGG TR+PK+Q  +Q  F G+  +KS+NPDEAVA GAA+Q  +L GD ++        DV PL+LG+ET GGV T  I RNTTIPTK++Q F+T +D QT V I+V++GER +  DN LLG+F L GIPPAPRG+PQ++VTFD+D+NGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D+  R+ ++  N  ES  +  +S +++   K +L  +E EK+    +   D L +  +   E I     EL+
Sbjct:    3 KAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSL-YDGI---DFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELE 601          
BLAST of Hsp70 vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 503.056 bits (1294), Expect = 1.975e-168
Identity = 304/608 (50.00%), Postives = 402/608 (66.12%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNG---DAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKG-VFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXX----XXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSL 1917
            K   IGIDLGTT SCV V      +++ N +G RTTPS V FT D ERLVG  AK Q  +N  NT+   KRLIGRRYD+  VQ DMK   +KI+  +N        + + K ++  +I + VL KMKETAE+YLG  V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRVINEPTAAALAYGLDK+   +K + +FDLGGGTFD+S+L I  G +FEVKST+GDT LGGEDFDN L+ + V EFKR+   D++K+  A++R+R A E+AK  LSS+ +  I +  L   +D         K++R++ E L   L    +DP  KA+ DA+   S+I EV+LVGG TR+PK+Q+ +++ F G+  +KS+NPDEAVA GAA+Q  +L+GD +D +       V PLSLGIET G V TKLI RN  IPTK +Q F+T +D Q  V I+V +GER +   N LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA+DK TGK   I I +  G LSK+EI+ MI  AE+    D+ +R+ +   N+ ES  +  +S I E     P+ E     +L Q+ +D + NK       +++  N L+++SL
Sbjct:    3 KAPAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFT-DTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGID------FYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISE-----PSLEG----KLSQSDKDTVKNK-------VEEVLNWLEKNSL 587          
BLAST of Hsp70 vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 501.901 bits (1291), Expect = 9.964e-168
Identity = 287/564 (50.89%), Postives = 392/564 (69.50%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNG---DAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD--DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSE--IKEVLLVGGMTRMPKVQETVQKLFG-RVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFK 1782
            K   +GIDLGTT SCV V      +++ N +G RTTPS VAF SD ERL+G  AK Q  +N  NT+   KRLIGR++D+P V +DM +  + ++R           + + K + P +I + VL KMKETAE+YLG  V +AVVTVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + ++DLGGGTFD+SVL I+ G+FEVKST+GDT LGGEDFDN ++ + V +FK++   D+  +  A++R+R A E+AK  LSS+ Q  I +  L   +D          +TR++ E+L + L K+T +P E+AI+D+++   +  I +++LVGG TR+PK+Q+ +Q+LFG +  +KS+NPDEAVA GAA+Q  +L GD  D +      DV PLS+GIET GGV + LI RN+TIPTK++Q F+T +D Q  V I+V +GER M A N LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+ +A +  E D+K+RD ++  N  ES  Y  +S +++ K
Sbjct:    3 KTPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-SDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGID------FYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDK 559          
BLAST of Hsp70 vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 499.975 bits (1286), Expect = 9.142e-167
Identity = 297/600 (49.50%), Postives = 409/600 (68.17%), Query Frame = 1
Query:  139 GHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIV---RASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTD-DKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXX--XXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI---DEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQ 1905
            G VIGIDLGTT SCV V      +++ N +G R TPS VAFT +GERL+G  AK Q   N  NT+   KRLIGR +D+  VQ D+K   +K+V   +  +    V+ + K ++  +I A VL KMKETAE+YLG  V +AVVTVPAYFND+QRQATKDAG I+GL V+R+INEPTAAA+AYG+DK + +K I VFDLGGGTFD+S+L I  GVFEV +T+GDT LGGEDFD  ++++ +  +K+++G ++ KD  A+Q++R   EKAK  LS+  Q  + +          +  S  LTR++ E+L   L K T+ P +K ++DA++K SEI E++LVGG TR+PKVQ+ V+  F G+ PS+ +NPDEAVA GAA+Q GVL    D  +V+LLDV PL+LGIET+GGV TKLI+RNT IPTKKSQVFSTAAD Q  V I+V +GER M  DN  LG+F L GIPPAPRG+PQ+EVTF+ID NGI+ VSA DKGTG +++I I +    L+ ++IE M+  AE+ A+ DKK ++ VE  N+ ES  Y  ++++   ++   +L  ++ + + + ++     +    + + E  KK   EL+
Sbjct:   33 GTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEG----EDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGEEDTGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELE 628          
BLAST of Hsp70 vs. Ensembl Medaka
Match: hspa9 (heat shock protein family A (Hsp70) member 9 [Source:NCBI gene;Acc:101165155])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 495/608 (81.41%), Postives = 556/608 (91.45%), Query Frame = 1
Query:  127 DKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            + +KG VIGIDLGTTNSCV+VMDGK  KVLENAEGARTTPSVVAFT++GERLVG PAKRQAV N  NTL+ATKRLIGRRYD+PEVQKD+KNV YKIVRASNGDAWVEA  KMYSPSQ+GAFVL+KMKETAE+++GT VKNAV+TVPAYFNDSQRQATKDAGQI+GLNVLRVINEPTAAALAYGLDK+ DKIIAV+DLGGGTFD+SVLEIQKGVFEVKST+GDTFLGGEDFD  LL++IV EFKRE GVD+ KD MALQRVREAAEKAK ELSS++QTDINLPYLTMD +GPKHL++KLTRS+ E +V  LI+RT+ PC+KA++DAEV   +I EVLLVGGMTRMPKVQ+TVQ LFGR PSKSVNPDEAVA+GAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKV QGEREMA DNK+LGQFSL+GIPPAPRG+PQ+EVTFDIDANGIV+VSARDKGTG+EQQIVIQSSGGLSKD+IENMI+ AE  AE D+++++ VE VN AE I++DTESK++EFK QLPA+EC KLK+ I  VRD LANK+ ET E+IK+A N LQQ+SLKLFE+AYKKMA
Sbjct:   49 EAIKGSVIGIDLGTTNSCVAVMDGKQAKVLENAEGARTTPSVVAFTAEGERLVGMPAKRQAVTNPQNTLYATKRLIGRRYDDPEVQKDLKNVPYKIVRASNGDAWVEAHGKMYSPSQMGAFVLMKMKETAENFMGTKVKNAVITVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGLDKSQDKIIAVYDLGGGTFDVSVLEIQKGVFEVKSTNGDTFLGGEDFDQQLLKHIVKEFKRESGVDLMKDNMALQRVREAAEKAKCELSSSLQTDINLPYLTMDASGPKHLNMKLTRSQFEGIVADLIRRTVAPCQKAMQDAEVSKGDIGEVLLVGGMTRMPKVQQTVQDLFGRAPSKSVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMALDNKVLGQFSLVGIPPAPRGVPQIEVTFDIDANGIVHVSARDKGTGREQQIVIQSSGGLSKDDIENMIKNAERYAEEDRRRKERVEAVNMAEGIIHDTESKMEEFKDQLPADECSKLKEEITKVRDILANKEAETGENIKQAANSLQQASLKLFEVAYKKMA 656          
BLAST of Hsp70 vs. Ensembl Medaka
Match: ENSORLT00000027715.1 (pep primary_assembly:ASM223467v1:8:715730:793937:1 gene:ENSORLG00000026256.1 transcript:ENSORLT00000027715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 531.561 bits (1368), Expect = 5.143e-178
Identity = 304/568 (53.52%), Postives = 407/568 (71.65%), Query Frame = 1
Query:  148 IGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYL--TMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXX----XXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKI--DEFKSQLPAEE 1803
            IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N +NT+   KRLIGRR+DEP VQ DMK+  +K+V +  G   ++     +NK + P +I + VL+KMKE AE+YLG  V NAV+TVPAYFNDSQRQATKDAG I+GLNV R+INEPTAAA+AYGLDK  + ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN ++ + V EFKR+   D++++  AL+R+R A E+AK  LSS+ Q  I +  L   +D          +TR++ E+L   L + T++P EKA++DA++   +I +V+LVGG TR+PK+Q+ +Q  F GR  +KS+NPDEAVA GAA+Q  +L+GD +    D+LLLDV PLSLGIET GGV T LI RNTTIPTK++QVFST AD Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D+++RD +   N  ES+ ++ +S    D  K ++  E+
Sbjct:    9 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVV-SEGGKPKIQVDYKGENKTFFPEEISSMVLVKMKEIAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVQRIINEPTAAAIAYGLDKGKSGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGID------FYTSVTRARFEELCSDLFRGTLEPVEKALRDAKMDKGQIHDVVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILSGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQVFSTYADNQPGVLIQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEQQRDKIAAKNSLESLAFNLKSSAQDDSLKDKISQED 568          

HSP 2 Score: 60.8474 bits (146), Expect = 4.653e-9
Identity = 28/43 (65.12%), Postives = 33/43 (76.74%), Query Frame = -2
Query: 1494 ITICCSFPVPLSRAETFTMPLASISNVTSTCGIPRGAGGIPIK 1622
            + I  S PV LS A+TF MPLAS+S VTS CG PRGAGGIP++
Sbjct:  648 MVILFSLPVLLSTADTFKMPLASMSKVTSICGTPRGAGGIPVR 690          
BLAST of Hsp70 vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 524.628 bits (1350), Expect = 2.756e-176
Identity = 311/615 (50.57%), Postives = 418/615 (67.97%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNG---DAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXX----XXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLI-QTVRDRLANKDNET------SESIKKATNELQQSSLK 1920
            KG  +GIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGRR+D+  VQ DMK+  + ++  +         + + K + P +I + VL+KMKE AE+YLG TV NAVVTVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + ++EFKR+   D++ +  A++R+R A E+AK  LSS+ Q  I +   Y  +D          +TR++ E+L   L + T+DP EKA++DA++  ++I +++LVGG TR+PK+Q+ +Q  F G+  +KS+NPDEAVA GAA+Q        + +V D+LLLDVTPLSLGIET GGV T LI RNTTIPTK++Q F+T AD Q  V I+V +GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D  +R+ V   N  ES  ++ +S ++E          EKLK  I +  R ++ +K NE       ++S +K   E QQ  L+
Sbjct:    3 KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVD------FYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKNGLESYAFNMKSTVEE----------EKLKDKISEDDRKKILDKCNEVISWLDRNQSAEKEEFEHQQKELE 600          
BLAST of Hsp70 vs. Ensembl Medaka
Match: hsp70-5 (Oryzias latipes heat shock protein 70 (hsp70-5), mRNA. [Source:RefSeq mRNA;Acc:NM_001104914])

HSP 1 Score: 524.242 bits (1349), Expect = 3.099e-176
Identity = 304/597 (50.92%), Postives = 411/597 (68.84%), Query Frame = 1
Query:  133 VKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVE----AQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--TDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTES---------KIDEFKSQLPAEECEKLKQLIQTVRDRLANKD 1860
            + G  IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N +NT+   KRLIGR +++P VQ DMK   +K++   NG   ++     + K + P +I + VL+KMKE AE+YLG  V N V+TVPAYFNDSQRQATKDAG I+GLNV+R+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVK+TSGDT LGGEDFDN ++ + V EFKR+   D++++  A++R+R A E+AK  LSS+ Q  I +  L  D          +TR++ E+L   L + T++P EKA++DA++  S+I E++LVGG TR+PK+Q+ +Q LF GR  +KS+NPDEAVA GAA+Q  +L GD ++ +      DVTPLSLGIET GGV T LI RNTTIPTK++Q+FST +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQVEVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M++ AE+    D+ +R+ V   N  ES  Y+ +S         KI E   ++  ++C +    ++   ++LA KD
Sbjct:    2 IGGVSIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DAERLIGDAAKNQVAMNPSNTVFDAKRLIGRNFNDPIVQSDMKLWPFKVIN-DNGKPKIQVDYKGETKAFYPEEISSMVLVKMKEIAEAYLGQRVSNVVITVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKGKRGEQNVLIFDLGGGTFDVSILTIEDGIFEVKATSGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSSQASIEIDSL-FDGI---DFYTSITRARFEELNSDLFRGTLEPVEKALRDAKLDKSKIHEIVLVGGSTRIPKIQKLLQVLFNGRELNKSINPDEAVAYGAAVQAAILMGDTSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQIFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQVEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQDAEKYKAEDELQREKVAAKNALESYAYNMKSSVEDENIVGKISEEDKKVVVDKCNQTISWLEN--NQLAEKD 590          
BLAST of Hsp70 vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 523.472 bits (1347), Expect = 1.911e-175
Identity = 299/593 (50.42%), Postives = 416/593 (70.15%), Query Frame = 1
Query:  136 KGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNG---DAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXX----XXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQ--LPAEE----CEKLKQLIQTV-RDRLANKD 1860
            KG  +GIDLGTT SCV +      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N ANT+   KRLIGR++D+  VQ DMK+  +K+V  S+    +   + + K + P +I + VL KMKE +E+YLG +V NAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVK+T+GDT LGGEDFDN ++ + + EFKR+   ++  +  A++R+R A E+AK  LSS+ Q  I +  L             +TR++ E+L   L + TI+P EKA++DA++  S+I +V+LVGG TR+PK+Q+ +Q LF GR  +KS+NPDEAVA GAA+Q  +LAGD ++ +       VTPLSLGIET GGV T LI RNTTIPTK++Q F+T +D Q  V I+V++GER M  DN +LG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA DK TGKE +I I +  G LSK++IE M+++AE+    D+ +RD +   N  ES+ ++ +S +D+ K Q  + +E+     +K  ++I  + ++++A KD
Sbjct:    3 KGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGT----DFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKD 590          
BLAST of Hsp70 vs. Planmine SMEST
Match: SMESG000056256.1 (SMESG000056256.1)

HSP 1 Score: 1200.27 bits (3104), Expect = 0.000e+0
Identity = 632/632 (100.00%), Postives = 632/632 (100.00%), Query Frame = 1
Query:   55 MLKMMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            MLKMMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIRKAEENAENDKKKRDMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA
Sbjct:    1 MLKMMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIRKAEENAENDKKKRDMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 632          
BLAST of Hsp70 vs. Planmine SMEST
Match: SMESG000056256.1 (SMESG000056256.1)

HSP 1 Score: 1194.87 bits (3090), Expect = 0.000e+0
Identity = 629/629 (100.00%), Postives = 629/629 (100.00%), Query Frame = 1
Query:   64 MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXXXXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 1950
            MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIRKAEENAENDKKKRDMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA
Sbjct:    1 MMKLFGQNGLTTYSKNVRLFGDKVKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRVPSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKDEIENMIRKAEENAENDKKKRDMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA 629          
BLAST of Hsp70 vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 533.872 bits (1374), Expect = 7.884e-180
Identity = 308/619 (49.76%), Postives = 427/619 (68.98%), Query Frame = 1
Query:  133 VKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGD---AWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLI-QTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKM 1947
            + G+ IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++DE  VQ DMK+ S+ ++  +         + + K + P +I + VLIKMKE AE+YLG TVK+AVVTVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + + EFKR+   D++ +  A++R+R A E+AK  LSS+ Q ++ +   Y  +D          +TR++ E+L   L + T++P EKA++DA++  + I +++LVGG TR+PK+Q+ +Q LF G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DV PLSLGIET GGV T LI RNTTIPTK++Q+F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA +KGTGKE +I I +  G LSKD+IE M+ +AE+  + D++++D +   N  ES  Y  +S +++          EKLK  I ++ R  + +K  E    ++K     QQ++ + FE  YK++
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVED----------EKLKDKISESDRKLIIDKCQEAINWLEKN----QQATKEEFEYHYKEL 598          
BLAST of Hsp70 vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 533.872 bits (1374), Expect = 7.884e-180
Identity = 308/619 (49.76%), Postives = 427/619 (68.98%), Query Frame = 1
Query:  133 VKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGD---AWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLI-QTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKM 1947
            + G+ IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++DE  VQ DMK+ S+ ++  +         + + K + P +I + VLIKMKE AE+YLG TVK+AVVTVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + + EFKR+   D++ +  A++R+R A E+AK  LSS+ Q ++ +   Y  +D          +TR++ E+L   L + T++P EKA++DA++  + I +++LVGG TR+PK+Q+ +Q LF G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DV PLSLGIET GGV T LI RNTTIPTK++Q+F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA +KGTGKE +I I +  G LSKD+IE M+ +AE+  + D++++D +   N  ES  Y  +S +++          EKLK  I ++ R  + +K  E    ++K     QQ++ + FE  YK++
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVED----------EKLKDKISESDRKLIIDKCQEAINWLEKN----QQATKEEFEYHYKEL 598          
BLAST of Hsp70 vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 533.872 bits (1374), Expect = 7.884e-180
Identity = 308/619 (49.76%), Postives = 427/619 (68.98%), Query Frame = 1
Query:  133 VKGHVIGIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAKRQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGD---AWVEAQNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKT--DDKIIAVFDLGGGTFDISVLEIQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQRVREAAEKAKIELSSAIQTDINLP--YLTMDNTGPKHLSLKLTRSKLEQLVEHLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLF-GRVPSKSVNPDEAVAMGAAIQXXXXXXXXXXXXXX----XXXXXXXXIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLIGIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGG-LSKDEIENMIXXXXXXXXXXXXXXXMVEVVNQAESIVYDTESKIDEFKSQLPAEECEKLKQLI-QTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKM 1947
            + G+ IGIDLGTT SCV V      +++ N +G RTTPS VAFT D ERL+G  AK Q  +N  NT+   KRLIGR++DE  VQ DMK+ S+ ++  +         + + K + P +I + VLIKMKE AE+YLG TVK+AVVTVPAYFNDSQRQATKDAG ISGLNVLR+INEPTAAA+AYGLDK    ++ + +FDLGGGTFD+S+L I+ G+FEVKST+GDT LGGEDFDN ++ + + EFKR+   D++ +  A++R+R A E+AK  LSS+ Q ++ +   Y  +D          +TR++ E+L   L + T++P EKA++DA++  + I +++LVGG TR+PK+Q+ +Q LF G+  +KS+NPDEAVA GAA+Q  +L+GD ++ +      DV PLSLGIET GGV T LI RNTTIPTK++Q+F+T +D Q  V I+V++GER M  DN LLG+F L GIPPAPRG+PQ+EVTFDIDANGI+NVSA +KGTGKE +I I +  G LSKD+IE M+ +AE+  + D++++D +   N  ES  Y  +S +++          EKLK  I ++ R  + +K  E    ++K     QQ++ + FE  YK++
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGID------FYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVED----------EKLKDKISESDRKLIIDKCQEAINWLEKN----QQATKEEFEYHYKEL 598          
The following BLAST results are available for this feature:
BLAST of Hsp70 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA90.000e+080.26heat shock protein family A (Hsp70) member 9 [Sour... [more]
HSPA83.539e-17552.84heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA83.539e-17552.84heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA83.539e-17552.84heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA61.728e-17348.94heat shock protein family A (Hsp70) member 6 [Sour... [more]
back to top
BLAST of Hsp70 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-60.000e+079.84Heat shock 70 kDa protein F, mitochondrial [Sourc... [more]
hsp-10.000e+050.65Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-10.000e+050.65Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.59.987e-17951.18pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.59.987e-17951.18pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
back to top
BLAST of Hsp70 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-50.000e+077.85gene:FBgn0001220 transcript:FBtr0339969[more]
Hsc70-50.000e+077.85gene:FBgn0001220 transcript:FBtr0087568[more]
Hsc70-41.856e-17352.77gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-41.856e-17352.77gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-41.856e-17352.77gene:FBgn0266599 transcript:FBtr0083058[more]
back to top
BLAST of Hsp70 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa90.000e+081.25heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa90.000e+081.25heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hsp70.22.182e-18050.08heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.12.278e-18050.08heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.34.212e-18049.92heat shock cognate 70-kd protein, tandem duplicate... [more]
back to top
BLAST of Hsp70 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
blvrb0.000e+076.44biliverdin reductase B [Source:Xenbase;Acc:XB-GENE... [more]
blvrb0.000e+079.28biliverdin reductase B [Source:Xenbase;Acc:XB-GENE... [more]
blvrb0.000e+076.25biliverdin reductase B [Source:Xenbase;Acc:XB-GENE... [more]
blvrb0.000e+076.25biliverdin reductase B [Source:Xenbase;Acc:XB-GENE... [more]
blvrb0.000e+076.37biliverdin reductase B [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Hsp70 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa90.000e+078.50heat shock protein 9 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa82.509e-17552.84heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa52.601e-17348.76heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa52.601e-17348.76heat shock protein 5 [Source:MGI Symbol;Acc:MGI:95... [more]
Hspa23.193e-17349.83heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
back to top
BLAST of Hsp70 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11141|HSP7F_CAEEL0.000e+079.84Heat shock 70 kDa protein F, mitochondrial OS=Caen... [more]
sp|O35501|GRP75_CRIGR0.000e+078.50Stress-70 protein, mitochondrial OS=Cricetulus gri... [more]
sp|P38646|GRP75_HUMAN0.000e+080.26Stress-70 protein, mitochondrial OS=Homo sapiens O... [more]
sp|Q3ZCH0|GRP75_BOVIN0.000e+078.66Stress-70 protein, mitochondrial OS=Bos taurus OX=... [more]
sp|Q5R511|GRP75_PONAB0.000e+078.34Stress-70 protein, mitochondrial OS=Pongo abelii O... [more]
back to top
BLAST of Hsp70 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1AGC30.000e+099.83Hsp70 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
D1GJ910.000e+091.77Mortalin-like protein OS=Dugesia japonica OX=6161 ... [more]
A0A293LZM40.000e+083.50Heat shock 70 kDa protein (Fragment) OS=Ornithodor... [more]
Q5DGY90.000e+081.24Heat shock 70kDa protein 9B OS=Schistosoma japonic... [more]
A0A2R5LMH10.000e+083.17Putative molecular chaperone dnak OS=Ornithodoros ... [more]
back to top
BLAST of Hsp70 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa90.000e+081.09heat shock protein family A (Hsp70) member 9 [Sour... [more]
hspa90.000e+078.69heat shock protein family A (Hsp70) member 9 [Sour... [more]
ENSAMXT00000055474.19.281e-17851.47pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031477.19.281e-17851.47pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037064.11.146e-17650.67heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
back to top
BLAST of Hsp70 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hspa90.000e+080.53heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa52.443e-17249.01heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa134.985e-6434.20heat shock protein 70 family, member 13 [Source:ZF... [more]
hspa141.635e-5030.08heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
back to top
BLAST of Hsp70 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSC10.000e+064.14Hsp70 family ATPase; constituent of the import mot... [more]
ECM100.000e+063.24Heat shock protein of the Hsp70 family; localized ... [more]
SSQ10.000e+049.85Mitochondrial hsp70-type molecular chaperone; requ... [more]
SSA30.000e+050.50ATPase involved in protein folding and the respons... [more]
SSA42.581e-17950.25Heat shock protein that is highly induced upon str... [more]
back to top
BLAST of Hsp70 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477230.000e+078.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303238.733e-17650.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445301.975e-16850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372809.964e-16850.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332969.142e-16749.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hsp70 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa90.000e+081.41heat shock protein family A (Hsp70) member 9 [Sour... [more]
ENSORLT00000027715.15.143e-17853.52pep primary_assembly:ASM223467v1:8:715730:793937:1... [more]
hspa8b2.756e-17650.57heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsp70-53.099e-17650.92Oryzias latipes heat shock protein 70 (hsp70-5), m... [more]
hsp70-31.911e-17550.42heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Hsp70 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056256.10.000e+0100.00SMESG000056256.1[more]
SMESG000056256.10.000e+0100.00SMESG000056256.1[more]
SMESG000051570.17.884e-18049.76SMESG000051570.1[more]
SMESG000051567.17.884e-18049.76SMESG000051567.1[more]
SMESG000051541.17.884e-18049.76SMESG000051541.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009284
GenBankADW66122.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009284 ID=SMED30009284|Name=Hsp70|organism=Schmidtea mediterranea sexual|type=transcript|length=2619bp
AGAAATTATTGTACTCGTTTGTTTAAACCCACAATATTTCACATTTCTAG
AATCATGTTGAAAATGATGAAACTTTTTGGACAAAATGGATTGACGACTT
ATTCTAAAAATGTTCGTTTATTTGGCGATAAAGTCAAGGGACATGTTATA
GGTATCGATTTGGGAACTACTAACTCGTGCGTTTCAGTTATGGATGGAAA
GACTCCTAAAGTGCTAGAAAATGCAGAGGGTGCAAGAACTACTCCATCAG
TTGTAGCCTTTACCAGTGATGGTGAACGGTTAGTTGGAACGCCAGCAAAG
CGCCAGGCTGTTATAAATTCAGCAAATACATTACATGCTACTAAAAGATT
GATTGGAAGGCGGTATGATGAGCCAGAAGTTCAAAAGGACATGAAAAATG
TTTCGTATAAAATTGTTAGGGCATCAAATGGGGATGCTTGGGTAGAAGCT
CAAAATAAAATGTATTCTCCTAGCCAAATTGGTGCATTTGTTTTAATAAA
AATGAAAGAAACTGCAGAAAGTTACTTGGGTACCACTGTCAAAAATGCAG
TAGTTACAGTTCCGGCTTATTTTAATGATTCTCAGAGACAAGCTACCAAA
GATGCTGGACAAATTTCGGGATTAAATGTGCTCAGAGTAATTAATGAACC
CACAGCAGCTGCATTGGCATATGGTTTAGACAAAACTGATGACAAAATCA
TTGCGGTTTTTGATTTGGGTGGTGGTACATTCGATATATCGGTGTTAGAG
ATTCAAAAAGGTGTGTTTGAAGTTAAATCAACCAGTGGTGACACTTTCCT
GGGAGGTGAAGATTTTGATAATGTTTTATTACAATATATTGTCAATGAAT
TTAAACGTGAACAAGGAGTGGATGTTAATAAAGACCCTATGGCACTACAA
AGAGTTAGAGAAGCTGCTGAAAAAGCTAAAATAGAGCTTTCATCAGCAAT
TCAGACTGATATAAATCTTCCATATTTGACTATGGATAATACAGGACCCA
AACATCTAAGTTTAAAACTTACGAGATCAAAATTAGAACAACTAGTTGAG
CATTTAATCAAGAGAACAATAGATCCCTGTGAAAAAGCTATTAAAGATGC
TGAAGTTAAAACATCGGAAATTAAAGAAGTATTGCTAGTTGGTGGTATGA
CAAGAATGCCTAAAGTTCAAGAAACTGTTCAAAAACTTTTTGGTAGGGTT
CCTAGTAAAAGTGTAAATCCTGATGAAGCTGTTGCTATGGGAGCAGCAAT
TCAAGGAGGAGTTCTTGCTGGAGATGTTACGGATGTATTATTGCTTGATG
TTACTCCTCTTTCGTTGGGTATTGAAACTTTAGGAGGTGTTTTCACTAAA
TTAATTAATCGAAATACAACTATTCCCACAAAAAAATCTCAAGTTTTTTC
AACTGCAGCAGACGGTCAAACTCAAGTTGAAATTAAAGTTCATCAAGGAG
AAAGAGAAATGGCTGCTGATAACAAATTATTAGGTCAATTTTCTTTAATT
GGTATTCCTCCAGCTCCACGTGGTATTCCACAAGTTGAAGTTACGTTTGA
TATCGATGCCAACGGCATTGTGAATGTTTCAGCTCGAGATAAAGGTACTG
GAAAAGAGCAACAAATTGTTATTCAGTCTAGTGGGGGATTAAGTAAAGAT
GAAATCGAAAATATGATTAGAAAAGCAGAAGAAAATGCTGAAAATGATAA
GAAGAAACGTGATATGGTCGAGGTTGTAAATCAAGCCGAATCGATTGTAT
ATGATACAGAGAGTAAAATCGATGAATTTAAGAGTCAGTTGCCAGCAGAA
GAATGCGAAAAGTTAAAGCAATTAATACAAACAGTTCGAGATAGATTAGC
AAATAAAGATAATGAAACTTCCGAGTCAATCAAAAAGGCAACAAATGAAC
TTCAACAGTCATCACTAAAATTGTTTGAAATGGCTTATAAAAAAATGGCA
TCTGAGAGAGAATCGAAATCAGGATCAGGATCAAACTCATCATCTGATTC
CAGTGAATCTGAAAAGAAAGAAGAAAAGCATTAACAACATGAAATTTTGT
GCAAATTGTTTATAGTAGTTAATAAAAGAAGTAAATATAATAGATTTCTC
ATATAAATGCCGCTTTATTTCTATTGGCTTTATGTATTTTGTTAGTGTAC
AAATATTTTTGATTAAAATGTTTTTATTTAATTTTGCAATCGTTTTATTC
TGTTTCTATTTGGTAGCTAGCTGTGTATTTTGTCTGTTGTAACGGTTAAT
TTATATTAGTGATGAAAATATCAATAATAATTCTGACGATAGGCGATGAA
GCAGAATCATAATTCAATAAATTTGTTTCTGATGTTCATGTGAGTGAAAA
TGATGTAGAATACGTTAACGGAATATCACAAACCAGACCCGGTGCCATTC
GACGTTGTTTCGAATTGTGATTCTGTTAAAGCACAGCTAATGACTCATGT
TATCTAATTGTTTGATGTTGCATTGTTAAAAATAGATATTTTTCATTGGC
TTACAAATCACTGTTGACTAAGTTGTACATTTTGTACCATGATGGGTAAG
AAAAATATGCTAACACATGGGATACCATTATATACCAGTCATGAATGACT
TTGGAAATGTATTCAAATG
back to top

protein sequence of SMED30009284-orf-1

>SMED30009284-orf-1 ID=SMED30009284-orf-1|Name=SMED30009284-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=678bp
RNYCTRLFKPTIFHISRIMLKMMKLFGQNGLTTYSKNVRLFGDKVKGHVI
GIDLGTTNSCVSVMDGKTPKVLENAEGARTTPSVVAFTSDGERLVGTPAK
RQAVINSANTLHATKRLIGRRYDEPEVQKDMKNVSYKIVRASNGDAWVEA
QNKMYSPSQIGAFVLIKMKETAESYLGTTVKNAVVTVPAYFNDSQRQATK
DAGQISGLNVLRVINEPTAAALAYGLDKTDDKIIAVFDLGGGTFDISVLE
IQKGVFEVKSTSGDTFLGGEDFDNVLLQYIVNEFKREQGVDVNKDPMALQ
RVREAAEKAKIELSSAIQTDINLPYLTMDNTGPKHLSLKLTRSKLEQLVE
HLIKRTIDPCEKAIKDAEVKTSEIKEVLLVGGMTRMPKVQETVQKLFGRV
PSKSVNPDEAVAMGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTK
LINRNTTIPTKKSQVFSTAADGQTQVEIKVHQGEREMAADNKLLGQFSLI
GIPPAPRGIPQVEVTFDIDANGIVNVSARDKGTGKEQQIVIQSSGGLSKD
EIENMIRKAEENAENDKKKRDMVEVVNQAESIVYDTESKIDEFKSQLPAE
ECEKLKQLIQTVRDRLANKDNETSESIKKATNELQQSSLKLFEMAYKKMA
SERESKSGSGSNSSSDSSESEKKEEKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0016226iron-sulfur cluster assembly
GO:0030218erythrocyte differentiation
GO:0045646regulation of erythrocyte differentiation
GO:0045647negative regulation of erythrocyte differentiation
GO:1902037negative regulation of hematopoietic stem cell differentiation
GO:1903707negative regulation of hemopoiesis
GO:0006457protein folding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012725Chaperone_DnaK
IPR043129ATPase_NBD
IPR013126Hsp_70_fam
IPR029047HSP70_peptide-bd_sf
IPR029048HSP70_C_sf
IPR018181Heat_shock_70_CS
IPR019651Glutamate_DH_NAD-spec
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0051082unfolded protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 548..568
NoneNo IPR availableCOILSCoilCoilcoord: 601..621
NoneNo IPR availableCOILSCoilCoilcoord: 298..318
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 241..251
score: 66.16
coord: 47..60
score: 79.35
coord: 75..87
score: 76.17
coord: 373..389
score: 66.73
coord: 182..202
score: 93.1
coord: 427..446
score: 83.56
coord: 98..106
score: 55.91
coord: 508..524
score: 73.79
coord: 404..424
score: 71.48
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 228..401
e-value: 3.1E-160
score: 534.7
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 49..416
e-value: 3.1E-160
score: 534.7
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 267..354
e-value: 3.1E-160
score: 534.7
NoneNo IPR availableGENE3DG3DSA:3.30.30.30coord: 111..162
e-value: 3.1E-160
score: 534.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 644..676
NoneNo IPR availablePANTHERPTHR19375:SF409coord: 37..637
NoneNo IPR availableCDDcd11733HSPA9-like_NBDcoord: 45..421
e-value: 0.0
score: 808.527
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 546..649
e-value: 2.7E-27
score: 97.1
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 48..645
e-value: 1.6E-267
score: 888.6
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 37..637
IPR012725Chaperone DnaKTIGRFAMTIGR02350TIGR02350coord: 48..645
e-value: 3.7E-282
score: 935.0
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 417..545
e-value: 1.8E-58
score: 197.9
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 423..579
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 51..58
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 376..390
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 235..248
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 48..228
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 230..421