Netrin-4

Overview
NameNetrin-4
Smed IDSMED30009281
Length (bp)5223
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Netrin-4 (SMED30009281) t-SNE clustered cells

Violin plots show distribution of expression levels for Netrin-4 (SMED30009281) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Netrin-4 (SMED30009281) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Netrin-4 (SMED30009281) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009281

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30009281h1SMcG0016939 dd_Smed_v4_6093_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30009281h1SMcG0016939 Contig38279uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009281h1SMcG0016939 Contig38279newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009281h1SMcG0016939 Contig4026uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009281h1SMcG0016939 Contig4026newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009281h1SMcG0016939 Contig29102newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009281h1SMcG0016939 Contig29102uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30009281h1SMcG0016939 dd_Smed_v4_6093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009281h1SMcG0016939 dd_Smed_v4_6093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009281h1SMcG0016939 dd_Smed_v4_6093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009281h1SMcG0016939 dd_Smed_v4_6093_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Netrin-4 vs. Ensembl Human
Match: LAMB1 (laminin subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:6486])

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 550/1767 (31.13%), Postives = 870/1767 (49.24%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE--------------IKINLPP--------VSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKD----LPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG-----------------ECL-NYANLVSSKKCDF-LNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT------NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKN-TFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDI------------IISNFSEKLSRLKYYV------YNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG-------ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNP--LMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLL-LDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASN--SKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C P  GDLLIGR   L  +STCGL   E YC+V+     +K  C IC+S++PY    +  SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V+F A    +   D Y  + +N +  ITN+R++FV+LHT GD  +D    IR KYYYA+ + ++RG C CYGHAS+C   +G   +V+ MV+G C C+HNTKG +CE C DFY+D PW PA+  ++N C+KC CN HS SCHFD  VY  +  +SGGVCD+CQHNT  +NCE+CK  YY++    I     C +C CD  G++   IC    +   GL AG C CK NVEG  CD CK GF+  +  +  GC  C C  +GT+     CDS TG CYCK  VTG  C  C   ++ LSN +++GC  C C + G   N +C   SG+C C+    G +C+E++  +Y     + L   +E              I+  +P         V +  Y  F I     +M+ +D  I             V+++   G+    S             + L   SRY+V+P   C EK     + + L  +T   ++   P  +   ++ +    S     V G                  CL N  ++V +   D   N   S + +     + C+C+  GS ++ C+  GGQCQC PNV G+TC RCA  ++GF   GCK C+C L GS+N+ C   TG+C C +GV  + CD C PG+W FP C  C+CN  +  CD  TG+CLNC+  + G+NC+ C  GYYGD     G  C+ C CP G  S +  +  C     T    C+C  GY G  CD C + +FGN     G+CQPC+C  NID    ++C+ +TG C KCL++T G +C+ C  GY+G+   + C KCVCN++GT       S  Q  C+  TG+C CLPNV+G  CDRC    + L+S  GC PCNC+    +   SCN+ TGQC C  G  G+ C+ C++ FWGDP     C  C C+  G    QC+++ G C C  G+ G  CD C +G  G  P+C+ C  C+  WD  +  + N T   L  +  + +S V  P    +   S+E+ +  +K+I    P    +            +I + +E +++++  +       NS   + ++ Q    +++N+       +   K  D+ GA + + K  +  L          +E     +   L++D++    E++        ++K ++   L++E++  + + +      +T   P    CSE  CGG  C+ D+  R       C G      N +   + LD+  +S + +   +Q +  ++  +++    K  +E    +   + T+  +     E  NL+ +I+ +L   SADL   E++   + K E+     ++  L + IR R+  L+ V  IL  S  +  + ++  + A RA +  + +  +   +       +K ++  ++ +     A   ++G    +   E+E    +  +   ++RI  L+  + ++ +  +    + +  ++      ++ + D K  ++     K K   N  +K +E       K+  L ++ K    +     +L+ D E K +   + +++K   L  L+ ++ S
Sbjct:   30 CAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKK--CFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQN-LLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSN-DLDGCRPCDC-DLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSME-YDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQ--CDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNA-AHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDV--ECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYR--ETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRV----EDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKC-GGPGCGGLVTVAHNAWQKAMDLDQDVLSALAE--VEQLSKMVSEAKLRADEAKQSAE--DILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAI---KQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAE-DVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRS 1770          
BLAST of Netrin-4 vs. Ensembl Human
Match: LAMB1 (laminin subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:6486])

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 550/1767 (31.13%), Postives = 870/1767 (49.24%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE--------------IKINLPP--------VSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKD----LPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG-----------------ECL-NYANLVSSKKCDF-LNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT------NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKN-TFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDI------------IISNFSEKLSRLKYYV------YNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG-------ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNP--LMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLL-LDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASN--SKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C P  GDLLIGR   L  +STCGL   E YC+V+     +K  C IC+S++PY    +  SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V+F A    +   D Y  + +N +  ITN+R++FV+LHT GD  +D    IR KYYYA+ + ++RG C CYGHAS+C   +G   +V+ MV+G C C+HNTKG +CE C DFY+D PW PA+  ++N C+KC CN HS SCHFD  VY  +  +SGGVCD+CQHNT  +NCE+CK  YY++    I     C +C CD  G++   IC    +   GL AG C CK NVEG  CD CK GF+  +  +  GC  C C  +GT+     CDS TG CYCK  VTG  C  C   ++ LSN +++GC  C C + G   N +C   SG+C C+    G +C+E++  +Y     + L   +E              I+  +P         V +  Y  F I     +M+ +D  I             V+++   G+    S             + L   SRY+V+P   C EK     + + L  +T   ++   P  +   ++ +    S     V G                  CL N  ++V +   D   N   S + +     + C+C+  GS ++ C+  GGQCQC PNV G+TC RCA  ++GF   GCK C+C L GS+N+ C   TG+C C +GV  + CD C PG+W FP C  C+CN  +  CD  TG+CLNC+  + G+NC+ C  GYYGD     G  C+ C CP G  S +  +  C     T    C+C  GY G  CD C + +FGN     G+CQPC+C  NID    ++C+ +TG C KCL++T G +C+ C  GY+G+   + C KCVCN++GT       S  Q  C+  TG+C CLPNV+G  CDRC    + L+S  GC PCNC+    +   SCN+ TGQC C  G  G+ C+ C++ FWGDP     C  C C+  G    QC+++ G C C  G+ G  CD C +G  G  P+C+ C  C+  WD  +  + N T   L  +  + +S V  P    +   S+E+ +  +K+I    P    +            +I + +E +++++  +       NS   + ++ Q    +++N+       +   K  D+ GA + + K  +  L          +E     +   L++D++    E++        ++K ++   L++E++  + + +      +T   P    CSE  CGG  C+ D+  R       C G      N +   + LD+  +S + +   +Q +  ++  +++    K  +E    +   + T+  +     E  NL+ +I+ +L   SADL   E++   + K E+     ++  L + IR R+  L+ V  IL  S  +  + ++  + A RA +  + +  +   +       +K ++  ++ +     A   ++G    +   E+E    +  +   ++RI  L+  + ++ +  +    + +  ++      ++ + D K  ++     K K   N  +K +E       K+  L ++ K    +     +L+ D E K +   + +++K   L  L+ ++ S
Sbjct:   54 CAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKK--CFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQN-LLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSN-DLDGCRPCDC-DLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSME-YDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQ--CDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNA-AHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDV--ECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYR--ETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRV----EDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKC-GGPGCGGLVTVAHNAWQKAMDLDQDVLSALAE--VEQLSKMVSEAKLRADEAKQSAE--DILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAI---KQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAE-DVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRS 1794          
BLAST of Netrin-4 vs. Ensembl Human
Match: LAMB4 (laminin subunit beta 4 [Source:HGNC Symbol;Acc:HGNC:6491])

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 541/1783 (30.34%), Postives = 859/1783 (48.18%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENV-VSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSA-DTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIR-NKYYYAISEWIIRGRCSCYGHASKCKAKE---GQV-QVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE----------------------IKINLP----PVSKSG---------------------YYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSC-----QSYQDTMQLIKDSRYIVIPNK-CLEKDLPIVLTVF---TIESNNKXXXXXXXXXXXXXXXXNSTK---TRKVLGE-----CLNYANLVSSK----KCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK------WQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTS----LEQNMKSLKEIKKY--FPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG----ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSE---------FCGGVGCKPDKCYRHAPMNKYCMGKS-NQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSR---RIESVNLLI-KIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDT-----------------SYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFS-LKGNLFHMFKN----ENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C+P  GDLL+GR + L ASSTCGL+ +++YC+++  +   + KC ICDS+ PY  +   +SH IENV VS  P    +WWQS +G+ +VSI +  E+ F+F+   L FKT+RPAAM +ERS DYG  W  + YF+ +C   FP+I   +   + +++C S++S I PS GG V+    D S  + N   ++    D+  +TN+R+ F +LHT GD  +    N   +KYYYA+ E I+RG C C GHAS+C+  +   G V     MV+G C CQHNT G +CE+CKDF+ D+PW PA     N CR C CNSHSS CHFD   Y  S  +SGGVC++CQHNTE ++C+RC+  +YR+    I+    C+ C CD  GT    IC+   +  LG  AG C+CKENVEG +CD+CK   +  +  +  GC  C+C  +G+L    CD  TG+C C S+VTG  C  C +GY+ L N +++GCS C C   G+  N  C   +G+C C+    G  C E    ++     + L   +E                      + +  P    PV+ +G                       +F I    +     D  + ++     G   C     QS   +  L   +R +++P   CLE D+   + V+    ++  +     ++   +  +  +NS +   +++ L E     C+  A+ +  +     C+ L   IS +       + CKC+  GS  ++C+++GGQCQC P V G+ C+RC++ SY     GC  C C   GS ++ C   TG+C C   V G+ CD C  GY+ FP CH C CN+ +  CD +TG C NC G + G NC+ C +GYYG+ S G  C+ C CP   SS +  +  C     ++   C C +GY+G  C +C T  +GN       CQPC C+ NID    +SC+  TGEC +CL NT G NC+ C  G++G+   +TC +C C+  G +           +C+  TG CPCLPNV GL CDRC D ++NL    GC  C+CD P  + +  C+QLTGQC C+ G  GK C+ C++ ++GDP     C  C CN  G+    C+ + G+CRC+ G++G+ CD C +G   + P C  C  C+ QWDH +  +      L        +N++  +E   VC +    L  N+  ++ I K+  FP G  + + ++ + + R         I+  N Q  ++   ++  D  +   +KN+   +     E      ++LN     +SE+ K Y +I+   +K         N +          +D L ++ + ++     +    I   N  +C +          CGG  C   K +R       C G   +    L  + L        I++  ++Q     N  +I+    + E   N  ++L +   G I+++     E++NL I K+K +L           L EN+   +I    N ++ +   I S+     N+ + L K + + + C+ ++    R  E+                  + LLN  K   TLN++ Q       Q     AN+  + L  N+  + KN    EN+  + ++ +    +R        +   K+  +    +  K + + A+ +   ++ + V  K  Y  L+  +++  +   +  L K   L D  +      +   + I D E K+Q L+     K  +L +L+D++ +
Sbjct:   23 CNRGACHPTTGDLLVGRNTQLMASSTCGLSRAQKYCILSYLEG--EQKCFICDSRFPYDPYDQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDLEALFRFSHLILTFKTFRPAAMLVERSTDYGHNWKVFKYFAKDCATSFPNITSGQAQGVGDIVCDSKYSDIEPSTGGEVVLKVLDPSFEIENP--YSPYIQDLVTLTNLRINFTKLHTLGDALLGRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGMVHGQCVCQHNTDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCEDCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVAGQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSYVTGAHCEECTVGYWGLGN-HLHGCSPCDCDIGGAYSN-VCSPKNGQCECRPHVTGRSCSEPAPGYFFAPLNFYLYEAEEATTLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFARVLPGAGLRFAVNNIPFPVDFTIAIHYETQSAADWTVQIVVNPPGGSEHCIPKTLQSKPQSFALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLQGESHAHSHVLVDSLGLIPQINSLENFCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLI--ISMSAKLHDGAVACKCHPQGSVGSSCSRLGGQCQCKPLVVGRCCDRCSTGSYDLGHHGCHPCHCHPQGSKDTVCDQVTGQCPCHGEVSGRRCDRCLAGYFGFPSCHPCPCNRFAELCDPETGSCFNCGGFTTGRNCERCIDGYYGNPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNPRISGAPCQPCACNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCRRCSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLVPGRGCQSCDCD-PRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPP--GRCIPCDCNRAGTQKPICDPDTGMCRCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMR----LAANMEDKRETLPVCEADFKDLRGNVSEIERILKHPVFPSGKFLKVKDYHDSVRR--------QIMQLNEQLKAVYEFQDLKDTIER--AKNEADLLLEDLQEEIDLQSSVLNASIADSSENIKKYYHISSSAEKKINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPGNVPCVPLPCGGALCTGRKGHRK------CRGPGCHGSLTLSTNALQKAQEAKSIIRNLDKQVRGLKN--QIESISEQAEVSKNNALQLRE-KLGNIRNQSDSEEENINLFIKKVKNFL-----------LEENVPPEDIEKVANGVLDIHLPIPSQ-----NLTDELVKIQKHMQLCEDYRTDENRLNEEADGAQKLLVKAKAAEKAANILLNLDK---TLNQLQQ------AQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELELAKQRSGLEDGLSLLQTKLQRHQDHAVNAKVQAESAQHQAGSLEKEFVELKKQYAILQRKTST--TGLTKETLGKVKQLKDAAEKLAGDTEAKIRRITDLERKIQDLNLSRQAKADQLRILEDQVVA 1744          
BLAST of Netrin-4 vs. Ensembl Human
Match: LAMB4 (laminin subunit beta 4 [Source:HGNC Symbol;Acc:HGNC:6491])

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 541/1783 (30.34%), Postives = 859/1783 (48.18%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENV-VSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSA-DTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIR-NKYYYAISEWIIRGRCSCYGHASKCKAKE---GQV-QVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE----------------------IKINLP----PVSKSG---------------------YYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSC-----QSYQDTMQLIKDSRYIVIPNK-CLEKDLPIVLTVF---TIESNNKXXXXXXXXXXXXXXXXNSTK---TRKVLGE-----CLNYANLVSSK----KCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK------WQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTS----LEQNMKSLKEIKKY--FPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG----ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSE---------FCGGVGCKPDKCYRHAPMNKYCMGKS-NQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSR---RIESVNLLI-KIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDT-----------------SYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFS-LKGNLFHMFKN----ENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C+P  GDLL+GR + L ASSTCGL+ +++YC+++  +   + KC ICDS+ PY  +   +SH IENV VS  P    +WWQS +G+ +VSI +  E+ F+F+   L FKT+RPAAM +ERS DYG  W  + YF+ +C   FP+I   +   + +++C S++S I PS GG V+    D S  + N   ++    D+  +TN+R+ F +LHT GD  +    N   +KYYYA+ E I+RG C C GHAS+C+  +   G V     MV+G C CQHNT G +CE+CKDF+ D+PW PA     N CR C CNSHSS CHFD   Y  S  +SGGVC++CQHNTE ++C+RC+  +YR+    I+    C+ C CD  GT    IC+   +  LG  AG C+CKENVEG +CD+CK   +  +  +  GC  C+C  +G+L    CD  TG+C C S+VTG  C  C +GY+ L N +++GCS C C   G+  N  C   +G+C C+    G  C E    ++     + L   +E                      + +  P    PV+ +G                       +F I    +     D  + ++     G   C     QS   +  L   +R +++P   CLE D+   + V+    ++  +     ++   +  +  +NS +   +++ L E     C+  A+ +  +     C+ L   IS +       + CKC+  GS  ++C+++GGQCQC P V G+ C+RC++ SY     GC  C C   GS ++ C   TG+C C   V G+ CD C  GY+ FP CH C CN+ +  CD +TG C NC G + G NC+ C +GYYG+ S G  C+ C CP   SS +  +  C     ++   C C +GY+G  C +C T  +GN       CQPC C+ NID    +SC+  TGEC +CL NT G NC+ C  G++G+   +TC +C C+  G +           +C+  TG CPCLPNV GL CDRC D ++NL    GC  C+CD P  + +  C+QLTGQC C+ G  GK C+ C++ ++GDP     C  C CN  G+    C+ + G+CRC+ G++G+ CD C +G   + P C  C  C+ QWDH +  +      L        +N++  +E   VC +    L  N+  ++ I K+  FP G  + + ++ + + R         I+  N Q  ++   ++  D  +   +KN+   +     E      ++LN     +SE+ K Y +I+   +K         N +          +D L ++ + ++     +    I   N  +C +          CGG  C   K +R       C G   +    L  + L        I++  ++Q     N  +I+    + E   N  ++L +   G I+++     E++NL I K+K +L           L EN+   +I    N ++ +   I S+     N+ + L K + + + C+ ++    R  E+                  + LLN  K   TLN++ Q       Q     AN+  + L  N+  + KN    EN+  + ++ +    +R        +   K+  +    +  K + + A+ +   ++ + V  K  Y  L+  +++  +   +  L K   L D  +      +   + I D E K+Q L+     K  +L +L+D++ +
Sbjct:   23 CNRGACHPTTGDLLVGRNTQLMASSTCGLSRAQKYCILSYLEG--EQKCFICDSRFPYDPYDQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDLEALFRFSHLILTFKTFRPAAMLVERSTDYGHNWKVFKYFAKDCATSFPNITSGQAQGVGDIVCDSKYSDIEPSTGGEVVLKVLDPSFEIENP--YSPYIQDLVTLTNLRINFTKLHTLGDALLGRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGMVHGQCVCQHNTDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCEDCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVAGQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSYVTGAHCEECTVGYWGLGN-HLHGCSPCDCDIGGAYSN-VCSPKNGQCECRPHVTGRSCSEPAPGYFFAPLNFYLYEAEEATTLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFARVLPGAGLRFAVNNIPFPVDFTIAIHYETQSAADWTVQIVVNPPGGSEHCIPKTLQSKPQSFALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLQGESHAHSHVLVDSLGLIPQINSLENFCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLI--ISMSAKLHDGAVACKCHPQGSVGSSCSRLGGQCQCKPLVVGRCCDRCSTGSYDLGHHGCHPCHCHPQGSKDTVCDQVTGQCPCHGEVSGRRCDRCLAGYFGFPSCHPCPCNRFAELCDPETGSCFNCGGFTTGRNCERCIDGYYGNPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNPRISGAPCQPCACNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCRRCSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLVPGRGCQSCDCD-PRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPP--GRCIPCDCNRAGTQKPICDPDTGMCRCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMR----LAANMEDKRETLPVCEADFKDLRGNVSEIERILKHPVFPSGKFLKVKDYHDSVRR--------QIMQLNEQLKAVYEFQDLKDTIER--AKNEADLLLEDLQEEIDLQSSVLNASIADSSENIKKYYHISSSAEKKINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPGNVPCVPLPCGGALCTGRKGHRK------CRGPGCHGSLTLSTNALQKAQEAKSIIRNLDKQVRGLKN--QIESISEQAEVSKNNALQLRE-KLGNIRNQSDSEEENINLFIKKVKNFL-----------LEENVPPEDIEKVANGVLDIHLPIPSQ-----NLTDELVKIQKHMQLCEDYRTDENRLNEEADGAQKLLVKAKAAEKAANILLNLDK---TLNQLQQ------AQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELELAKQRSGLEDGLSLLQTKLQRHQDHAVNAKVQAESAQHQAGSLEKEFVELKKQYAILQRKTST--TGLTKETLGKVKQLKDAAEKLAGDTEAKIRRITDLERKIQDLNLSRQAKADQLRILEDQVVA 1744          
BLAST of Netrin-4 vs. Ensembl Human
Match: LAMB2 (laminin subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:6487])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 461/1392 (33.12%), Postives = 709/1392 (50.93%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE-MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---------------------IEKPTYP-------------LEHLKEIKINLPPVSKSGYYNFVITTDTK-NMQFFDSFIIVLSIYHVGKSSCQSY----QDTMQ--LIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYAN-------------------LVSSK-----KCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKW-----QGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSS---------GVFMSNVKFPKEIDDV-----------CTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQ------QNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMD--NLINEMSKNVITFNGVTCNTITESNPLMC 3992
            C +  C P  GDLL+GR   L ASSTCGL   + YC+V+      + KC +CDS+ P+    + HSHRI+NVV+   PQ    WWQS +G+  V+I++  E+EF FT   + FKT+RPAAM +ERS D+GRTW+ Y YFS +C  DFP +P     + ++V+C S +S I PS  G V++          D Y ++ +N +  ITN+RV   RLHT GD  +D    IR KYYYA+ E ++RG C CYGHAS+C    G     E MV+G C C+HNT+G +CE+C+DFY D PW PA+   ++ CRKCEC+ H+ SCHFD  VY  S  +SGGVCD CQHNT  ++CE C+  +YR+    +     C  C CD +G++    C    +  LGL +G C CKE+V G +C +C+ GF+  + ++  GC +C C   GT+  +  CD ++G CYCK  VTG  C  C  G++ LS+ ++ GC  C C   G+ D + CD+ +G+C C+    G RC++++  ++                     +E+   P             L+  + ++  +  V K+  Y+ ++  + +   Q+ +  +IV     V   S   +     D +Q  L   +RY++ PN  CLE  +   L +  + +     P         L+D      R ++ E  +  +                   LV SK      C  L   IS +T+  +  + C+CN  GS ++ CN  GGQC C P V G+ C+ CA   YGF   GC+ C+C   G+L+S C   +G+CLCR G  G  CD C+ G W FP C  C CN  +  C++ TG CL C+ ++ G +C+ C  G++GD     G  C+ C CP G  S ++ +  C     +    C C+ GY+G  C+ C   HFG+     G CQ C CSGNID    D+C+  TG+C +CL +T G +C  C  G+ G  A ++C +C CN +GTN +      Q  C+  +G+CPCLPNV G  CDRC   F+NL+S  GC PC C +P  A   +CN+ TGQC+C+AG  G+ C+ C++  WGDP     C  C C+  G    QC+R  G C C+PG++G  CD C +G  G  P C  C  C+  WD  +  +     +L   +         G F S+    +E   +             S  Q +++ +E+++         I   +E L++L+  + +    +FN        +   + +  +       +   K  +  GA++    S+++  + ++E+++      L        +   R+     +  + +D +  ++ N+ +   ++ +  T  ++T+ N L+C
Sbjct:   42 CSRGSCYPATGDLLVGRADRLTASSTCGLNGPQPYCIVSHLQD--EKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRRAAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQN-LLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDGGRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPGSTPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSH-DLLGCRPCDCDVGGALDPQ-CDEGTGQCHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFVRLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPKDDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVLLPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLL--ISLSTLIYNGALPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALSSLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGYTGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCAPNFWNLTSGHGCQPCAC-HPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQ--CHACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRVVQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVEATEELRRE--------IGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYD----SIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTL-SLTDINELVC 1410          
BLAST of Netrin-4 vs. Ensembl Celegans
Match: lam-1 (LAMinin related. See also lmb [Source:UniProtKB/TrEMBL;Acc:V6CIX7])

HSP 1 Score: 926.776 bits (2394), Expect = 0.000e+0
Identity = 598/1816 (32.93%), Postives = 895/1816 (49.28%), Query Frame = 3
Query:   84 IIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPY--QRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQV------QVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYI-----------------------EKPTYPLEHL------------KEIKINLPPVSKSGYYNFVITTDTKN--MQFFDSFIIVLSIYHVGKSSCQSYQDT-----MQLIKDSRYI-VIPNKCLEKDLPIVLTV-FTIESNNKXXXXXXXX------------XXXXXXXXNSTKTRKVLGE-----CLNYANLVS------SKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCRE-GVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLI---FNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHS------CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWD----------HFLIVVKNTFDKLHNSSGV---FMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYN-SNIIDFNTQ-----QNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQ------KSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVG----CKPDKCYRHAPMNKYCMGKSNQF--FNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQ---SRRIESVNLLIKIKTYLNGS-ADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNI-STLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNN--------ISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKID----TKVVVNKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYSKSEFHAQC 5120
            +   A++ L+ ++++ C+   C P  G+LLIGR+S L+A+STCG    +R+C+V+  +   ++KC  CDS+  +  QR     SHRIENVV+ +  D  R W+QS +G  NVSI    E+EF FT   + FK++RPAAM IERS D+G+TW  Y YF+ +C   FP IPE       +V+CTS++S + PS GG +++   +   V  + Y ++  + +  ITN+R  F +LHT GD  +D  P I  KYYYAI E ++RG CSCYGHAS+C   +  V      +  ++V+G C+C HNT+G +CEKCK FYND PW PA  +  NECR+C CN H+  CHFD  VY+ S  +SGGVCD+C HNT+ KNCE+CK  +YR+    I+    CL C CD  G++   IC  E + + GL AG C CK NV+GN+CD+CK G+W        GC+ C C ++GT  N GCD  TG C CK  VTG +C  C   ++ LS  +++GC  C C   GS DN TC+  +G+C C+ GF+G RC+   S +Y                        E P+ P E                I +N P V  S  YN +I  D     + + +  I V+     G  SC     +      ++   SRYI V P  CLE  +   L + F  +  N  P                       +   S +  + L E     C + A  +S      ++ C+     I+   + K+   +C C+ TGS +  CN  GGQC+C PNV G+ C++CA  +YGF   GCKKC CD  GSL + C   +G+C+CRE G+ G+ C+ C+PG+W FP C +C+CN  +  CD  +G C+ C+  + G+ C  C++GYYGD     GI CK C CP G +S   ++  C L     NT    C CK GY G+ C +C  NH+G+     GTC+ C C+GNID  +E SC++ TGEC KCL +T G  CE CV GY+G+  ++TC +CVCN +GTNS  +G C+  +G+CPC  N++G+QCD+C +  FNL+S  GC  C CD     LNH       CN   GQC C+ GR G+ C+ C+D +WGDPT  +GC +C CN  GS   QC+RNNG C C+ G  G  C+ C +G  G+ P C+ CG+C+ QWD          H LI   N  +    +S     F    +  KE     +    + + ++E+ K   +    +I+   EKL  ++  + N +  +DF  +     Q  +  +  +T   +   SK K  DV GAFN  ++S    L+    +      +   +++    +E L      F +Q         + + L+  +   +   N   C     S P  C   CGG G    C    C   A      + K+NQ   F   A   LD        KE  +  +I      ++D   +         K  +V +   Q   S R E   +  +I  +L    +  +   +L E +   EI+   ++I  L  +I+  + K+NN++ IL++++ N+      +  AV+A ++   L  +++ I   L    Q +  +    V+   + +      L    +N  EA + +          +  V   +K   L I +  K    T           + K + ++ D    T+++  +            K+ ER   LL ++   ND I        L+K      E++L      + +  SRL  +   I+ K++FHA C
Sbjct:   17 VFIEAQHPLQ-QNEDRCQDRSCYPITGNLLIGRKSQLKATSTCGSQGRQRFCIVSHLE--EQTKCFYCDSRTEWKPQREPYRLSHRIENVVTEVMDDKNRNWYQSENGAQNVSISFDLEAEFHFTHLIMTFKSFRPAAMIIERSADFGKTWQVYRYFAYDCDSSFPGIPEGPPKKHTDVICTSQYSDVAPSTGGEIVYKVISPHIVTENPYADEI-STLLKITNLRFNFTKLHTLGDDLLDYRPEIDEKYYYAIYEIVVRGSCSCYGHASRCIPIDPHVSPNTVMERADIVHGRCECMHNTEGLNCEKCKAFYNDLPWRPAIGDEKNECRQCNCNRHALRCHFDRAVYESSGFVSGGVCDDCMHNTQGKNCEQCKPFFYRDPRRTIDDPHVCLPCECDKAGSQNKGICEGEEDAERGLVAGKCYCKTNVDGNRCDRCKNGYWNLTETNVDGCVACTCNLLGTYNNEGCDKYTGMCTCKRLVTGENCDQCLPEHYGLSE-HVDGCKACDCDIGGSYDN-TCEITTGQCKCREGFSGRRCETADSSFYCADITHYVYEAEYANLTRGEVKTREWPSQPHEQTFTGEGFAQAVEGTIITVN-PIVEVSQKYNVIIRHDGARDPVGWENIQITVVRPEAEGDGSCSDAPPSDDFLIARIYPGSRYIEVQPAICLEAGVQYELRIQFNEKRGNSHPQERAAANILIDSILLAPPTSELHIFQGSARAEQHLTEYNRYQCRHLALSLSLFKDQRNEVCERYVCPIAAALLNKTS--ECNCDATGSVSGICNVQGGQCECKPNVVGRRCDQCAIGTYGFGPSGCKKCDCDAVGSLGNDCDKQSGQCVCREKGIYGRQCNQCQPGFWGFPECRTCQCNDHANICDQSSGACIECRDLTTGHYCDRCQDGYYGDPRLGVGIPCKPCPCPGGPTSGYQHADTCYLRNSGNNTQDIVCNCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGNIDMAMEGSCDAATGECLKCLHHTEGAQCEHCVDGYYGDAKLKTCQRCVCNELGTNST-KGACDRVSGQCPCHDNIIGMQCDQCAENHFNLASGAGCEACGCDSNGVVLNHEGVPHLQCNIFDGQCQCKPGRGGRKCDQCEDLYWGDPTTPDGCHRCECNPTGSKSLQCHRNNGTCECQAGSGGALCNECARGYTGQWPYCNPCGECFHQWDNIMQKLQKQVHALIDTANNIEDTGVASAYDADFEKMEETLKETKKALSDANISKEDIEEMSKKLALLKKQVIAG-REKLGAIETRISNITQAVDFAQKDLEHLQKEVDKVTKATIELEDKASKIKEADVLGAFNITRESASKSLDAQRRTDAAIGKLAAAENQALRASELLEKNKNDFEKQYVENEEALNEAETLLGGLESVLPKLNEQVCG--ASSAP--CDALCGGPGSCGFCGGQSCMEGA------VSKANQAKSFATEADTRLDEKQ-----KEAEEVLSI------VRDVLTETTKAKAKAEKAYEVAKNTAQRANSSRAELDKIAEEIGEFLTAQKSSPEQIRNLAEEVLGKEISLTPDQITDLTGKIKESLAKINNIDEILNETRGNKSIAANLESRAVKANKEAELLQKAMEEIREALQLADQAYNNVTS--VLEEIDTMQVQARELIDKARNSTEAVEGKAQAANTTLAELEGVMSGVKVEYLQISESAKNALTTVDAALAAATNAEQKNKQIQTDLERATELLEKRMEGNVAPQQRAEKLRERAAKLLYQAQRHNDDID------NLSKD---STEMRLDDYETILADLNSRLERVTRDIHEKTDFHATC 1789          
BLAST of Netrin-4 vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 248.054 bits (632), Expect = 5.902e-66
Identity = 187/607 (30.81%), Postives = 282/607 (46.46%), Query Frame = 3
Query: 2370 CLCREGVEGQHCDTCKPGY-----WNFPFCH--SCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGT-CQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRT---CTKCVCNHMGT---NSKWQGI-CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSN------VKFPKEI---------------------------------DDVCTSLEQNMKSLKEIKKYFPIGYD----------IIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKN-----------ILNGASESK----------KIYQNITLIKDKLFYRNEEL-RNINLKFIRQKSKDMDNLINEMS 3926
            C C  G  GQ C++C+ G+     +  PF H   C C+  S +C++++G C+ C+ N+ G  C+ C  GYYGD  +G    C+KC CP       N   C L  +       C  GY+G+ CD+C   +FGN   KDGT C  C CSGN D     +C+  TGEC+KC+FNT GFNCE C  GY+G+  +     C  C C   GT   N+ +  + CN + G+C CLPNV+G+QCD+C   F+N++S +GC  CNCD P+G+  ++C+  TGQC C+ G +G+ C+ C D  +G     NGC  C C   GS  +QC+ N+G C CK  + GR CD C +   G    C  C DC+      + V +     L N+    + N       KF +++                                 D++  +LE+ + S+ E      +G D          III N   ++  + +Y      ++   ++ + I    S  Y +   SK      +G   E +K LK            I N    +K          +I + I  +K+K    NE + R ++L   ++KS D  N +  +S
Sbjct:  702 CECLPGFVGQFCESCESGFRRETKFGGPFNHCIKCDCHNHSNSCEAESGSCI-CEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCP-------NDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNP--KDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCD-PLGSEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFG--FSANGCQPCDCEYIGSENQQCDVNSGQCLCKENVEGRRCDQCAENRYGITQGCLPCDDCYTLIQSRVNVFREKVKSLDNTLQEIIENPAPVNDTKFDEKVKETSRAASEVWEAVKQKTKEGGGTIKTKSKAIKDEIVAALEK-LTSIDESVAQAKVGADAAENDMKRWEIIIENARREIENVLHY------LETEGEERAQIAYNASQKYGEQ--SKRMSELASGTREEAEKHLKQASEIEQLSEQAIANATQANKEASDAIYGGEQISKQIAELKEKQNQLNESIHRTLDLAEEQKKSADEANNLAAVS 1286          

HSP 2 Score: 205.297 bits (521), Expect = 8.242e-53
Identity = 152/482 (31.54%), Postives = 230/482 (47.72%), Query Frame = 3
Query:  192 LRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVH------NVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDF------PSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGS 1598
            ++ ++TCG     ++CV  +  +G++S C  CD +  ++ FS    +  +  V     +   WWQS +           ++ +     F  T+  L+F + RP +  I +       W  + ++S +C   +      P +P     N     CT EFS I P  GG + FS        +    ++        + IR+   R++TFGD +V  +P +   YYYAIS++ + GRC C GHAS+C    G   V      VC C+HNT+G  C +C  FYND PW        NEC  C C+  S+ C+FD  +++++    GG C +CQ NT+  +CE+C + ++R           C+ C C+ +G+   + C          N G C CK  V G  CD+C  GF+ F+ N   GC  C C   G+L N+  CDSS+G C CK  V G  C  CK GYF+LS  N  GC+ C C  + S
Sbjct:   64 VQVTNTCGTKRPTKFCV-QSGHTGQRSVCETCDDR--HEGFSHPAKYLTDFNVG----NNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFISPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRAPILP----GNEATAQCTKEFSDISPITGGNIAFSTLEGRPSAHAFEESEVLQKWVTASAIRISLNRMNTFGD-EVFKDPQVLRSYYYAISDFAVGGRCKCNGHASECV---GSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETGH--GGHCIDCQGNTQGVHCEQCIANHWRRPG-----ENYCVACGCNEIGS-LSTQCD---------NEGKCQCKPGVTGRFCDQCLDGFYDFSTN---GCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGRQCDKCKPGYFDLSTENQFGCTPCFCFGHSS 510          

HSP 3 Score: 126.331 bits (316), Expect = 1.220e-28
Identity = 106/324 (32.72%), Postives = 154/324 (47.53%), Query Frame = 3
Query: 2163 IKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARG----CKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP----FCHSCKCNQMSTT-----CDSKTGKCLNCKGNSFGYNCQNCENGYYGDT---SRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCN 3086
            IKC C+   + +N+C    G C C  N +G TCERCA   YG   +G    C+KC C   G        D     C  G  G+ CD C  GY+  P     C  C C+  +       CD  TG+C  C  N+ G+NC+NC+ GY+GD     +G  C+ C C    + + N+    L  N     C C     G  CDQC  + F N  S  G CQ C C     +   ++C+  TG+C +C    +G  C++C   +FG  A   C  C C ++G+ ++    C+  +G+C C  NV G +CD+C +  + ++   GCLPC+
Sbjct:  734 IKCDCH---NHSNSCEAESGSCICEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGN-CQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQC-AHGFYNITSGLG-CQECNCDPLGSEG--NTCDVNTGQC-QCKPGVTGQRCDRCADYHFGFSA-NGCQPCDCEYIGSENQQ---CDVNSGQCLCKENVEGRRCDQCAENRYGITQ--GCLPCD 1042          

HSP 4 Score: 119.013 bits (297), Expect = 2.257e-26
Identity = 106/320 (33.12%), Postives = 138/320 (43.12%), Query Frame = 3
Query:  858 RCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFY------------------NDSP-WLPADKNST-NEC------RKC---------------ECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            +C C+ H++ C+A+ G           C C+HNT G  CE+C   Y                  ND P  L AD +    EC      R+C               EC   + S + DP       K++G  C  C  NT   NCE CK GY+ +    I     C  C C + GT+ P+       L+     G C C  NV G QCD+C  GF+        GC +CNC  +G+ E   CD +TG+C CK  VTG  C  C   +F  S    NGC  C C EY   +N+ CD  SG+CLCK    G RCD+     Y
Sbjct:  735 KCDCHNHSNSCEAESGS----------CICEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITG-ECKKCIFNTHGFNCENCKPGYWGD--ALIEPKGNCQSCGCFAAGTRRPNN--DYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSG--LGCQECNCDPLGS-EGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFS---ANGCQPCDC-EYIGSENQQCDVNSGQCLCKENVEGRRCDQCAENRY 1032          

HSP 5 Score: 91.2781 bits (225), Expect = 6.844e-18
Identity = 59/156 (37.82%), Postives = 76/156 (48.72%), Query Frame = 3
Query: 2169 CKCNVTGSRNNN-------CNKIGGQCQCLPNVSGKTCERCASESYGF-DARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF--CHSCKCNQMST---TCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKC 2597
            C C   G+R  N       CN+  GQC CLPNV G  C++CA   Y      GC++C CD  GS  + C  +TG+C C+ GV GQ CD C   ++ F    C  C C  + +    CD  +G+CL CK N  G  C  C    YG T   + C  C
Sbjct:  890 CGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCDPLGSEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDCEYIGSENQQCDVNSGQCL-CKENVEGRRCDQCAENRYGITQGCLPCDDC 1044          

HSP 6 Score: 82.0333 bits (201), Expect = 4.054e-15
Identity = 83/296 (28.04%), Postives = 108/296 (36.49%), Query Frame = 3
Query:  939 CDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDS-----LGTKFPSICIQEPELDLGLNAGHCI---------------------------------------CKENVEGNQCDKCKIGFWKFNGNEETG-CLKCNCVMMGTLENRG------CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCD 1673
            C+C     GQ CE C+  +             N C KC+C++HS+SC           +   G C  C+HNT    CERC  GYY +      + + C KC C +     L      IC + P    G     C                                        C  N  G  C+ CK G+W     E  G C  C C   GT           C+   G+C C   V G  C  C  G++N+++    GC  C C   GS  N TCD  +G+C CK G  G RCD
Sbjct:  702 CECLPGFVGQFCESCESGFRRETKFGG---PFNHCIKCDCHNHSNSC-----------EAESGSC-ICEHNTAGDTCERCARGYYGDALQG--TEEDCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSG--LGCQECNCDPLGSEGN-TCDVNTGQCQCKPGVTGQRCD 977          

HSP 7 Score: 77.411 bits (189), Expect = 1.114e-13
Identity = 78/258 (30.23%), Postives = 121/258 (46.90%), Query Frame = 3
Query: 2556 YYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGT------CQPCRCSG-----NIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHS--CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLN-GCTKCYCNLDGSVFKQCNRNNG 3287
            YY   S   +  +C+C G +S     +G S +       C C+    G  C++C    + +   + GT      C  C CS        DQ++ +      G C  C  NT G +CE+C++ ++       C  C CN +G+ S     C++E GKC C P V G  CD+C D F++ S+  GC  C C+   G+LN+   C+  +G C C+    G+ C+ CK G++   T+   GCT C+C    S+   CN  +G
Sbjct:  274 YYYAISDFAVGGRCKCNGHAS---ECVGSSSVDGENRLVCRCEHNTQGADCNEC-LPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEE-TGHGGHCIDCQGNTQGVHCEQCIANHWRRPGENYCVACGCNEIGSLSTQ---CDNE-GKCQCKPGVTGRFCDQCLDGFYDFSTN-GCKNCGCETS-GSLNNQPRCDSSSGSCSCKLNVEGRQCDKCKPGYFDLSTENQFGCTPCFCFGHSSI---CNTADG 517          

HSP 8 Score: 72.4034 bits (176), Expect = 3.191e-12
Identity = 47/118 (39.83%), Postives = 67/118 (56.78%), Query Frame = 3
Query: 2163 IKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQ--CYNDTGKCLCREGVEGQHCDTCKPGYWNFPF-----CHSCKCNQMSTTCDSKTG 2495
            + C CN  GS +  C+   G+CQC P V+G+ C++C    Y F   GCK C C+ +GSLN+Q  C + +G C C+  VEG+ CD CKPGY++        C  C C   S+ C++  G
Sbjct:  401 VACGCNEIGSLSTQCDN-EGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGRQCDKCKPGYFDLSTENQFGCTPCFCFGHSSICNTADG 517          

HSP 9 Score: 66.6254 bits (161), Expect = 2.018e-10
Identity = 67/218 (30.73%), Postives = 102/218 (46.79%), Query Frame = 3
Query: 2739 AISKDGTCQPCRCSGNIDQRIEDSCNSKTGECR---KCLFNTSGFNCEKCVSGY----FGNGA---VRTCTKCVCNHMGTNSKWQGICNHETGK----CPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQ--CNRNNGVCRCKPGITGRNCDMCMKG 3344
            AIS       C+C+G+  + +  S  S  GE R   +C  NT G +C +C+  Y    + +G       C  C C+ +     +      ETG       C  N  G+ C++C    +    +  C+ C C+  IG+L+  C+   G+C C+ G +G+ C+ C DGF+   T  NGC  C C   GS+  Q  C+ ++G C CK  + GR CD C  G
Sbjct:  277 AISDFAVGGRCKCNGHASECVGSS--SVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETGHGGHCIDCQGNTQGVHCEQCIANHWRRPGENYCVACGCN-EIGSLSTQCDN-EGKCQCKPGVTGRFCDQCLDGFYDFST--NGCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGRQCDKCKPG 488          

HSP 10 Score: 60.8474 bits (146), Expect = 1.086e-8
Identity = 54/171 (31.58%), Postives = 80/171 (46.78%), Query Frame = 3
Query: 2217 GGQC-QCLPNVSGKTCERCASESYGFDARG-CKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF--CHSCKCNQMSTTCDSK----TGKCLNCKGNSFGYNCQNCENGYYG-DTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQ 2702
            GG C  C  N  G  CE+C +  +       C  C C+  GSL++QC N+ GKC C+ GV G+ CD C  G+++F    C +C C    +  +      +    +CK N  G  C  C+ GY+   T     C  C C G SS+ N + G     N ++     K+ ++GQ
Sbjct:  369 GGHCIDCQGNTQGVHCEQCIANHWRRPGENYCVACGCNEIGSLSTQCDNE-GKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGRQCDKCKPGYFDLSTENQFGCTPCFCFGHSSICNTADG-YFAMNVSSVFDQDKQKWAGQ 537          

HSP 11 Score: 60.4622 bits (145), Expect = 1.458e-8
Identity = 49/155 (31.61%), Postives = 64/155 (41.29%), Query Frame = 3
Query: 2991 CPCLPNVVGLQCDRCQDKFFNLSSQIG-------CLPCNCDYPIGALNHSCNQLTGQCY-----------------CQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKG-TDGKMPNCSSCG 3380
            C C  N  G  C+ C   + +   + G       C+ CNC           +QL+ +CY                 CQ    G  C  C    W  P + N C  C CN  GS+  QC+ N G C+CKPG+TGR CD C+ G  D     C +CG
Sbjct:  310 CRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNC-----------SQLSNRCYFDQQLFEETGHGGHCIDCQGNTQGVHCEQCIANHWRRPGE-NYCVACGCNEIGSLSTQCD-NEGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCG 451          

HSP 12 Score: 59.3066 bits (142), Expect = 3.220e-8
Identity = 60/211 (28.44%), Postives = 89/211 (42.18%), Query Frame = 3
Query: 2370 CLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTC---------DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRC--SGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRT--CTKCVC 2933
            C C    +G  C+ C P Y + P+          C +C C+Q+S  C             G C++C+GN+ G +C+ C   ++        C  C C  + SL   S  C          C CK G +G+FCDQC    +    S +G C+ C C  SG+++ +     +S +  C+    N  G  C+KC  GYF         CT C C
Sbjct:  310 CRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETGHGGHCIDCQGNTQGVHCEQCIANHWRRPGEN-YCVACGCNEIGSL---STQCD-----NEGKCQCKPGVTGRFCDQCLDGFYD--FSTNG-CKNCGCETSGSLNNQPRCDSSSGSCSCK---LNVEGRQCDKCKPGYFDLSTENQFGCTPCFC 505          
BLAST of Netrin-4 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 207.223 bits (526), Expect = 5.043e-56
Identity = 133/438 (30.37%), Postives = 211/438 (48.17%), Query Frame = 3
Query:  123 DNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGR-KSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGV--HNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERK--RSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRL--------------HTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGF 1379
            D+  R   C P   +   G+     AS TCG    ++YC V     G  + +C  CD++N +Q   ++    + ++ +         W S   +   NVS+ +S   +F+ T+  + F +  P +M + +S D+G+TW  + ++S  C R F   P+    +SN  E +CT+  S I+   G  V F    +     +   +    D    T+I+V F RL              +++G+ + DD   ++ +Y+Y++ E  + GRC C GHAS+C          +M    CDC+HNT G  CE CK F+ D PW  A  NS N C  C CN H+  C FD  +++ S   SGGVC NC+HNT  +NC  CK G+ R+ ++ +   + C  C C  +G+   S C Q        ++G C+CK  V G  C++C  G+
Sbjct:   39 DHTGRPVRCVPEFINAAFGKPVI--ASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGN------MTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDPDVSITKSNEQEAVCTA--SHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGN-ETDDE--VKQRYFYSMGELAVGGRCKCNGHASRCI-------FDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKS-CNQ--------SSGQCVCKPGVTGTTCNRCAKGY 447          

HSP 2 Score: 75.8702 bits (185), Expect = 1.836e-13
Identity = 57/172 (33.14%), Postives = 80/172 (46.51%), Query Frame = 3
Query: 1047 KCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNI--AVAINSSQTCLKCHCDSLGTKFPSICIQEPEL---DLGLNAGHCI-CKENVEGNQCDKCKIGFWK---FNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGY 1535
            +C+CN H+S C FD        KM    CD C+HNT    CE CK  +Y         NS+ +C+ C+C+    +    C  + EL       + G C+ C+ N  G  C  CK GF +           C  C C  +G+L  + C+ S+G+C CK  VTG  C+ C  GY
Sbjct:  290 RCKCNGHASRCIFD--------KMGRYTCD-CKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKR----CRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGY 447          

HSP 3 Score: 62.3882 bits (150), Expect = 2.667e-9
Identity = 50/179 (27.93%), Postives = 75/179 (41.90%), Query Frame = 3
Query: 2769 CRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVR-------TCTKCVCNHMGTNSKWQGIC-----NHETGKCP-CLPNVVGLQCDRCQDKF-----FNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLD 3251
            C+C+G+  + I D     T +C+    NT+G  CE C   ++     R       +C  C CN      ++         N   G C  C  N  G  C  C+  F       ++ +  C  C C +P+G+L  SCNQ +GQC C+ G +G  CN C  G+    + +  C K     D
Sbjct:  291 CKCNGHASRCIFDKMGRYTCDCKH---NTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGC-HPVGSLGKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKAD 465          

HSP 4 Score: 62.3882 bits (150), Expect = 2.736e-9
Identity = 48/171 (28.07%), Postives = 77/171 (45.03%), Query Frame = 3
Query: 2889 YFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFN-------LSSQIGCLPCNCD-------YPIGALNHSCNQLTGQCY-CQAGRSGKMCNNCKDGFWGDP----TKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKG 3344
            ++  G +    +C CN   +   +  +  +    C C  N  G +C+ C+   ++        +S   C+ CNC+       +       S N+  G C  C+   +G+ C+ CK GF  D     T    C  C C+  GS+ K CN+++G C CKPG+TG  C+ C KG
Sbjct:  279 FYSMGELAVGGRCKCNGHASRCIFDKMGRY---TCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKSCNQSSGQCVCKPGVTGTTCNRCAKG 446          

HSP 5 Score: 62.003 bits (149), Expect = 3.659e-9
Identity = 57/216 (26.39%), Postives = 90/216 (41.67%), Query Frame = 3
Query: 2310 KCKCDLTGSLNSQCYNDTGK--CLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTC-----------DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEK 2876
            +CKC+  G  +   ++  G+  C C+    G  C+ CKP +++ P+          C +C CNQ +  C           +   G CLNC+ N+ G NC  C+ G+  DTS  +     CK C C  + SL  +        N ++  C+CK G +G  C++C   +         T  PC         I  S + +  +C KC       N +K
Sbjct:  290 RCKCN--GHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKSC-------NQSSGQCVCKPGVTGTTCNRCAKGY----QQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKK 492          
BLAST of Netrin-4 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 207.223 bits (526), Expect = 5.043e-56
Identity = 133/438 (30.37%), Postives = 211/438 (48.17%), Query Frame = 3
Query:  123 DNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGR-KSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGV--HNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERK--RSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRL--------------HTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGF 1379
            D+  R   C P   +   G+     AS TCG    ++YC V     G  + +C  CD++N +Q   ++    + ++ +         W S   +   NVS+ +S   +F+ T+  + F +  P +M + +S D+G+TW  + ++S  C R F   P+    +SN  E +CT+  S I+   G  V F    +     +   +    D    T+I+V F RL              +++G+ + DD   ++ +Y+Y++ E  + GRC C GHAS+C          +M    CDC+HNT G  CE CK F+ D PW  A  NS N C  C CN H+  C FD  +++ S   SGGVC NC+HNT  +NC  CK G+ R+ ++ +   + C  C C  +G+   S C Q        ++G C+CK  V G  C++C  G+
Sbjct:   39 DHTGRPVRCVPEFINAAFGKPVI--ASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGN------MTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDPDVSITKSNEQEAVCTA--SHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGN-ETDDE--VKQRYFYSMGELAVGGRCKCNGHASRCI-------FDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKS-CNQ--------SSGQCVCKPGVTGTTCNRCAKGY 447          

HSP 2 Score: 75.8702 bits (185), Expect = 1.836e-13
Identity = 57/172 (33.14%), Postives = 80/172 (46.51%), Query Frame = 3
Query: 1047 KCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNI--AVAINSSQTCLKCHCDSLGTKFPSICIQEPEL---DLGLNAGHCI-CKENVEGNQCDKCKIGFWK---FNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGY 1535
            +C+CN H+S C FD        KM    CD C+HNT    CE CK  +Y         NS+ +C+ C+C+    +    C  + EL       + G C+ C+ N  G  C  CK GF +           C  C C  +G+L  + C+ S+G+C CK  VTG  C+ C  GY
Sbjct:  290 RCKCNGHASRCIFD--------KMGRYTCD-CKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKR----CRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGY 447          

HSP 3 Score: 62.3882 bits (150), Expect = 2.667e-9
Identity = 50/179 (27.93%), Postives = 75/179 (41.90%), Query Frame = 3
Query: 2769 CRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVR-------TCTKCVCNHMGTNSKWQGIC-----NHETGKCP-CLPNVVGLQCDRCQDKF-----FNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLD 3251
            C+C+G+  + I D     T +C+    NT+G  CE C   ++     R       +C  C CN      ++         N   G C  C  N  G  C  C+  F       ++ +  C  C C +P+G+L  SCNQ +GQC C+ G +G  CN C  G+    + +  C K     D
Sbjct:  291 CKCNGHASRCIFDKMGRYTCDCKH---NTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGC-HPVGSLGKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKAD 465          

HSP 4 Score: 62.3882 bits (150), Expect = 2.736e-9
Identity = 48/171 (28.07%), Postives = 77/171 (45.03%), Query Frame = 3
Query: 2889 YFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFN-------LSSQIGCLPCNCD-------YPIGALNHSCNQLTGQCY-CQAGRSGKMCNNCKDGFWGDP----TKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKG 3344
            ++  G +    +C CN   +   +  +  +    C C  N  G +C+ C+   ++        +S   C+ CNC+       +       S N+  G C  C+   +G+ C+ CK GF  D     T    C  C C+  GS+ K CN+++G C CKPG+TG  C+ C KG
Sbjct:  279 FYSMGELAVGGRCKCNGHASRCIFDKMGRY---TCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKSCNQSSGQCVCKPGVTGTTCNRCAKG 446          

HSP 5 Score: 62.003 bits (149), Expect = 3.659e-9
Identity = 57/216 (26.39%), Postives = 90/216 (41.67%), Query Frame = 3
Query: 2310 KCKCDLTGSLNSQCYNDTGK--CLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTC-----------DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEK 2876
            +CKC+  G  +   ++  G+  C C+    G  C+ CKP +++ P+          C +C CNQ +  C           +   G CLNC+ N+ G NC  C+ G+  DTS  +     CK C C  + SL  +        N ++  C+CK G +G  C++C   +         T  PC         I  S + +  +C KC       N +K
Sbjct:  290 RCKCN--GHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKSC-------NQSSGQCVCKPGVTGTTCNRCAKGY----QQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKK 492          
BLAST of Netrin-4 vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 211.46 bits (537), Expect = 1.958e-54
Identity = 159/513 (30.99%), Postives = 231/513 (45.03%), Query Frame = 3
Query:  174 IGRESFLRASSTCGLTNSERYCVVTTSDSGRKS------KCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHN-----VSIEISFESEFQFTFTHLRF-KTYRPAAMYIERSKD--YGRTWNKYAYFSDNCPRDF--PS---IPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNK------------YYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMS-------GGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGS 1598
            +   S + A+ TCG   +E YC +      RK+      +C ICD+ N ++R      H IE  +        RWWQS S  +      V+I I    E+Q  +  L+   + RP    +E+S D  Y   W  YA     C R F  P+   +P  ++ +  EV CTSE+S I P E G +  S      VN          ++   T  R +FVRL       ++ +  I NK            Y+Y+IS+  I G+C CYGHA  C +     Q K      C+C+HNT G+ C +C   +N  PW P   +  N C++C+C +H+ SC +D  + +    ++       GG C  C HNTE  NCERCK GYYR   ++      C  C CD +G+   +    +   + G   G CICK    G +C++C  G+          C  C C   G++    CD ++  C CK+ V G  C  CK G  +LS +N  GC  C C  + S
Sbjct:   55 LATNSLITATDTCGQYTAEEYCKLVEHVLLRKTTNTQSPQCDICDANNVHKR------HPIEYAID----GTRRWWQSPSLANGLRFEKVNITIDLRQEYQVAYIILKMGNSPRPGTWVLEKSLDGEYYEPWQYYAMQDAECMRQFGIPATTGVPRFQKED--EVHCTSEYSKITPLENGEIHTS-----LVNGRPGAENTSLELQKFT--RARFVRLRLISPRTLNADLMIINKKSDSLDKSVTMRYFYSISDISIGGQCICYGHAESCPSDPVTGQFK------CECRHNTCGESCNRCCPLFNQLPWKPGTNSHPNVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGY-----RNHPTCEPCPCNRAGSVNFDTCDGAS--CQCKANVEGIYCDRCKAGTIHLSASNPLGCQPCFCFGHSS 535          

HSP 2 Score: 185.652 bits (470), Expect = 1.446e-46
Identity = 116/343 (33.82%), Postives = 181/343 (52.77%), Query Frame = 3
Query: 2370 CLCREGVEGQHCDTCKPGYWNF------PFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI---LCKKCQCPGLSSLKNN-------SIGCSLIFNTTAFTCM-CKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFK-QCNRNNGVCRCKPGITGRNCDMCMKG 3344
            C C E   G  C++C PGY           C  C C+  S  CD  TG+CLNC+ N+ G  C+ C+ G+ G+ SRG     C++C+CP L    N        ++  S+  N   + C+ C  GY G  C+ C    F + ++  G C  C C+GNID     +C+S+TG+C KC+ +T+G +CE C   ++GN  + TC  C C+  G  +     C+ E G+C C  N +G QCDRC++   ++ +  GC  C+C+   G++   C+Q++GQC C+ G  GK C+ C+  ++       GC  C+CN+ GS+   +C++  G C C+  + G  C+ C  G
Sbjct:  741 CECPENFAGNSCESCVPGYRRVNNQLYGGRCEKCDCHGNSEECDPFTGECLNCRHNTTGSRCELCKPGHVGNPSRGGELGACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFEDPLT--GKCIECTCNGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESCKEHHWGNAQLHTCKPCGCHTQGAVNPQ---CSEENGECECKENYIGAQCDRCKENHGDVEN--GCPACDCN-DTGSIGSDCDQVSGQCNCKQGVFGKQCDQCRPSYFNFTDA--GCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADG 1073          

HSP 3 Score: 181.415 bits (459), Expect = 3.197e-45
Identity = 129/371 (34.77%), Postives = 185/371 (49.87%), Query Frame = 3
Query: 2169 CKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNF--PFCHSCKCNQMSTT----CDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDY----PIGALNHS--CNQLTGQCYCQAGRSGKMCNNCKDG-FWGDPTKLNGCTKCYC 3242
            C C+  G+ N  C++  G+C+C  N  G  C+RC  E++G    GC  C C+ TGS+ S C   +G+C C++GV G+ CD C+P Y+NF    C  C CN   +     CD  TGKC  C+ N  G  C+ C +GY+  TS G  C+ C C    S     + C+L+       C+CK G +G  CD C  N +G        C+PC   G +   I+ SC         C  NT G  CE C +  +    +  C  C C+ +G++    G+CN  TG+C C    VGL+CD C   FFN  +   C PC C+     P+   +    CN++ G+C C+    G  C+ C +G F  D + L GCT+C+C
Sbjct:  941 CGCHTQGAVNPQCSEENGECECKENYIGAQCDRC-KENHGDVENGCPACDCNDTGSIGSDCDQVSGQCNCKQGVFGKQCDQCRPSYFNFTDAGCQFCHCNIYGSIEDGKCDQTTGKC-ECRENVEGTMCEKCADGYFNITS-GDGCEDCGCDPTGS---EDVSCNLVTG----QCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQVCDPIDGSC--------VCPPNTVGEMCENCTTNAWDYHPLNGCKLCDCSDIGSDG---GMCNTFTGQCKCKAAYVGLKCDLCTHGFFNFPT---CEPCGCNAAGTDPLQCKDGQCLCNEI-GECPCKKNVHGTKCDQCGEGTFSLDSSNLKGCTECFC 1286          

HSP 4 Score: 167.933 bits (424), Expect = 3.972e-41
Identity = 149/476 (31.30%), Postives = 199/476 (41.81%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQC-QCLPNVSGKTCERCASESYGFDARG-----CKKCKC-DLTGSLNSQCYNDTGKCL--------------CREGVEGQHCDTCKPGYWNFPF---CHSCKCN-----QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSR--------------------------------GILCKKCQ---------CPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDS-CNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCG 3380
            KC C+     +  C+   G+C  C  N +G  CE C     G  +RG     C++C+C  L  + N +C +     L              C  G EG  C+ C  G++  P    C  C CN          CDS+TGKCL C G++ G +C++C+  ++G+                                   G  C +C+         CP        SIG     +  +  C CK+G  G+ CDQC  ++F      D  CQ C C  NI   IED  C+  TG+C +C  N  G  CEKC  GYF   +   C  C C+  G+       CN  TG+C C P V GL+CD C   F+ L+S+ GC  C    P  A    C+ + G C C     G+MC NC    W D   LNGC  C C+  GS    CN   G C+CK    G  CD+C  G     P C  CG
Sbjct:  773 KCDCH---GNSEECDPFTGECLNCRHNTTGSRCELCKPGHVGNPSRGGELGACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFEDPLTGKCIECTCNGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESCKEHHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGDVENGCPACDCNDTGSIGSDC--DQVSGQCNCKQGVFGKQCDQCRPSYFNFT---DAGCQFCHC--NIYGSIEDGKCDQTTGKC-ECRENVEGTMCEKCADGYFNITSGDGCEDCGCDPTGSEDV---SCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSE-GCTECE---PCPAPGQVCDPIDGSCVCPPNTVGEMCENCTTNAW-DYHPLNGCKLCDCSDIGSDGGMCNTFTGQCKCKAAYVGLKCDLCTHGF-FNFPTCEPCG 1228          

HSP 5 Score: 163.696 bits (413), Expect = 6.802e-40
Identity = 132/417 (31.65%), Postives = 189/417 (45.32%), Query Frame = 3
Query: 2157 DPIKCKC-------NVTGSRNNNCNKIGGQC-QCLPNVSGKTCERCASESYG-FDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP-FCHSCKCNQ---MSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKC-VCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNN------GVCRCKPGITGRNCDMCMKGT 3347
            DP+  KC       N+      NC+   G+C +C+ + +G +CE C    +G      CK C C   G++N QC  + G+C C+E   G  CD CK  + +    C +C CN    + + CD  +G+C NCK   FG  C  C   Y+  T  G  C+ C C    S+++         + T   C C++   G  C++C   +F N  S DG C+ C C     + +  SCN  TG+C  C    +G  C+ C+  ++G  +   CT+C  C   G       +C+   G C C PN VG  C+ C    ++     GC  C+C   IG+    CN  TGQC C+A   G  C+ C  GF+  PT    C  C CN  G+   QC          G C CK  + G  CD C +GT
Sbjct:  880 DPLTGKCIECTCNGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESCKEHHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGDVENGCPACDCNDTGSIGSDCDQVSGQC-NCKQGVFGKQCDQCRPSYFNFTDAG--CQFCHCNIYGSIEDGKC------DQTTGKCECRENVEGTMCEKCADGYF-NITSGDG-CEDCGCDPTGSEDV--SCNLVTGQC-VCKPGVTGLKCDSCLPNFYGLTS-EGCTECEPCPAPGQ------VCDPIDGSCVCPPNTVGEMCENCTTNAWDYHPLNGCKLCDCS-DIGSDGGMCNTFTGQCKCKAAYVGLKCDLCTHGFFNFPT----CEPCGCNAAGTDPLQCKDGQCLCNEIGECPCKKNVHGTKCDQCGEGT 1270          

HSP 6 Score: 102.834 bits (255), Expect = 2.055e-21
Identity = 81/268 (30.22%), Postives = 128/268 (47.76%), Query Frame = 3
Query:  915 VKEMVYGVCD--------CQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            +  M  G CD        C  +T G  CE CK+ +    W  A  ++   C+ C C++  +    +P   +++     G C+ C+ N     C+RCK  +        +    C  C C+  G+   S C Q         +G C CK+ V G QCD+C+  ++ F    + GC  C+C + G++E+  CD +TGKC C+  V G  C  C  GYFN+++   +GC  C C   GS D  +C+  +G+C+CK G  G++CD     +Y
Sbjct:  895 IDPMGIGNCDSETGKCLKCIGHTTGDSCESCKEHH----WGNAQLHT---CKPCGCHTQGA---VNPQCSEEN-----GECE-CKENYIGAQCDRCKENHG-------DVENGCPACDCNDTGS-IGSDCDQV--------SGQCNCKQGVFGKQCDQCRPSYFNFT---DAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGYFNITSG--DGCEDCGCDPTGSED-VSCNLVTGQCVCKPGVTGLKCDSCLPNFY 1124          

HSP 7 Score: 98.5969 bits (244), Expect = 4.002e-20
Identity = 90/317 (28.39%), Postives = 137/317 (43.22%), Query Frame = 3
Query:  858 RCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFD------PVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRN-----------------IAVAINSSQT--CLKC-------HCDS----------LGTKFPSICIQEPELDL--GLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE 1676
            +C C+G++ +C    G+           +C+HNT G  CE CK  +  +   P+       C +CEC S   + + +       V+   +      VC NC    E   CE C  G++ +                 + +    S+T  CLKC        C+S          L T  P  C  +  ++       G C CKEN  G QCD+CK    + +G+ E GC  C+C   G++    CD  +G+C CK  V G  C  C+  YFN ++A   GC  C C+ YGS ++  CD+ +GKC C+    G  C++
Sbjct:  773 KCDCHGNSEECDPFTGEC---------LNCRHNTTGSRCELCKPGHVGN---PSRGGELGACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFEDPLTGKCIECTCNGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESCKEHHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCK----ENHGDVENGCPACDCNDTGSI-GSDCDQVSGQCNCKQGVFGKQCDQCRPSYFNFTDA---GCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEK 1069          

HSP 8 Score: 94.3597 bits (233), Expect = 7.105e-19
Identity = 87/265 (32.83%), Postives = 120/265 (45.28%), Query Frame = 3
Query:  936 VCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNE-----CRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGH-----CI-CKENVEGNQCDKCKIGFWKFNGNEETG-CLKCNCVMMGTLENRG---CDSSTGKCY-CKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIK 1682
            VC+C  N  G  CE C         +P  +   N+     C KC+C+ +S  C  DP           G C NC+HNT    CE CK G+  N +        C +C C SL       CI      LG  A +     CI C    EGN+C+ C  GF++   +  TG C++C C   G ++  G   CDS TGKC  C    TG+ C +CK  ++   NA ++ C  C C   G+  N  C + +G+C CK  + G +CD  K
Sbjct:  740 VCECPENFAGNSCESC---------VPGYRRVNNQLYGGRCEKCDCHGNSEEC--DPFT---------GECLNCRHNTTGSRCELCKPGHVGNPSRG-GELGACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFE---DPLTGKCIECTC--NGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESCKEHHW--GNAQLHTCKPCGCHTQGAV-NPQCSEENGECECKENYIGAQCDRCK 975          

HSP 9 Score: 87.0409 bits (214), Expect = 1.507e-16
Identity = 65/207 (31.40%), Postives = 97/207 (46.86%), Query Frame = 3
Query: 2367 KCL-CREGVEGQHCDTCKPGYWN---------------FPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI--LCKKCQCPGLSSLKNNSIGCSLIFNTTAFTC-MCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGY-FGNGAVRTCTKC 2927
            KCL C +G  G  C   + GY+                  +   C C+  S TC+  T  C +C+ N+FG  C++C  GY GD   G    C KC CP + +  ++S  C  + +   + C  CK GY+GQ+C+ C   ++G+     GTC PC C  + D  +  +CN  +G+C +C    +G  C  C   + F N   R CT C
Sbjct: 1496 KCLGCPQGYTGLSCQNPEVGYYRKKHREYLNQADDIALIGWSEPCSCHGHSQTCNPDTSVCTDCEHNTFGDFCEHCLPGYIGDAREGGANACTKCACPLVENSFSDS--CVAVDHGRGYVCNSCKPGYTGQYCETCVAGYYGDPQHIGGTCSPCDC--HPDGSLHGACNPLSGQC-ECKPGVTGRTCSMCQERHAFIN---RVCTSC 1694          

HSP 10 Score: 75.8702 bits (185), Expect = 3.417e-13
Identity = 52/152 (34.21%), Postives = 69/152 (45.39%), Query Frame = 3
Query: 2217 GGQC-QCLPNVSGKTCERCASESY------GFDARGCKKCKCDLTGSLNSQCYND---------TGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQM-STTCDSKTGKCLNCKGNSFGYNCQNCENG-YYGDTSRGILCKKCQCPGLSS 2618
            GG+C +C  N  G  CERC    Y       +    C+ C+CD  GS++  C  D          G C+C+ G  G+ C+ C PGY N P C  C CN+  S   D+  G    CK N  G  C  C+ G  +   S  + C+ C C G SS
Sbjct:  384 GGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPTCEPCPCNRAGSVNFDTCDGASCQCKANVEGIYCDRCKAGTIHLSASNPLGCQPCFCFGHSS 535          

HSP 11 Score: 74.7146 bits (182), Expect = 7.593e-13
Identity = 47/134 (35.07%), Postives = 68/134 (50.75%), Query Frame = 3
Query: 2970 CNHETGKCP-CLPNVVGLQCDRCQDKFFNLSSQIG---CLPCNCDYPIGALNHSCNQLT-GQCY----CQAGRSGKMCNNCKDGFWGDPTKLNG-CTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMK 3341
            CN +T  C  C  N  G  C+ C   +   + + G   C  C C     + + SC  +  G+ Y    C+ G +G+ C  C  G++GDP  + G C+ C C+ DGS+   CN  +G C CKPG+TGR C MC +
Sbjct: 1549 CNPDTSVCTDCEHNTFGDFCEHCLPGYIGDAREGGANACTKCACPLVENSFSDSCVAVDHGRGYVCNSCKPGYTGQYCETCVAGYYGDPQHIGGTCSPCDCHPDGSLHGACNPLSGQCECKPGVTGRTCSMCQE 1682          

HSP 12 Score: 71.2478 bits (173), Expect = 7.663e-12
Identity = 72/296 (24.32%), Postives = 112/296 (37.84%), Query Frame = 3
Query:  921 EMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNE-CRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDN------CQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTK------FPSICIQEPELD-----------LGLNA--------------------GHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE 1676
            + V G C+C+    G+ C++C+         P+  N T+  C+ C CN + S              +  G CD       C+ N E   CE+C  GY+      I S   C  C CD  G++          C+ +P +             GL +                    G C+C  N  G  C+ C    W ++     GC  C+C  +G+ +   C++ TG+C CK+   G  C  C  G+FN       GC+         +D +      G+C CK    G +CD+
Sbjct: 1001 DQVSGQCNCKQGVFGKQCDQCR---------PSYFNFTDAGCQFCHCNIYGS--------------IEDGKCDQTTGKCECRENVEGTMCEKCADGYFN-----ITSGDGCEDCGCDPTGSEDVSCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQVCDPIDGSCVCPPNTVGEMCENCTTNAWDYH--PLNGCKLCDCSDIGS-DGGMCNTFTGQCKCKAAYVGLKCDLCTHGFFNFPTCEPCGCNAAGTDPLQCKDGQCLCNEIGECPCKKNVHGTKCDQ 1265          

HSP 13 Score: 69.707 bits (169), Expect = 2.424e-11
Identity = 63/211 (29.86%), Postives = 86/211 (40.76%), Query Frame = 3
Query: 2466 MSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL-----------CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDG-TCQPCRCSGNIDQRIEDSC----NSKTGECRKCLFNTSGFNCEKCVSGYFGNGAV--RTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDK 3044
            +STT      KCL C     G +CQN E GYY    R  L            + C C G S   N           T+    C+    G FC+ C   + G+A       C  C C   ++    DSC    + +   C  C    +G  CE CV+GY+G+      TC+ C C+  G+     G CN  +G+C C P V G  C  CQ++
Sbjct: 1486 LSTTKAIGVEKCLGCPQGYTGLSCQNPEVGYYRKKHREYLNQADDIALIGWSEPCSCHGHSQTCNPD---------TSVCTDCEHNTFGDFCEHCLPGYIGDAREGGANACTKCACP-LVENSFSDSCVAVDHGRGYVCNSCKPGYTGQYCETCVAGYYGDPQHIGGTCSPCDCHPDGS---LHGACNPLSGQCECKPGVTGRTCSMCQER 1683          

HSP 14 Score: 65.4698 bits (158), Expect = 4.913e-10
Identity = 46/137 (33.58%), Postives = 63/137 (45.99%), Query Frame = 3
Query: 2985 GKC-PCLPNVVGLQCDRCQDKFFNLSS-----QIGCLPCNCDYPIGALNHSC---------NQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSV-FKQCNRNNGVCRCKPGITGRNCDMCMKGT 3347
            G+C  C  N  G  C+RC+D ++  S      +  C  C CD P+G+++ +C          Q  G C C+ G  G+ C  C  G+   PT    C  C CN  GSV F  C+     C+CK  + G  CD C  GT
Sbjct:  385 GRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECD-PVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPT----CEPCPCNRAGSVNFDTCD--GASCQCKANVEGIYCDRCKAGT 514          

HSP 15 Score: 64.3142 bits (155), Expect = 1.101e-9
Identity = 70/237 (29.54%), Postives = 98/237 (41.35%), Query Frame = 3
Query: 1047 KCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQ--TCLKCHCDSLGTKFPSICIQEPELD----------LGLNAGHCI-CKENVEGNQCDKCKIGFWKFNG---NEETGCLKCNCVMMGTLEN---RGCDSS-----TGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKS 1685
            +C C  H+ SC  DPV  Q         C+ C+HNT  ++C RC   + +       +S    C +C C          C+ + ELD          +    G C+ C  N EG  C++CK G+++ +G     E  C  C C  +G++ +   R   S+      G C CK    G  C  C  GY N        C  C C+  GS +  TCD  S  C CK    GI CD  K+
Sbjct:  295 QCICYGHAESCPSDPVTGQFK-------CE-CRHNTCGESCNRCCPLFNQLPWKPGTNSHPNVCQQCQC----FNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPT-----CEPCPCNRAGSVNFDTCDGAS--CQCKANVEGIYCDRCKA 512          

HSP 16 Score: 62.3882 bits (150), Expect = 4.154e-9
Identity = 54/199 (27.14%), Postives = 81/199 (40.70%), Query Frame = 3
Query:  930 YGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCK 1526
            Y    CQ+   G + +K +++ N +     D         C C+ HS +C+ D             VC +C+HNT    CE C  GY  +       +  C KC C  +   F   C+    +D G       CK    G  C+ C  G++    +    C  C+C   G+L    C+  +G+C CK  VTG  CS C+
Sbjct: 1504 YTGLSCQNPEVGYYRKKHREYLNQA----DDIALIGWSEPCSCHGHSQTCNPDT-----------SVCTDCEHNTFGDFCEHCLPGYIGDAREG--GANACTKCACPLVENSFSDSCVA---VDHGRGYVCNSCKPGYTGQYCETCVAGYYGDPQHIGGTCSPCDCHPDGSLHG-ACNPLSGQCECKPGVTGRTCSMCQ 1681          

HSP 17 Score: 60.077 bits (144), Expect = 1.763e-8
Identity = 64/226 (28.32%), Postives = 93/226 (41.15%), Query Frame = 3
Query: 2658 TTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGT------CQPCRCSGNI-----DQRIEDSCNSKT--------GECRKCLFNTSGFNCEKCVSGYFGNGAVR-----TCTKCVCNHMGTNSKW-----QGICN-HETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDG-FWGDPTKLNGCTKCYC 3242
            T  F C C+    G+ C++C    F     K GT      CQ C+C  +      D  ++ +  S T        G C +C  NT GFNCE+C  GY+    +       C  C C+ +G+ S       Q   N  + G C C P   G +C+RC   + N  +   C PC C+        +C+  +  C C+A   G  C+ CK G      +   GC  C+C
Sbjct:  311 TGQFKCECRHNTCGESCNRC-CPLFNQLPWKPGTNSHPNVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPT---CEPCPCNRAGSVNFDTCDGAS--CQCKANVEGIYCDRCKAGTIHLSASNPLGCQPCFC 530          

HSP 18 Score: 58.151 bits (139), Expect = 8.345e-8
Identity = 66/253 (26.09%), Postives = 92/253 (36.36%), Query Frame = 3
Query: 2838 KCLFNTSGFNCEKCVSGY-------FG---------------------------NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCL---PN-----------------------------VVGLQCDRCQDKFFNLSSQIGCLPCNCDY---PIGALNHSCNQLTGQCY-CQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDC 3386
            +C  N +G +CE CV GY       +G                           N     C  C   H+G  S+   +   E  +CP L   PN                               G +C+ C D FF       C+ C C+    P+G  N  C+  TG+C  C    +G  C +CK+  WG+  +L+ C  C C+  G+V  QC+  NG C CK    G  CD C +        C +C DC
Sbjct:  742 ECPENFAGNSCESCVPGYRRVNNQLYGGRCEKCDCHGNSEECDPFTGECLNCRHNTTGSRCELCKPGHVGNPSRGGELGACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFEDPLTGKCIECTCNGNIDPMGIGN--CDSETGKCLKCIGHTTGDSCESCKEHHWGN-AQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGDVENGCPAC-DC 990          

HSP 19 Score: 52.7582 bits (125), Expect = 2.943e-6
Identity = 67/257 (26.07%), Postives = 94/257 (36.58%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECN---SHSSSCHFD-------------------PVVYQQSRK---------MSGGVCDN------CQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGL---NAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKC 1583
            G C+C+ N +G  CEKC D Y        +  S + C  C C+   S   SC+                     P  Y  + +           G VCD       C  NT  + CE C +      A   +    C  C C  +G+            D G+     G C CK    G +CD C  GF+ F   E  GC       +   + +   +  G+C CK  V G  C  C  G F+L ++N+ GC+ C C
Sbjct: 1054 GKCECRENVEGTMCEKCADGY-------FNITSGDGCEDCGCDPTGSEDVSCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQVCDPIDGSCVCPPNTVGEMCENCTTN-----AWDYHPLNGCKLCDCSDIGS------------DGGMCNTFTGQCKCKAAYVGLKCDLCTHGFFNFPTCEPCGCNAAGTDPLQCKDGQCLCNEIGECPCKKNVHGTKCDQCGEGTFSLDSSNLKGCTECFC 1286          

HSP 20 Score: 52.7582 bits (125), Expect = 3.395e-6
Identity = 56/177 (31.64%), Postives = 70/177 (39.55%), Query Frame = 3
Query:  861 CSCYGHASKCKAKEGQVQVKEMVYGVC-DCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCEC----NSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLN--AGHCICKENVEGNQCDKCK 1370
            CSC+GH+  C               VC DC+HNT G  CE C   Y       A +   N C KC C    NS S SC    V     R   G VC++C+     + CE C +GYY +     +   TC  C C   G+           L    N  +G C CK  V G  C  C+
Sbjct: 1540 CSCHGHSQTCNPDT----------SVCTDCEHNTFGDFCEHCLPGYIGD----AREGGANACTKCACPLVENSFSDSC----VAVDHGR---GYVCNSCKPGYTGQYCETCVAGYYGD---PQHIGGTCSPCDCHPDGS-----------LHGACNPLSGQCECKPGVTGRTCSMCQ 1681          

HSP 21 Score: 52.7582 bits (125), Expect = 3.423e-6
Identity = 48/167 (28.74%), Postives = 70/167 (41.92%), Query Frame = 3
Query: 2352 YNDTGKCL-CREGVEGQHCDTCKPGYWNFP--------FCHSCKCNQMSTTCDS------------KTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNT-TAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGN 2786
            Y   G+CL C    EG +C+ CK GY+            C +C+C+ + +  D+            K G C+ CK    G  C+ C  GY    +    C+ C C        N  G S+ F+T    +C CK    G +CD+C+      + S    CQPC C G+
Sbjct:  381 YEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCI-CKPGFGGRRCERCAPGYRNHPT----CEPCPC--------NRAG-SVNFDTCDGASCQCKANVEGIYCDRCKAGTIHLSASNPLGCQPCFCFGH 533          
BLAST of Netrin-4 vs. Ensembl Fly
Match: LanB1 (gene:FBgn0261800 transcript:FBtr0079490)

HSP 1 Score: 437.573 bits (1124), Expect = 4.585e-126
Identity = 230/546 (42.12%), Postives = 317/546 (58.06%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSK-----NPYQRFSSTHSHRIENVV--SRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE----MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEI 1736
            C ++ C P  G+LLIGRE+ L ASSTCGL + ER+C+++     +  KC +CD++     +PY+      +HRI  ++  ++   +   WWQS +G  N +I++  E+EF FT   + F T+RPAAMYIERS D+G+TW+ Y YF+ +C   FP +P     NI +V+CTS +S++ PS  G V+F     +    D Y    +N +  +TN+R+Q  +LH  GD  +D       KYYY IS  ++RG CSCYGHAS+C   +      +    MV+G C+C HNTKG +CE+C+DF+ND PW PA    TN C+KCECN H+ SCHFD  V+  S  +SGGVCDNC HNT  ++CE C   +YR+    I S + C  C CD  G+    IC    EL+ G  AG C CK  V G +C++CK G+W    +   GC  C C  +GTL N GC   TG+C CK +VTG DC+ C    + LS +   GCSLC C   GS DN  CD  SG+C C+    G  C + K  ++I  P  P  H  E+
Sbjct:   49 CERSSCYPATGNLLIGRENRLTASSTCGLHSPERFCILSHL---QDKKCFLCDTREETKHDPYK------NHRIGQIIYKTKPGTNIPTWWQSENGKENATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHIYRYFAYDCKESFPGVP-TVLENITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTDPYAEHVQNQLK-MTNLRIQMTKLHKLGDNLLDSRLENEEKYYYGISNMVVRGSCSCYGHASQCLPLDPAFSQADNEDGMVHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSES-PEGCSLCNCDAGGSYDN-YCDVISGQCRCRPHMTGRSCSQPKQNYFI--PLLPEVHEAEV 579          

HSP 2 Score: 376.326 bits (965), Expect = 6.218e-106
Identity = 256/830 (30.84%), Postives = 411/830 (49.52%), Query Frame = 3
Query: 2169 CKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRG--ILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFD---------KLHNSSGVFMSNV-KFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIID-FNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKS-LKNILNGASESKKIYQNITLIKDKLFYRNEELRNI--NLKFIRQKSKDMDNLINEMSKN--VITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKP--ESEYNTTIKLIDVTRGAIQSRR-IESVNLLIKIKTYL---------NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNI 4565
            C CN TGS +  C   GG CQC PNV G+ C++CA  +YGF   GCK C C+  GS +  C   TG+C C     G+ C+ C+PGYWNFP C  C+CN  + TCD   G C++C+ ++ GY+C +C +GYYG+   G  I C+ C+CP  ++S   ++ GCSL        C C++GYSG  C+ C  N FGN     GTC  C CS N+D     +C+ +TG C KCL+ T+G +CE C  G+FG+   + C +C C+ +GTN+     C+  TG+CPCLPNV G++CD+C +  + ++S  GC  CNCD PIGAL+  CN  TGQC C+ G  G+ CN C+  +WG+P +   C  C C+  G+   QC+R  G C C  GI G  C+ C +G  G+ P+CS CG+C+  WD  L  +++            K   ++G + S   +  K++  +   L+    SL +I+K   + Y+        + S  +      N+ D +N+   S + +E+  ++++ +   +K     G   +L++S ++  LN    + +   N++ +KD+    NE   N   N K +   S  +    ++++ N  +I        ++T   P + ++ CG  G   D C   +       G    F +        +T+    LK          + K+  D  ++   +++ N +       RG  QS R +   N  IK+   L         N +A   + + L +     ++  +  EI  L  QI   +  L NV  I+ ++K +  + +  +  A   KE    +L+S  ++
Sbjct:  789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGCKACDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPECRVCQCNGHAATCDPIQGTCIDCQDSTTGYSCDSCLDGYYGNPLFGSEIGCRPCRCPETVASGLAHADGCSLDTRNNNMLCHCQEGYSGSRCEICADNFFGNP-DNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTI-AHCDRFTGQCPCLPNVQGVRCDQCAENHWKIASGEGCESCNCD-PIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNE--KCQPCECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPCGECFNNWDLILSALEDATTATILRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEK---LDYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLVQQLSKELKENGI--QLQESNIEGALNLTRHAYERVSNLSTLKDEA---NELASNTDRNCKRVENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQVCGKPG---DPC--DSLCGGAGCGHCGGFLSCEHGA---KTHSEEALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQENKTASPSESKELAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVEAIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSV 1597          

HSP 3 Score: 107.071 bits (266), Expect = 1.105e-22
Identity = 79/248 (31.85%), Postives = 112/248 (45.16%), Query Frame = 3
Query:  936 VCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSR-KMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE 1676
            +C CQ    G  CE C D +  +P    D   T  C KCEC+++         +Y         G C  C + T   +CE CK G++ +        Q C +C CD LGT                  G C C  NV+G +CD+C    WK    E  GC  CNC  +G L  + C+S TG+C CK    G  C+ C+  Y+   N     C  C+C ++G+ D + CD+ +G C+C  G  G +C+E
Sbjct:  959 LCHCQEGYSGSRCEICADNFFGNP----DNGGT--CSKCECSNNVD-------LYDTGNCDRQTGACLKCLYQTTGDHCELCKDGFFGDAL-----QQNCQQCECDFLGTN-------NTIAHCDRFTGQCPCLPNVQGVRCDQCAENHWKIASGE--GCESCNCDPIGALHEQ-CNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEK---CQPCECDQFGAADFQ-CDRETGNCVCHEGIGGYKCNE 1174          

HSP 4 Score: 103.99 bits (258), Expect = 1.143e-21
Identity = 81/247 (32.79%), Postives = 119/247 (48.18%), Query Frame = 3
Query: 2673 CMCKKGYSGQFCDQCETNHFGNAIS-------KDGTCQPCRC-----SGNIDQRI-EDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNG-----AVRTCTKCVCNHMGTNSKWQGICNH--------ETGKCPCLPNVVGLQCDRCQDKFFNLSSQ--IGCLPCNCDYPIGALNHS-CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNC 3326
            C C     G  C++CE   F N +        K   C+ C C     S + D+ +   S     G C  CL NT G +CE+C+  ++ +      + R C  C C+  G++    GIC+           G C C   V G +C++C+D ++NL S    GC PC C+ P+G LN+S C   TG+C C+   +GK CN C    +G      GC+ C C+  GS    C+  +G CRC+P +TGR+C
Sbjct:  318 CECTHNTKGMNCEECED--FFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSD--DGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCN-PLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGSYDNYCDVISGQCRCRPHMTGRSC 559          

HSP 5 Score: 102.834 bits (255), Expect = 2.282e-21
Identity = 85/268 (31.72%), Postives = 123/268 (45.90%), Query Frame = 3
Query:  921 EMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCD---SLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETG--CLKCNCVMMGTLENRG-CDSSTGKCY-CKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDN-KTCDKYSGKCLCKNGFAGIRCDE-IKSEWYI 1697
            +++ G C C  NT G+ C +C+  Y + P          ECR C+CN H+++C  DP+          G C +CQ +T   +C+ C  GYY N      S   C  C C    + G      C     LD   N   C C+E   G++C+ C   F+   GN + G  C KC C     L + G CD  TG C  C    TG+ C  CK G+F   +A    C  C+C   G+ +    CD+++G+C C     G+RCD+  ++ W I
Sbjct:  850 DLITGQCQCVPNTYGRECNQCQPGYWNFP----------ECRVCQCNGHAATC--DPIQ---------GTCIDCQDSTTGYSCDSCLDGYYGN--PLFGSEIGCRPCRCPETVASGLAHADGC----SLDTRNNNMLCHCQEGYSGSRCEICADNFF---GNPDNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTTGDHCELCKDGFF--GDALQQNCQQCECDFLGTNNTIAHCDRFTGQCPCLPNVQGVRCDQCAENHWKI 1085          

HSP 6 Score: 84.7297 bits (208), Expect = 8.602e-16
Identity = 69/223 (30.94%), Postives = 100/223 (44.84%), Query Frame = 3
Query: 2826 GECRKCLFNTSGFNCEKCVSGY--------FGNGAVRTCTKCVCNHMGTNSKWQ------------GICNHETGKCPCLPNVVGLQCDRCQDKFF-----NLSSQIGCLPCNCDYPIGALNH----SCNQL-----TGQCYCQAGRSGKMCNNCKDGFWG-DPTKLNGCTKCYCNLDGSVFKQ-CNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDC 3386
            G C +C  NT G NCE+C   +        FG      C KC CN    +  +             G+C++      CL N  G  C+ C   F+     +++S+  C PC+CD P G+ +     S N+L      G C+C+A  +G+ CN CKDG+W        GC  C CN  G++    C    G C+CK  +TG++C+ CM  T G   +   C  C
Sbjct:  316 GRC-ECTHNTKGMNCEECEDFFNDLPWKPAFGK-KTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDN------CLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCD-PQGSSDDGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLC 529          

HSP 7 Score: 82.0333 bits (201), Expect = 4.487e-15
Identity = 76/264 (28.79%), Postives = 121/264 (45.83%), Query Frame = 3
Query: 2493 GKCLNCKGNSFGYNCQNCENGYYGDTS-------RGILCKKCQCPGLSSLKNNSIGCSL---IFNTTAFTCM-----CKKGYSGQFCDQCETNHFGNA---ISKDGTCQPCRC--SGNIDQRIEDSCN-----SKTGECRKCLFNTSGFNCEKCVSGYFG--NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLS-SQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFW 3200
            G+C  C  N+ G NC+ CE+ ++ D         +   CKKC+C       ++++ C     +F  + F        C     GQ C++C    + +    I+ +  CQPC C   G+ D  I DS N     +  G C  C    +G  C +C  GY+   +     C  C CN +GT +     C   TG+C C   V G  C++C  + + LS S  GC  CNCD   G+ ++ C+ ++GQC C+   +G+ C+  K  ++
Sbjct:  316 GRC-ECTHNTKGMNCEECED-FFNDLPWKPAFGKKTNACKKCEC------NDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLNELEEGAVAGACH-CKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNN--SGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAG-GSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567          

HSP 8 Score: 76.2554 bits (186), Expect = 2.810e-13
Identity = 65/260 (25.00%), Postives = 116/260 (44.62%), Query Frame = 3
Query: 2364 GKCLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTCD-----------SKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKN---NSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCS--GNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFG-NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFF 3050
            G+C C    +G +C+ C+  + + P+          C  C+CN  + +C               G C NC  N+ G +C+ C   +Y D  + I    +C+ C C    S  +   +S+   L     A  C CK   +G+ C+QC+  ++         C+PC C+  G ++      C  +TGEC KC    +G +C +C+   +G + +   C+ C C+  G+   +   C+  +G+C C P++ G  C + +  +F
Sbjct:  316 GRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLN-ELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNN---SGCVMRTGEC-KCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGS---YDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567          

HSP 9 Score: 73.559 bits (179), Expect = 1.887e-12
Identity = 46/129 (35.66%), Postives = 69/129 (53.49%), Query Frame = 3
Query: 1311 NAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCL-CKNGFAGIRCDEIKSEWY 1694
            N G+C CK NV G QCD+C  G + F G E  GC  C+C  +G+ +++ CD  TG+C C     G +C+ C+ GY+N        C +C+C+ + +    TCD   G C+ C++   G  CD     +Y
Sbjct:  804 NGGYCQCKPNVVGRQCDQCAPGTYGF-GPE--GCKACDCNSIGS-KDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPE-----CRVCQCNGHAA----TCDPIQGTCIDCQDSTTGYSCDSCLDGYY 919          

HSP 10 Score: 71.633 bits (174), Expect = 6.963e-12
Identity = 71/267 (26.59%), Postives = 112/267 (41.95%), Query Frame = 3
Query: 2214 IGGQCQCLPNVSGKTCERCAS--------ESYGFDARGCKKCKCD---LTGSLNSQCYNDTGKCL------CREGVEGQHCDTCKPGYWNFP--------FCHSCKCNQMSTT----CDS--------KTGKCLNCKGNSFGYNCQNCENGYY---GDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYF 2894
            + G+C+C  N  G  CE C           ++G     CKKC+C+   ++   +   +  +G         C     GQHC+ C P ++  P         C  C C+   ++    CDS          G C +CK    G  C  C++GY+    D   G  C+ C C  L +L N+  GC +        C CKK  +G+ C+QC    +G + S +G C  C C        ++ C+  +G+CR C  + +G +C +    YF
Sbjct:  314 VHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLNELEEGAVAGAC-HCKAFVTGRRCNQCKDGYWNLQSDNPEG--CEPCTCNPLGTLNNS--GCVM----RTGECKCKKYVTGKDCNQCMPETYGLSESPEG-CSLCNCDAG--GSYDNYCDVISGQCR-CRPHMTGRSCSQPKQNYF 567          

HSP 11 Score: 66.6254 bits (161), Expect = 2.787e-10
Identity = 59/209 (28.23%), Postives = 87/209 (41.63%), Query Frame = 3
Query:  933 GVC-DCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCECN---SHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNA--GHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYF 1538
            G C  C + T G HCE CKD F+ D+            C++CEC+   ++++  H D            G C  C  N +   C++C   +++     I S + C  C+CD +G            L    N+  G C CK    G  C++C+  +W   GN    C  C C   G  + + CD  TG C C   + G  C+ C  GY 
Sbjct: 1010 GACLKCLYQTTGDHCELCKDGFFGDA--------LQQNCQQCECDFLGTNNTIAHCDRFT---------GQCP-CLPNVQGVRCDQCAENHWK-----IASGEGCESCNCDPIGA-----------LHEQCNSYTGQCQCKPGFGGRACNQCQAHYW---GNPNEKCQPCECDQFGAADFQ-CDRETGNCVCHEGIGGYKCNECARGYI 1180          

HSP 12 Score: 59.3066 bits (142), Expect = 3.594e-8
Identity = 55/194 (28.35%), Postives = 79/194 (40.72%), Query Frame = 3
Query: 1122 GGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCY-CKSFVTGNDCSTCKIGYFN--LSNANINGCSLCKCSEYGSRDNKTCDKYSGK-------CLCKNGFAGIRCD 1673
            GG C  C+ N   + C++C  G Y          + C  C C+S+G+K         +    L  G C C  N  G +C++C+ G+W F       C  C C          CD   G C  C+   TG  C +C  GY+   L  + I GC  C+C E  +      D  S         C C+ G++G RC+
Sbjct:  805 GGYC-QCKPNVVGRQCDQCAPGTYG------FGPEGCKACDCNSIGSK---------DKYCDLITGQCQCVPNTYGRECNQCQPGYWNF-----PECRVCQCNGHAAT----CDPIQGTCIDCQDSTTGYSCDSCLDGYYGNPLFGSEI-GCRPCRCPETVASGLAHADGCSLDTRNNNMLCHCQEGYSGSRCE 972          

HSP 13 Score: 58.5362 bits (140), Expect = 6.161e-8
Identity = 34/90 (37.78%), Postives = 48/90 (53.33%), Query Frame = 3
Query: 2169 CKCNVTGSRNNN-CNKIGGQCQCLPNVSGKTCERCASESYGFD--ARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYW 2429
            C CN  G+ NN+ C    G+C+C   V+GK C +C  E+YG      GC  C CD  GS ++ C   +G+C CR  + G+ C   K  Y+
Sbjct:  478 CTCNPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567          
BLAST of Netrin-4 vs. Ensembl Fly
Match: LanB1 (gene:FBgn0261800 transcript:FBtr0079491)

HSP 1 Score: 437.573 bits (1124), Expect = 4.585e-126
Identity = 230/546 (42.12%), Postives = 317/546 (58.06%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSK-----NPYQRFSSTHSHRIENVV--SRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE----MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEI 1736
            C ++ C P  G+LLIGRE+ L ASSTCGL + ER+C+++     +  KC +CD++     +PY+      +HRI  ++  ++   +   WWQS +G  N +I++  E+EF FT   + F T+RPAAMYIERS D+G+TW+ Y YF+ +C   FP +P     NI +V+CTS +S++ PS  G V+F     +    D Y    +N +  +TN+R+Q  +LH  GD  +D       KYYY IS  ++RG CSCYGHAS+C   +      +    MV+G C+C HNTKG +CE+C+DF+ND PW PA    TN C+KCECN H+ SCHFD  V+  S  +SGGVCDNC HNT  ++CE C   +YR+    I S + C  C CD  G+    IC    EL+ G  AG C CK  V G +C++CK G+W    +   GC  C C  +GTL N GC   TG+C CK +VTG DC+ C    + LS +   GCSLC C   GS DN  CD  SG+C C+    G  C + K  ++I  P  P  H  E+
Sbjct:   49 CERSSCYPATGNLLIGRENRLTASSTCGLHSPERFCILSHL---QDKKCFLCDTREETKHDPYK------NHRIGQIIYKTKPGTNIPTWWQSENGKENATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHIYRYFAYDCKESFPGVP-TVLENITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTDPYAEHVQNQLK-MTNLRIQMTKLHKLGDNLLDSRLENEEKYYYGISNMVVRGSCSCYGHASQCLPLDPAFSQADNEDGMVHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSES-PEGCSLCNCDAGGSYDN-YCDVISGQCRCRPHMTGRSCSQPKQNYFI--PLLPEVHEAEV 579          

HSP 2 Score: 376.326 bits (965), Expect = 6.218e-106
Identity = 256/830 (30.84%), Postives = 411/830 (49.52%), Query Frame = 3
Query: 2169 CKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRG--ILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFD---------KLHNSSGVFMSNV-KFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIID-FNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKS-LKNILNGASESKKIYQNITLIKDKLFYRNEELRNI--NLKFIRQKSKDMDNLINEMSKN--VITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKP--ESEYNTTIKLIDVTRGAIQSRR-IESVNLLIKIKTYL---------NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNI 4565
            C CN TGS +  C   GG CQC PNV G+ C++CA  +YGF   GCK C C+  GS +  C   TG+C C     G+ C+ C+PGYWNFP C  C+CN  + TCD   G C++C+ ++ GY+C +C +GYYG+   G  I C+ C+CP  ++S   ++ GCSL        C C++GYSG  C+ C  N FGN     GTC  C CS N+D     +C+ +TG C KCL+ T+G +CE C  G+FG+   + C +C C+ +GTN+     C+  TG+CPCLPNV G++CD+C +  + ++S  GC  CNCD PIGAL+  CN  TGQC C+ G  G+ CN C+  +WG+P +   C  C C+  G+   QC+R  G C C  GI G  C+ C +G  G+ P+CS CG+C+  WD  L  +++            K   ++G + S   +  K++  +   L+    SL +I+K   + Y+        + S  +      N+ D +N+   S + +E+  ++++ +   +K     G   +L++S ++  LN    + +   N++ +KD+    NE   N   N K +   S  +    ++++ N  +I        ++T   P + ++ CG  G   D C   +       G    F +        +T+    LK          + K+  D  ++   +++ N +       RG  QS R +   N  IK+   L         N +A   + + L +     ++  +  EI  L  QI   +  L NV  I+ ++K +  + +  +  A   KE    +L+S  ++
Sbjct:  789 CNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGCKACDCNSIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPECRVCQCNGHAATCDPIQGTCIDCQDSTTGYSCDSCLDGYYGNPLFGSEIGCRPCRCPETVASGLAHADGCSLDTRNNNMLCHCQEGYSGSRCEICADNFFGNP-DNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTTGDHCELCKDGFFGDALQQNCQQCECDFLGTNNTI-AHCDRFTGQCPCLPNVQGVRCDQCAENHWKIASGEGCESCNCD-PIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNE--KCQPCECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPCGECFNNWDLILSALEDATTATILRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEK---LDYETQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLVQQLSKELKENGI--QLQESNIEGALNLTRHAYERVSNLSTLKDEA---NELASNTDRNCKRVENLSNKIQAEADDLANNNKLIEDYRAELTSLTSQIPELNNQVCGKPG---DPC--DSLCGGAGCGHCGGFLSCEHGA---KTHSEEALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIKLAENLFIALNNFQENKTASPSESKELAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVEAIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSV 1597          

HSP 3 Score: 107.071 bits (266), Expect = 1.105e-22
Identity = 79/248 (31.85%), Postives = 112/248 (45.16%), Query Frame = 3
Query:  936 VCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSR-KMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE 1676
            +C CQ    G  CE C D +  +P    D   T  C KCEC+++         +Y         G C  C + T   +CE CK G++ +        Q C +C CD LGT                  G C C  NV+G +CD+C    WK    E  GC  CNC  +G L  + C+S TG+C CK    G  C+ C+  Y+   N     C  C+C ++G+ D + CD+ +G C+C  G  G +C+E
Sbjct:  959 LCHCQEGYSGSRCEICADNFFGNP----DNGGT--CSKCECSNNVD-------LYDTGNCDRQTGACLKCLYQTTGDHCELCKDGFFGDAL-----QQNCQQCECDFLGTN-------NTIAHCDRFTGQCPCLPNVQGVRCDQCAENHWKIASGE--GCESCNCDPIGALHEQ-CNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEK---CQPCECDQFGAADFQ-CDRETGNCVCHEGIGGYKCNE 1174          

HSP 4 Score: 103.99 bits (258), Expect = 1.143e-21
Identity = 81/247 (32.79%), Postives = 119/247 (48.18%), Query Frame = 3
Query: 2673 CMCKKGYSGQFCDQCETNHFGNAIS-------KDGTCQPCRC-----SGNIDQRI-EDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNG-----AVRTCTKCVCNHMGTNSKWQGICNH--------ETGKCPCLPNVVGLQCDRCQDKFFNLSSQ--IGCLPCNCDYPIGALNHS-CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNC 3326
            C C     G  C++CE   F N +        K   C+ C C     S + D+ +   S     G C  CL NT G +CE+C+  ++ +      + R C  C C+  G++    GIC+           G C C   V G +C++C+D ++NL S    GC PC C+ P+G LN+S C   TG+C C+   +GK CN C    +G      GC+ C C+  GS    C+  +G CRC+P +TGR+C
Sbjct:  318 CECTHNTKGMNCEECED--FFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSD--DGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCN-PLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGSYDNYCDVISGQCRCRPHMTGRSC 559          

HSP 5 Score: 102.834 bits (255), Expect = 2.282e-21
Identity = 85/268 (31.72%), Postives = 123/268 (45.90%), Query Frame = 3
Query:  921 EMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCD---SLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETG--CLKCNCVMMGTLENRG-CDSSTGKCY-CKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDN-KTCDKYSGKCLCKNGFAGIRCDE-IKSEWYI 1697
            +++ G C C  NT G+ C +C+  Y + P          ECR C+CN H+++C  DP+          G C +CQ +T   +C+ C  GYY N      S   C  C C    + G      C     LD   N   C C+E   G++C+ C   F+   GN + G  C KC C     L + G CD  TG C  C    TG+ C  CK G+F   +A    C  C+C   G+ +    CD+++G+C C     G+RCD+  ++ W I
Sbjct:  850 DLITGQCQCVPNTYGRECNQCQPGYWNFP----------ECRVCQCNGHAATC--DPIQ---------GTCIDCQDSTTGYSCDSCLDGYYGN--PLFGSEIGCRPCRCPETVASGLAHADGC----SLDTRNNNMLCHCQEGYSGSRCEICADNFF---GNPDNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTTGDHCELCKDGFF--GDALQQNCQQCECDFLGTNNTIAHCDRFTGQCPCLPNVQGVRCDQCAENHWKI 1085          

HSP 6 Score: 84.7297 bits (208), Expect = 8.602e-16
Identity = 69/223 (30.94%), Postives = 100/223 (44.84%), Query Frame = 3
Query: 2826 GECRKCLFNTSGFNCEKCVSGY--------FGNGAVRTCTKCVCNHMGTNSKWQ------------GICNHETGKCPCLPNVVGLQCDRCQDKFF-----NLSSQIGCLPCNCDYPIGALNH----SCNQL-----TGQCYCQAGRSGKMCNNCKDGFWG-DPTKLNGCTKCYCNLDGSVFKQ-CNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDC 3386
            G C +C  NT G NCE+C   +        FG      C KC CN    +  +             G+C++      CL N  G  C+ C   F+     +++S+  C PC+CD P G+ +     S N+L      G C+C+A  +G+ CN CKDG+W        GC  C CN  G++    C    G C+CK  +TG++C+ CM  T G   +   C  C
Sbjct:  316 GRC-ECTHNTKGMNCEECEDFFNDLPWKPAFGK-KTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDN------CLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCD-PQGSSDDGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLC 529          

HSP 7 Score: 82.0333 bits (201), Expect = 4.487e-15
Identity = 76/264 (28.79%), Postives = 121/264 (45.83%), Query Frame = 3
Query: 2493 GKCLNCKGNSFGYNCQNCENGYYGDTS-------RGILCKKCQCPGLSSLKNNSIGCSL---IFNTTAFTCM-----CKKGYSGQFCDQCETNHFGNA---ISKDGTCQPCRC--SGNIDQRIEDSCN-----SKTGECRKCLFNTSGFNCEKCVSGYFG--NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLS-SQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFW 3200
            G+C  C  N+ G NC+ CE+ ++ D         +   CKKC+C       ++++ C     +F  + F        C     GQ C++C    + +    I+ +  CQPC C   G+ D  I DS N     +  G C  C    +G  C +C  GY+   +     C  C CN +GT +     C   TG+C C   V G  C++C  + + LS S  GC  CNCD   G+ ++ C+ ++GQC C+   +G+ C+  K  ++
Sbjct:  316 GRC-ECTHNTKGMNCEECED-FFNDLPWKPAFGKKTNACKKCEC------NDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLNELEEGAVAGACH-CKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNN--SGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAG-GSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567          

HSP 8 Score: 76.2554 bits (186), Expect = 2.810e-13
Identity = 65/260 (25.00%), Postives = 116/260 (44.62%), Query Frame = 3
Query: 2364 GKCLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTCD-----------SKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKN---NSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCS--GNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFG-NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFF 3050
            G+C C    +G +C+ C+  + + P+          C  C+CN  + +C               G C NC  N+ G +C+ C   +Y D  + I    +C+ C C    S  +   +S+   L     A  C CK   +G+ C+QC+  ++         C+PC C+  G ++      C  +TGEC KC    +G +C +C+   +G + +   C+ C C+  G+   +   C+  +G+C C P++ G  C + +  +F
Sbjct:  316 GRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLN-ELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTCNPLGTLNN---SGCVMRTGEC-KCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGS---YDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567          

HSP 9 Score: 73.559 bits (179), Expect = 1.887e-12
Identity = 46/129 (35.66%), Postives = 69/129 (53.49%), Query Frame = 3
Query: 1311 NAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCL-CKNGFAGIRCDEIKSEWY 1694
            N G+C CK NV G QCD+C  G + F G E  GC  C+C  +G+ +++ CD  TG+C C     G +C+ C+ GY+N        C +C+C+ + +    TCD   G C+ C++   G  CD     +Y
Sbjct:  804 NGGYCQCKPNVVGRQCDQCAPGTYGF-GPE--GCKACDCNSIGS-KDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPE-----CRVCQCNGHAA----TCDPIQGTCIDCQDSTTGYSCDSCLDGYY 919          

HSP 10 Score: 71.633 bits (174), Expect = 6.963e-12
Identity = 71/267 (26.59%), Postives = 112/267 (41.95%), Query Frame = 3
Query: 2214 IGGQCQCLPNVSGKTCERCAS--------ESYGFDARGCKKCKCD---LTGSLNSQCYNDTGKCL------CREGVEGQHCDTCKPGYWNFP--------FCHSCKCNQMSTT----CDS--------KTGKCLNCKGNSFGYNCQNCENGYY---GDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYF 2894
            + G+C+C  N  G  CE C           ++G     CKKC+C+   ++   +   +  +G         C     GQHC+ C P ++  P         C  C C+   ++    CDS          G C +CK    G  C  C++GY+    D   G  C+ C C  L +L N+  GC +        C CKK  +G+ C+QC    +G + S +G C  C C        ++ C+  +G+CR C  + +G +C +    YF
Sbjct:  314 VHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDHAVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDCDPQGSSDDGICDSLNELEEGAVAGAC-HCKAFVTGRRCNQCKDGYWNLQSDNPEG--CEPCTCNPLGTLNNS--GCVM----RTGECKCKKYVTGKDCNQCMPETYGLSESPEG-CSLCNCDAG--GSYDNYCDVISGQCR-CRPHMTGRSCSQPKQNYF 567          

HSP 11 Score: 66.6254 bits (161), Expect = 2.787e-10
Identity = 59/209 (28.23%), Postives = 87/209 (41.63%), Query Frame = 3
Query:  933 GVC-DCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCECN---SHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNA--GHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYF 1538
            G C  C + T G HCE CKD F+ D+            C++CEC+   ++++  H D            G C  C  N +   C++C   +++     I S + C  C+CD +G            L    N+  G C CK    G  C++C+  +W   GN    C  C C   G  + + CD  TG C C   + G  C+ C  GY 
Sbjct: 1010 GACLKCLYQTTGDHCELCKDGFFGDA--------LQQNCQQCECDFLGTNNTIAHCDRFT---------GQCP-CLPNVQGVRCDQCAENHWK-----IASGEGCESCNCDPIGA-----------LHEQCNSYTGQCQCKPGFGGRACNQCQAHYW---GNPNEKCQPCECDQFGAADFQ-CDRETGNCVCHEGIGGYKCNECARGYI 1180          

HSP 12 Score: 59.3066 bits (142), Expect = 3.594e-8
Identity = 55/194 (28.35%), Postives = 79/194 (40.72%), Query Frame = 3
Query: 1122 GGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCY-CKSFVTGNDCSTCKIGYFN--LSNANINGCSLCKCSEYGSRDNKTCDKYSGK-------CLCKNGFAGIRCD 1673
            GG C  C+ N   + C++C  G Y          + C  C C+S+G+K         +    L  G C C  N  G +C++C+ G+W F       C  C C          CD   G C  C+   TG  C +C  GY+   L  + I GC  C+C E  +      D  S         C C+ G++G RC+
Sbjct:  805 GGYC-QCKPNVVGRQCDQCAPGTYG------FGPEGCKACDCNSIGSK---------DKYCDLITGQCQCVPNTYGRECNQCQPGYWNF-----PECRVCQCNGHAAT----CDPIQGTCIDCQDSTTGYSCDSCLDGYYGNPLFGSEI-GCRPCRCPETVASGLAHADGCSLDTRNNNMLCHCQEGYSGSRCE 972          

HSP 13 Score: 58.5362 bits (140), Expect = 6.161e-8
Identity = 34/90 (37.78%), Postives = 48/90 (53.33%), Query Frame = 3
Query: 2169 CKCNVTGSRNNN-CNKIGGQCQCLPNVSGKTCERCASESYGFD--ARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYW 2429
            C CN  G+ NN+ C    G+C+C   V+GK C +C  E+YG      GC  C CD  GS ++ C   +G+C CR  + G+ C   K  Y+
Sbjct:  478 CTCNPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGSYDNYCDVISGQCRCRPHMTGRSCSQPKQNYF 567          
BLAST of Netrin-4 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0345031)

HSP 1 Score: 347.051 bits (889), Expect = 8.460e-97
Identity = 343/1322 (25.95%), Postives = 553/1322 (41.83%), Query Frame = 3
Query:  192 LRASSTCGLTNSERYCVVTTSDSGRKSKCTIC--DSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQS---MSGVHN---VSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPE----RKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNA-GHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENR-GCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQ-FFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEK-----DLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARG-----CKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF------CHSCKC--NQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL-----CKKCQCPGLSSLKNNSIG-CSLIFNTTAFTCM-CKKGYSGQFCDQCETNHFGNAIS-KDGTCQPCRCSGNIDQRIEDS---CNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNL--------DGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSS-----CGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEI----KKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRN---INLKFIRQK-------SKDMDNLINEMSKNVITF 3944
            + +++TCG  N   +C+ T + + +   C  C  +  NP    +  H           PQ P  WWQS     G+ +   V++ +     +  T+  + F++ RP +  I +       W  Y ++S  C RD  S+P+    RK       LCTSE+S I P   G + FS         +   + +  +    T+IR+   RL+TFGD    D+  +++ Y+YAIS+  +  RC C GHASKC    G    + +V   C+C+HNT G  C++C   YND  W  +     NEC+ C CN  +  C FD  ++  +R   GG C +C+ N +  NCERCK  +Y      +     C+ C CD +G++            L  N+ G C CK  V G++CD+C   +++F  +   GC +C C   G+ +N   CD+ TG C+CK  V G  C+ CK G+FNL   N  GC+ C C  YG         ++ +C+   G++ +    + S +   K  +    L + +++   +  + Y   + TT   N   +F +    L       +    ++  +QL+       + +  LE       LPI      I        +             S   R  L      +NL + K    + A  S       D ++ +    G+  +    I  QC C     G+ CE CA       ARG     C  C C     +   C ++TG+C+C+    G +CD C  G++          C  C C  +      +  T  C  C    FG  C+ C +G++GD + G+L     CK C C G  ++  N++G C    N T   C+ C    +G+ CDQC + HFG+ ++   G C  C C     ++ E S   C+  TG+C +C  N  G +C +C  GYF   +   C  C+C+ +G+   +   C+  +G+C C P V+G +CD+C++ F+  SS+ GC PC CD   G+    C+Q  GQC C     G+ C+ CK+  +        C  CY NL           +F      + + R  P       +  +K    K+   +       GD    +   +  +    D +       +S  KF  + +       QN   L +I    KK      D++    ++ L+R K        ++F  Q   I  I      A+A+  K +        +E +  LKN  +     +K +Q      D       ELR+   + L  ++Q        SK+     NE+    +T 
Sbjct:   80 IESTNTCGEQNDNHFCIQTMNQNHKN--CEFCKYNDHNP-SFLTDLHD----------PQSP-TWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATC-RDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEGRPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKS-YFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLV---CECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLF--NRTGHGGHCLDCRENRDGPNCERCKENFY------MRDDGYCVNCACDPVGSR-----------SLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPH---GCQQCGCDSGGSHQNTPACDTETGICFCKENVEGRRCNECKPGFFNLDKNNRFGCTPCFC--YG---------HTSECMTAPGYSIV---SVTSNFNKFKERWTAADLNQREVD---IKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFK--LQLVGQVANTGVSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSARGFLS---ILSNLTAIK----IRATYSVQGEAILDDVELQTAHRGAAGHPATWI-EQCTCPEGYLGQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADI---CDSETGRCICQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPT-GLLGEVQTCKSCDCNG--NVDPNAVGNC----NRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQC-QCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGS---YNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSE-GCKPCECDES-GSKGFQCDQ-NGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCY-NLVQDAADLHRAKLFNLSQTLDEIAR-TPVTNDDEFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREH---LVSADKFQADANGEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAK-----EKSVEFGQQSEQISDISRE---ARALADKLE--------SEAQFDLKNAKDAKDAVEKAHQLAKSAIDLQLKIGTELRSEVGLELSHVKQSLGTVVQTSKEALRKANEVYDTALTL 1295          

HSP 2 Score: 238.039 bits (606), Expect = 1.132e-62
Identity = 183/622 (29.42%), Postives = 282/622 (45.34%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNFPF-------CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDG---TCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRT---CTKCVCNHMGTNSKWQGI--CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFD----KLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIG-----------YDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASE-SKKIYQNITLIKD------KLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLD 4115
            +C C EG  GQ C++C PGY + P        C  C C+  +  CDS+TG+C+ C+ N+ G NC  C  G+YG+   G    CK+C CP       N   C  I   T     C KGY G  C+QC    FG+     G   TC+ C C+GN+D     +CN  TGEC KC+ NT+G +C++C+SG+FG+        C +C C   GT    Q I  C+  TG+C C PNV+G  C  CQ  +FN+ S  GC  C CD P+G+ N +C++ +GQC+C+ G  G+ C+ C++ F+G  ++  GC  C C+  GS   QC++ NG C C   + GR CD C +    +   C  C DC+        +V++  D    KL N S       + P   DD     E  +K+++E                   Y  +I +  + L  ++ ++ +++   F    N  I            I++N  +++  A + L       L  A E S +  Q    I D       L  + E     +LK  +  +KD     ++++K+ I         +     L  S     +G            +K  + K+N+ ++   +LL D
Sbjct:  709 QCTCPEGYLGQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCI-CQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCP-------NDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCD-PVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSE--GCKPCECDESGSKGFQCDQ-NGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCY-------NLVQDAADLHRAKLFNLSQTLDEIARTPVTNDD---EFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREHLVSAD--KFQADANGEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAKEKSVEFGQQSEQISDISREARALADKLESEAQFDLKNAKD-AKDAVEKAHQLAKSAIDLQLKIGTELRSEVGLELSHVKQSLGTV-------VQTSKEALRKANEVYDTALTLLND 1298          
BLAST of Netrin-4 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0076382)

HSP 1 Score: 347.051 bits (889), Expect = 8.460e-97
Identity = 343/1322 (25.95%), Postives = 553/1322 (41.83%), Query Frame = 3
Query:  192 LRASSTCGLTNSERYCVVTTSDSGRKSKCTIC--DSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQS---MSGVHN---VSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPE----RKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNA-GHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENR-GCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQ-FFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEK-----DLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARG-----CKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF------CHSCKC--NQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL-----CKKCQCPGLSSLKNNSIG-CSLIFNTTAFTCM-CKKGYSGQFCDQCETNHFGNAIS-KDGTCQPCRCSGNIDQRIEDS---CNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNL--------DGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSS-----CGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEI----KKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRN---INLKFIRQK-------SKDMDNLINEMSKNVITF 3944
            + +++TCG  N   +C+ T + + +   C  C  +  NP    +  H           PQ P  WWQS     G+ +   V++ +     +  T+  + F++ RP +  I +       W  Y ++S  C RD  S+P+    RK       LCTSE+S I P   G + FS         +   + +  +    T+IR+   RL+TFGD    D+  +++ Y+YAIS+  +  RC C GHASKC    G    + +V   C+C+HNT G  C++C   YND  W  +     NEC+ C CN  +  C FD  ++  +R   GG C +C+ N +  NCERCK  +Y      +     C+ C CD +G++            L  N+ G C CK  V G++CD+C   +++F  +   GC +C C   G+ +N   CD+ TG C+CK  V G  C+ CK G+FNL   N  GC+ C C  YG         ++ +C+   G++ +    + S +   K  +    L + +++   +  + Y   + TT   N   +F +    L       +    ++  +QL+       + +  LE       LPI      I        +             S   R  L      +NL + K    + A  S       D ++ +    G+  +    I  QC C     G+ CE CA       ARG     C  C C     +   C ++TG+C+C+    G +CD C  G++          C  C C  +      +  T  C  C    FG  C+ C +G++GD + G+L     CK C C G  ++  N++G C    N T   C+ C    +G+ CDQC + HFG+ ++   G C  C C     ++ E S   C+  TG+C +C  N  G +C +C  GYF   +   C  C+C+ +G+   +   C+  +G+C C P V+G +CD+C++ F+  SS+ GC PC CD   G+    C+Q  GQC C     G+ C+ CK+  +        C  CY NL           +F      + + R  P       +  +K    K+   +       GD    +   +  +    D +       +S  KF  + +       QN   L +I    KK      D++    ++ L+R K        ++F  Q   I  I      A+A+  K +        +E +  LKN  +     +K +Q      D       ELR+   + L  ++Q        SK+     NE+    +T 
Sbjct:   80 IESTNTCGEQNDNHFCIQTMNQNHKN--CEFCKYNDHNP-SFLTDLHD----------PQSP-TWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATC-RDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEGRPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKS-YFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLV---CECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLF--NRTGHGGHCLDCRENRDGPNCERCKENFY------MRDDGYCVNCACDPVGSR-----------SLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPH---GCQQCGCDSGGSHQNTPACDTETGICFCKENVEGRRCNECKPGFFNLDKNNRFGCTPCFC--YG---------HTSECMTAPGYSIV---SVTSNFNKFKERWTAADLNQREVD---IKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFK--LQLVGQVANTGVSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSARGFLS---ILSNLTAIK----IRATYSVQGEAILDDVELQTAHRGAAGHPATWI-EQCTCPEGYLGQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADI---CDSETGRCICQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPT-GLLGEVQTCKSCDCNG--NVDPNAVGNC----NRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQC-QCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGS---YNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSE-GCKPCECDES-GSKGFQCDQ-NGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCY-NLVQDAADLHRAKLFNLSQTLDEIAR-TPVTNDDEFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREH---LVSADKFQADANGEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAK-----EKSVEFGQQSEQISDISRE---ARALADKLE--------SEAQFDLKNAKDAKDAVEKAHQLAKSAIDLQLKIGTELRSEVGLELSHVKQSLGTVVQTSKEALRKANEVYDTALTL 1295          

HSP 2 Score: 238.039 bits (606), Expect = 1.132e-62
Identity = 183/622 (29.42%), Postives = 282/622 (45.34%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNFPF-------CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDG---TCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRT---CTKCVCNHMGTNSKWQGI--CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFD----KLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIG-----------YDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASE-SKKIYQNITLIKD------KLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLD 4115
            +C C EG  GQ C++C PGY + P        C  C C+  +  CDS+TG+C+ C+ N+ G NC  C  G+YG+   G    CK+C CP       N   C  I   T     C KGY G  C+QC    FG+     G   TC+ C C+GN+D     +CN  TGEC KC+ NT+G +C++C+SG+FG+        C +C C   GT    Q I  C+  TG+C C PNV+G  C  CQ  +FN+ S  GC  C CD P+G+ N +C++ +GQC+C+ G  G+ C+ C++ F+G  ++  GC  C C+  GS   QC++ NG C C   + GR CD C +    +   C  C DC+        +V++  D    KL N S       + P   DD     E  +K+++E                   Y  +I +  + L  ++ ++ +++   F    N  I            I++N  +++  A + L       L  A E S +  Q    I D       L  + E     +LK  +  +KD     ++++K+ I         +     L  S     +G            +K  + K+N+ ++   +LL D
Sbjct:  709 QCTCPEGYLGQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCI-CQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCP-------NDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCD-PVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSE--GCKPCECDESGSKGFQCDQ-NGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCY-------NLVQDAADLHRAKLFNLSQTLDEIARTPVTNDD---EFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREHLVSAD--KFQADANGEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAKEKSVEFGQQSEQISDISREARALADKLESEAQFDLKNAKD-AKDAVEKAHQLAKSAIDLQLKIGTELRSEVGLELSHVKQSLGTV-------VQTSKEALRKANEVYDTALTLLND 1298          
BLAST of Netrin-4 vs. Ensembl Fly
Match: wb (gene:FBgn0261563 transcript:FBtr0302731)

HSP 1 Score: 265.388 bits (677), Expect = 9.658e-71
Identity = 318/1270 (25.04%), Postives = 498/1270 (39.21%), Query Frame = 3
Query:  192 LRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR--WWQSMS-----GVHNVSIEISFESEFQFTFTHLR-FKTYRPAAMYIERSKDYGRTWNKYAYF--SD-NCPRDFPSIPERKR---SNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITN--IRVQFVRLHTFG------DWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLG---LNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLI---------KDSRYIVIPNKCL--EKDLPIVLTVFTIESN--NKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRN----NNCNKIGGQC-----QCL--PNVSGKTCERCASESYGF--------DARGCKKC-KCDLTGSLNSQCYNDTGKCL-CREGVEGQHCDTCKPGYWNFPF------CHSCKC------NQMSTTCDSKTGK-----------------CLNCKGNSFGYNCQNCENGYYGDTSR-GILCKKCQCPG--------------------------LSSLKNNSIGC-----------SLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVR-----------------------------------TCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGF----------------------------------------------WGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCG 3380
            +  ++TCG   +E YC    +       C IC++ +  +    +    I +         F   WWQS +         V+I +  +  FQ     L+   + RPA+  +E+S D G  +  + YF  SD +C R +    +  +    N  E++C+++FS   P E G +      S   N     ++    +  IT   IR++   +H+        DW +D +P++    +Y++S+  +  R  C GHA++         ++      C CQHNT G  CE+C   + D P+         EC  C+C  H+ SC +DP        +  G+C +C +NT    CE C+ G+YR +   +  +  CL C C+             P    G    + G C C E  +G  C++C  G++   G++   C +C C   G+L + G  S +G C CK  V G+ CS C  GYF+LS  N  GC+ C CS      ++TC     + L           E  ++W I      ++ +K I I  P  +++    F    D     ++ +     S+ ++G +   SY   +QL+         +  +    PN  L  +  L I     +++    N                V   KTR    E  +Y    S  +  FL+  +S + V            T        +   ++GG+      QCL     +G +CE CA   +GF        D +   KC  C   G  NS C   +G C  C     G  C+ C+ GY+  P       C  C C      N  S +C  K+                   C  C     G +CQ C++GY+G+  + G  C++C C G                          L    + ++GC           S + ++T   C+CK  Y+GQ CD+C+  +    +     C  C C   +   ++D C+  TG+C  C     G  C +C  GYFG  AV                                     C +C C+ +G+ S     C+  TG+C CL NV G +CD+C+   +NL++  GC  C CD P G+  H CN  TGQC C+ G  G+ CN C +GF                                              WG   +L GC +C C+  GS+ +QC+  +G C+C+ G +GR CD C  G  G  P C  CG
Sbjct:  166 ISVNATCGQNGAEEYCKQVGA-----KPCGICNAHSSDRAKQRSIQSLISSGSGSGSGSGFEEGWWQSPTLQGGRQFEYVTILLDLKQTFQIFSVWLKSANSPRPASWILEKSLD-GINFEPWQYFGLSDADCQRRWNLSGQNGKYVFQNDTEIICSTQFSKPGPLENGVL----HASLLKNRPGATDQSPELMKFITTRYIRIRLQGMHSTANQDNSLDWLLD-SPSLEKHSFYSLSQLKVSARLDCNGHANRSHESPDDPLMQ------CICQHNTCGAQCEQCCPLFQDRPY-----QMGGECEICQCYGHAESCTYDPF-------LDKGICQSCSNNTAGIECEFCEMGFYRELDAPL--TDPCLPCSCN-------------PARSTGGCQSDGGSCNCLEGFQGKNCEECAPGYY---GDD---CKRCECDERGSLGSTG--SCSGVCQCKLNVEGSTCSECAPGYFDLSAENAEGCTSCWCSGV----SQTCHSAKLQTLAF---------ETLNDWKITD----IQRVKPISI--PVDAETNRLIFANELDEVEAIYWQA-----SLGYLG-NRLTSYGSRLQLVLSWDVIRGDRSGKPTTGPNVILVGKNGLKIAFGDESLDGLGINLNVTLTEVGWYHVPPTVVDIKTRLRRTEGGDYHG-ESVTRSQFLSVLVSLDAVLIRAAFHTDQGETSLERAVIYSGGVELGGKSSSQVEQCLCPAGYTGLSCEGCA---FGFKRIYENTSDHQILSKCIPCPCNGHSNS-CDLQSGNCGDCMHNTFGDRCERCQLGYYGNPLQGTPNDCKRCACPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAEYICTQCPEGYTGDHCQVCDDGYFGNPRQPGSSCQRCDCAGGPCNVTTGECITCRGNTEGWHCERCKLGYWGDPAVGCDPCHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELR----CPSCNCD-PLGSLVQDRCDPHTGQCH-CKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEECHCSSVGSLSS---DCDKRTGQCACLANVTGRRCDKCRPGHWNLTAGEGCRDCRCD-PHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPHNGRCICPKFTRGLGCGQCVPGTWGWQARL-GCRECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFG-YPECRRCG 1341          

HSP 2 Score: 171.014 bits (432), Expect = 4.844e-42
Identity = 131/429 (30.54%), Postives = 193/429 (44.99%), Query Frame = 3
Query: 2205 CNKIGGQC-QCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF-CHSCKCNQMSTT----CDSKTGKCLNCKGNSFGYNCQNCENGYYG----------------------------------DTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKC-VCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCN-----RNNGVCRCKPGITGRNCDMCMKGTDG 3353
            CN   G+C  C  N  G  CERC    +G  A GC  C C   GS +  C +  G+CLC+    GQ CD C  GY N    C SC C+ + +     CD  TG+C +CK    G  C  C++GY+G                                  ++   + C++C C  + SL ++        +     C C    +G+ CD+C   H+ N  + +G C+ CRC  +  +  E  CN  TG+C  C     G +C +C  G+FG  +   C +C  C   G       +C+   G+C C     GL C +C    +   +++GC  C CD+ IG++   C+   GQC C+ G SG+ C+ C  G++G P     C +C C+ +GS F Q +      +NG C CK  + G  CD CM+ T G
Sbjct:  981 CNVTTGECITCRGNTEGWHCERCKLGYWGDPAVGCDPCHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELRCPSCNCDPLGSLVQDRCDPHTGQC-HCKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEECHCSSVGSLSSDC-------DKRTGQCACLANVTGRRCDKCRPGHW-NLTAGEG-CRDCRCDPHGSRGHE--CNPWTGQC-DCKIGVGGQHCNECTEGFFGF-STEGCQRCSACRSEGQ------VCDPHNGRCICPKFTRGLGCGQCVPGTWGWQARLGCRECECDH-IGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPE----CRRCGCDAEGS-FTQADGSIACDSNGQCPCKSLVVGLKCDTCMQSTFG 1383          

HSP 3 Score: 130.568 bits (327), Expect = 1.001e-29
Identity = 115/409 (28.12%), Postives = 163/409 (39.85%), Query Frame = 3
Query: 2157 DPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSL-NSQCYNDTGKCLCREGVEGQHCDTCKPGYWNF-----------------------------------------PFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLT----GQCYCQAGRSGKMCNNCKDGFWGDPTK-LNGCTKCYC 3242
            DP  C C+  GS +  C+   GQC C P  +G+ C+ C       + R C  C CD  GSL   +C   TG+C C+EGV G  C  C+ GY+                                             CH      +S+ CD +TG+C  C  N  G  C  C  G++  T+ G  C+ C+C    S  +         N     C CK G  GQ C++C    FG +      C  CR  G +       C+   G C  C   T G  C +CV G +G  A   C +C C+H+G+  +    C+   G+C C     G +CD C   +F       C  C CD   G+   +   +     GQC C++   G  C+ C    +G   +   GCT+C+C
Sbjct: 1016 DP--CHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELR-CPSCNCDPLGSLVQDRCDPHTGQCHCKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEECHCSSVGSLSSDCDKRTGQCA-CLANVTGRRCDKCRPGHWNLTA-GEGCRDCRCDPHGSRGHEC-------NPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQV-------CDPHNGRC-ICPKFTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQ---CSTGDGQCQCREGYSGRKCDTCAIGYFGYPE---CRRCGCDAE-GSFTQADGSIACDSNGQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFC 1397          

HSP 4 Score: 95.1301 bits (235), Expect = 5.465e-19
Identity = 53/144 (36.81%), Postives = 83/144 (57.64%), Query Frame = 3
Query: 2451 CKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAIS-KDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKC 2879
            C CN  S+ CD +TG C NC+GN+ G +C  C  G+YGD +    C+ C CP   + +N + GC++       +C+CK GY+G+ C++C+  +FG+ +   + TCQPC C  + D    + C+ +TG C  C    +G  C+KC
Sbjct: 1670 CHCNGRSSDCDRETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCP--ETNRNFARGCNVW--DGEVSCVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNC--HPDGIQTEGCDVETGRC-YCREGVTGLKCDKC 1806          

HSP 5 Score: 88.1965 bits (217), Expect = 8.480e-17
Identity = 65/214 (30.37%), Postives = 91/214 (42.52%), Query Frame = 3
Query: 2169 CKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKC-KCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF---CHSCKCNQMSTT---CDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSL--KNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSG 2783
            C+C+  GSR + CN   GQC C   V G+ C  C    +GF   GC++C  C   G +   C    G+C+C +   G  C  C PG W +     C  C+C+ + +    C +  G+C  C+    G  C  C  GY+G       C++C C    S    + SI C      +   C CK    G  CD C  + FG +      C  C C G
Sbjct: 1199 CRCDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQV---CDPHNGRCICPKFTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQCSTGDGQC-QCREGYSGRKCDTCAIGYFGYPE----CRRCGCDAEGSFTQADGSIACD-----SNGQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFCFG 1399          

HSP 6 Score: 85.5001 bits (210), Expect = 5.345e-16
Identity = 55/158 (34.81%), Postives = 78/158 (49.37%), Query Frame = 3
Query: 2172 KCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDAR-GCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQM--------STTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL-CKKCQCPGLS 2615
            +C+   S    C+   G+C C     G  C +C   ++G+ AR GC++C+CD  GS+  QC    G+C CREG  G+ CDTC  GY+ +P C  C C+          S  CDS  G+C  CK    G  C  C    +G +++    C +C C G S
Sbjct: 1246 RCSACRSEGQVCDPHNGRCICPKFTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPECRRCGCDAEGSFTQADGSIACDS-NGQC-PCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFCFGRS 1401          

HSP 7 Score: 77.411 bits (189), Expect = 1.261e-13
Identity = 58/197 (29.44%), Postives = 88/197 (44.67%), Query Frame = 3
Query: 2880 VSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCP-CLPNVVGLQCDRCQDKFF-NLSSQIGCLPCNCDYPIGALNHSCNQLTGQ--CYCQAGRSGKMCNNCKDGFWGDPTKL--NGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPN-CSSCGDCWLQWDHFLIVVKNTFDK-LHN 3446
            V   F    +     C CN   ++      C+ ETG C  C  N  G  C +C + F+ + +S  GC  C C          CN   G+  C C+ G +G++C  C+ G++GDP +     C  C C+ DG   + C+   G C C+ G+TG  CD C       + N C  C +C L    ++ +V N   + +HN
Sbjct: 1655 VESVFIEDLIGRAAPCHCNGRSSD------CDRETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDGEVSCVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRCYCREGVTGLKCDKCQAERHHLVDNGCKICDNCTLLLLDYMELVGNKLRRGMHN 1845          

HSP 8 Score: 76.2554 bits (186), Expect = 2.973e-13
Identity = 68/251 (27.09%), Postives = 103/251 (41.04%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHF-DPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGS---RDNKTCDKYSGKCLCKNGFAGIRCD 1673
            G C C  N  G+ C+KC+  +    W   +  +   CR C C+ H S  H  +P           G CD C+     ++C  C  G++     +    Q C  C  +        +C  +P      + G CIC +   G  C +C  G W +      GC +C C  +G++  + C +  G+C C+   +G  C TC IGYF         C  C C   GS    D       +G+C CK+   G++CD
Sbjct: 1167 GQCACLANVTGRRCDKCRPGH----W---NLTAGEGCRDCRCDPHGSRGHECNPWT---------GQCD-CKIGVGGQHCNECTEGFF---GFSTEGCQRCSACRSEG------QVC--DP------HNGRCICPKFTRGLGCGQCVPGTWGWQA--RLGCRECECDHIGSIGQQ-CSTGDGQCQCREGYSGRKCDTCAIGYFGYPE-----CRRCGCDAEGSFTQADGSIACDSNGQCPCKSLVVGLKCD 1375          

HSP 9 Score: 75.8702 bits (185), Expect = 4.564e-13
Identity = 98/414 (23.67%), Postives = 151/414 (36.47%), Query Frame = 3
Query:  390 MSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGR-------TWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDI-TAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCE-KCKDFYN-------DSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSIC-IQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGN-EETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLC 1577
            +S V   +  +S  +  QF +  L F+   P   Y +R+  YG        T   +     N    +P +     S +  +L   E+     S   T       S W  +       RN +  A+ NIR  F+R   F D++     N+                     H       +G   +       C C     G  C+   + FY        +S ++   ++       C CN  SS C  +            GVC NC+ NT   +C +C  G+Y +     NS   C  C C      F   C + + E+        C+CK    G  C++C+ G++        T C  CNC   G ++  GCD  TG+CYC+  VTG  C  C+    +L +   NGC +C
Sbjct: 1463 LSLVPKSTGNVSIGAYGQF-YHPLYFQL--PPQFYGDRTSSYGGFLYFTLITEGAHKPLERNILGQYPLVQLHAHSKL--LLDFYEYEEFEYSLNVTHRVPLHESFWKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQEVVLQNV---------------------HMDAAIYIKGSTNLIAKGVERCKCPKRFDGLSCQDPGRSFYRWRNTTIVESVFI---EDLIGRAAPCHCNGRSSDCDRET-----------GVCQNCRGNTGGDHCHQCAEGFYGDP----NSPHGCQACPCPETNRNFARGCNVWDGEVS-------CVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDG-IQTEGCDVETGRCYCREGVTGLKCDKCQAERHHLVD---NGCKIC 1821          

HSP 10 Score: 69.707 bits (169), Expect = 3.489e-11
Identity = 69/222 (31.08%), Postives = 90/222 (40.54%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCE-CNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENR----GCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKC 1583
            G CDC+    GQHC +C + +           ST  C++C  C S    C  DP           G C  C   T    C +C  G +        +   C +C CD +G    SI  Q    D     G C C+E   G +CD C IG++ +       C +C C   G+         CDS+ G+C CKS V G  C TC    F LS  N  GC+ C C
Sbjct: 1216 GQCDCKIGVGGQHCNECTEGFFGF--------STEGCQRCSACRSEGQVC--DP---------HNGRCI-CPKFTRGLGCGQCVPGTW-----GWQARLGCRECECDHIG----SIGQQCSTGD-----GQCQCREGYSGRKCDTCAIGYFGY-----PECRRCGCDAEGSFTQADGSIACDSN-GQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFC 1397          

HSP 11 Score: 61.6178 bits (148), Expect = 9.401e-9
Identity = 41/123 (33.33%), Postives = 59/123 (47.97%), Query Frame = 3
Query: 1329 CKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGK--CYCKSFVTGNDCSTCKIGYFNLSNANING-CSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSE 1688
            C+ N  G+ C +C  GF+  + N   GC  C C        RGC+   G+  C CK   TG  C  C+ GYF       N  C  C C   G +  + CD  +G+C C+ G  G++CD+ ++E
Sbjct: 1689 CRGNTGGDHCHQCAEGFYG-DPNSPHGCQACPCPETNRNFARGCNVWDGEVSCVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQ-TEGCDVETGRCYCREGVTGLKCDKCQAE 1809          

HSP 12 Score: 58.5362 bits (140), Expect = 8.010e-8
Identity = 44/135 (32.59%), Postives = 62/135 (45.93%), Query Frame = 3
Query: 2997 CLPNVVGLQCDRCQDKFF-NLSSQI--GCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGT-DGKMPNCSSCGDCW 3389
            C  N  G++C+ C+  F+  L + +   CLPC+C+ P  +    C    G C C  G  GK C  C  G++GD      C +C C+  GS+       +GVC+CK  + G  C  C  G  D    N   C  CW
Sbjct:  475 CSNNTAGIECEFCEMGFYRELDAPLTDPCLPCSCN-PARSTG-GCQSDGGSCNCLEGFQGKNCEECAPGYYGD-----DCKRCECDERGSL-GSTGSCSGVCQCKLNVEGSTCSECAPGYFDLSAENAEGCTSCW 601          

HSP 13 Score: 54.6842 bits (130), Expect = 9.961e-7
Identity = 42/142 (29.58%), Postives = 64/142 (45.07%), Query Frame = 3
Query: 2169 CKCNVTGSRNNNCNKIGGQCQ-CLPNVSGKTCERCASESYGF--DARGCKKCKCDLTG---SLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF------CHSCKCNQ---MSTTCDSKTGKCLNCKGNSFGYNCQNCE 2549
            C CN    R+++C++  G CQ C  N  G  C +CA   YG      GC+ C C  T    +     ++    C+C+ G  G+ C+ C+ GY+  P       C  C C+     +  CD +TG+C  C+    G  C  C+
Sbjct: 1670 CHCN---GRSSDCDRETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDGEVSCVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRCY-CREGVTGLKCDKCQ 1807          
BLAST of Netrin-4 vs. Ensembl Zebrafish
Match: lamb2 (laminin, beta 2 (laminin S) [Source:ZFIN;Acc:ZDB-GENE-081030-4])

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 549/1805 (30.42%), Postives = 870/1805 (48.20%), Query Frame = 3
Query:   87 IFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYI----------------------EKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQF--------------FDSFIIVLSIYHVGKSS-CQSYQD-----TMQLIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXX----------------XXXXXXXNSTKTRKVLGE---CLNYANLVSSKKCDFLNAEI--STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI--LCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTN-----SKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNM-KSLKEIKKYFPIGYDII---------ISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMIS--KNKIRDVTGAFNELKKSLKNILN----GASESKKIYQN-----------ITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVIT-FNGVTCN-TITESNPLMCS---------EFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTN---------MSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLL----NKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLS---KDIDE-------KLSRLLVLQDKI 5090
            +  A    E ++ + C    C P  GDLL+GRE+ L+ASSTCGL   E YC+V  S    + KC  CDS+ PY   S+  SHRIENV++   P     WWQS +G  +V +++  E+EF FT   + FKT+RPAAM IERS D+GR+W  Y YF+++C   FP I +     +++V+C S +S I PS  G V+F          D Y  + +N +  ITN+R+   +LHT GD  +D  P I+ KYYYA+ E ++RG C CYGHAS+C   EG +  ++ MV+G C C+HNTKG +CE+C DFYND PW PA+  +TN C+KC CN HS+ CHFD  VY  +  +SGGVCDNC HNT   NCE CK  YY++    I     C+ C CD  G+K   +C    +  LG+ AG C CK+NVEG++CDKCK GF+  + ++  GC  C C   GT+     CD  +G C+CK  VTG+ C+ C   ++ LS+ + +GC  C C   G+ +N+ C   +G+C C++   G +C++++S ++                       E+   P   +           + G   F I     +M++               +  ++V+    +  SS C +        T+ L   +R++V+P   CLE  +   L V  I   ++                          +      ++  RK   E   C   A  VS  +   + A++  S + +     + C+C+  GS ++ C+  GGQC+C PN+SG+ CE+CA  +YGF   GCK C+C L GS +  C   +G+C CR G  GQ CD C+ G+W FP C  C+CN  +  C  +TG CLNC+ N+ G  C+ C NGYYG+   G+   C+ C CP G +S ++ +  C     +    C C +GY+G  CD+C   +FG+     G CQPCRCS NID    +SC+ +TG+C KCL+NT G +C  C SGY+G+ + R C KC CN +GT      S+   +C   TG+C CLPNV+G  CD C    +NL+S  GC PC CD P  A   +CN+ TGQC C+ G  GK C +C++  WGDP  L  C  C C+  G    QCNR  G C C+ G++G  CD C +G  G  P+C  C  C+  WD  +  +      L + +    +            T L +   +  KE++       DI+         ++     +  L+  +  +     N Q+  +  +++S   A   +S  + + +++    ++L + L  + N    GA +S +   N            T        ++ + R    + I QK  D  N  N  +K  +T  N    N  + + N  +C            CGG GC+ D+  R       C G +       A   LDR+          M ++ + F Q  +    ++E KD       + + T   +D +   ++       +L+ +I+ +L    AD    E++   + +  I     +I  L  +I+ R++ L+NV+ IL++++ + ++ +     A +A+     + N+ +++        + +   ++ +    N +  L  N     ++E  A ++  +++   +R+  L+  I  +    +N               L   + +    + +    + K   + ++S++++++     NK+  + D    +       K L+ D + KLQ L+   KD +E       K  +L  L+DK+
Sbjct:   11 VLSAVSAQEPDAAHGCTHGSCYPATGDLLVGREANLKASSTCGLRRREPYCIV--SHLQEEKKCFQCDSRRPYDPQSNPVSHRIENVITTFKPHRKKSWWQSENGKSDVYLQLDLEAEFHFTHLIMTFKTFRPAAMLIERSADFGRSWQVYRYFANDCESIFPGISQDSLRKVDDVICESRYSDIEPSTEGEVIFRVLDPAIRIEDPYSPRIQNQLK-ITNLRLNLTKLHTLGDNLLDSRPEIKEKYYYAMYELVVRGNCFCYGHASECAPIEGIRDDIEGMVHGRCVCKHNTKGLNCEQCDDFYNDLPWRPAEGRNTNACKKCNCNGHSNQCHFDMAVYLATGNISGGVCDNCLHNTMGSNCESCKPFYYQDPTRDIRDPGVCVACDCDPDGSKNGGVCDGHDDPSLGMIAGQCRCKDNVEGSRCDKCKPGFFGLSASDPRGCQPCKCDPRGTVSGSSQCDPVSGDCFCKRLVTGHSCNQCLPEHWALSH-DTSGCRGCDCDVGGATENQ-CSMETGQCQCRSHMIGRQCNQVESGYFFMALDHYIYEAETAKLGQGSVFEEREYQPGRPISWTGTGFARAPEGGTLEFAINNIPYSMEYDVLIRYELQMPRDWEEVRVVVIRPGPIPTSSPCGNTIPADDLLTVSLSSGARFVVLPQPVCLESGVSYKLRVELIRYADRNSIITSTNAFVLVDSIALLPRYLSLEMFTAGDPASVARKQSFERYRCHETAKSVSRPQMSEVCAKLITSMSALINDGALACECDPQGSLSSECDVRGGQCRCRPNISGRRCEKCAPGAYGFGPSGCKLCECSLEGSQSRFCDLYSGQCPCRPGAYGQRCDGCQAGHWGFPNCRPCQCNGHADECHQRTGACLNCRSNTAGDKCERCANGYYGNPVLGLGSQCRPCPCPEGPNSGRHFAASCYQDNRSQQVVCNCNQGYTGPRCDECAPGYFGDPSKPGGQCQPCRCSNNIDLSDPESCDKRTGQCLKCLYNTEGPDCSVCRSGYYGDASRRNCRKCTCNFLGTERSQCLSRDDCVCQRATGQCQCLPNVIGQTCDHCAPNSWNLASGQGCEPCACD-PNNAYTSACNEFTGQCQCRVGFGGKTCTDCQENHWGDPRVL--CRACDCDPRGIESSQCNRMTGHCVCQQGVSGVRCDQCARGFSGTFPDCKPCHQCFGDWDRIVQDLATRTKALTDRAKELQT------------TGLTRAFERRFKELEDMLAQARDIVNARNATAEAVTTLMGMIEVLRAQIGETTDT-LNQQEGDLTAVQDSNYEASNALSTLEREAKELNLNADQLNRQLDILKNSNFLGAYDSIRASYNKSRDAEHRSNRSTTDTPSTVSQSADTRKKTERLIGQKRDDF-NRKNAANKRTLTDLNAKVQNLDLKKINEKVCGAPGDAQCVDSPCGGAGCRDDEGKRR------CGGLNCNGAVAVADTALDRSKHAEKELDKAMGVVEELFKQVADAKTKAQEAKDRAQAALEKASDTKNKVDHSNNDLR-------DLIKQIRQFLMQEGADPDSIEAVANRVLELSIPASPKQIRHLADEIKDRVKSLSNVDAILEQTQNDVRKAEQLLLDAKKARNKAEGVKNTAESVKKALNDASRAQAAAEKAIQKAKNDI-GLTQNQLAQIQSETSASER--DLNDAVDRLGDLERQIEALKTKRANN-------------SLDAARAEETATMARDKANEAKEILDGELSDKYRTVQGLMDNKAKTMQDAKHKAEQLRDEAKGLLKDAQDKLQRLAELEKDYEENQKVLEGKARQLDGLEDKM 1764          
BLAST of Netrin-4 vs. Ensembl Zebrafish
Match: lamb1a (laminin, beta 1a [Source:ZFIN;Acc:ZDB-GENE-021226-1])

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 557/1800 (30.94%), Postives = 885/1800 (49.17%), Query Frame = 3
Query:   63 MTLNYVFIIFVARYILE--IESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFS-STHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE-MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLEN-RGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCK------------NGFAGIRCDEIKSEWYIEK-----PTYPLEHLKEIK--------INLPP----------VSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHV--GKSSCQSYQ--DTMQLI---KDSRYIVIPNK-CLEKDL-------------------PIVL--TVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECL-NYANLVSSKKCDFLNAEISTNTVTKSDPIK-CKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKW---QGICNHE--TGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKL-HNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDII-ISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILN----GA----------SESKKIYQNITLIKD--------KLFYRNEELRNINLKFIRQK----SKDMDNLINEMSK-NVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKP-ESEYNT--TIKLIDVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXX---XXLRNLK--IDTKVVVNKSNYFKLKSASNSKISE---RFQSLLNKSHNLNDKIKASHYKLKL----------NKKLIVDKELKLQSLSKDIDEKLSRL 5069
            M L    +  +  + L    E  +VC +  C P  GDLLIGR   L A+STCG+   E +C+V  S    + KC +CDS+  Y   +    SH IENVV+    +  + WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS D+G TW  Y YF+ +C   FPS+     + +++V+C + +S I PS  G V+F      +   D Y  + +N +  ITN+RV+F +LHT GD  +D    I+ KYYYAI + ++RG C CYGHAS+C   +G  +  E MV+G C C HNT G +CE+C+DFY+D PW PA+  +TN C+KC CN HS SCHFD  VY+ S  +SGGVCD+CQHNT   NCE+CK  ++++    I     C  C+CD +G+    +C    ++ LGL +G C CK NVEG +CD+CK G +  +  +  GC  C C  +GT+     CD+ +G CYCK  VTG +C  C   ++ LSN +++GC  C C ++G   N  C   SG+C C+            +GF  I  D    E    K        P  H ++          +N+P           +  S  Y+ +I  + +  + ++  ++ +    V    S C +    D  Q++     SRY+V+P   C E+ L                   P  L  ++  +     +            L  NS         CL N   +V +   D     I + +      +K C+C+  GS +  C+  GGQCQC PNV G+ C+RCA  ++ F  +GC+ C C   GS++S C+  TG+C C  G  G+ CD C PGYW FP C  C CN  +  CD +TG+CL+C+ ++ G+NC+ C  GYYGD     G  C+ C CP G  S +  S  C    +++   C+C +GY G  C++C   ++GN     G C+PC+C+ NID    +SC+++TG C KCL++T G +C +C  GY+GN   ++C KCVCN MGT  +     G CN +  +G+C CLPNVVG  CD+C    +N++S  GC  C+CD P  +   SCN++ GQC C+ G  G+ C  C++ FWG+P     C  C C+  G   +QCN+  G C C  G++G  CD C +G  G+ P C  C  C+ +WD  +  + N   +L    + +  + +  P +      ++E +  S++ I    P    +  I    E+ + L   + NSN ++   +  S I+ +N++   K    K + + +     +L++ ++ + N    GA          S++ +I  N + I           L    EEL N   +   Q+    SK +DNL  ++   ++   +  TC +   S     S  CGG+ C   +  R     + C G +    N +      +      L+  +    +   SK + +A VK  E++ N    +   + T+  + S   E   L+ +I+ +L    ADL+  E++   + + ++     ++  L ++IR R+  L +V +IL++S  +  + +   + A +A+++ S + ++ + +   N   Q  E            A   +KG    +   E+E    +  +S  T R+  L+  +  + +   NT       ++  +   A    LK  +D+++    S   +L +     ++E   R + L +++ NL   ++AS  KL+L          N+KL+ DK  +L  L K + E L  +
Sbjct:    1 MLLQLAALSILGAWALADVPELGDVCTEGSCYPATGDLLIGRAQQLLATSTCGVHKPEPFCIV--SHLQEEKKCFVCDSRQAYNETAHQVTSHSIENVVTTFAPNRLKTWWQSENGLENVTIQLDLEAEFHFTHLIMTFKTFRPAAMVIERSADFGNTWQVYRYFAYDCESSFPSVSHGPMTKVDDVICDTRYSDIEPSTEGEVIFRVLDPAFRIEDPYSPRIQN-MLKITNLRVKFTKLHTLGDNLLDSRIEIKEKYYYAIYDMVVRGNCFCYGHASECAPVDGTGEAVEGMVHGHCMCNHNTIGLNCERCQDFYHDLPWRPAEGRNTNACKKCHCNHHSHSCHFDMAVYRASGNVSGGVCDDCQHNTMGHNCEQCKPFFHQHPEKDIRDPNICEPCNCDPVGSLNGGVCDPMTDVSLGLISGQCRCKPNVEGERCDQCKQGHYGLS-EDPLGCQPCTCNALGTVPGGSPCDTDSGNCYCKRLVTGRNCDQCLPQHWGLSN-DMDGCRPCDC-DHGGAINNNCSPVSGQCQCREHMFGRRCDQVESGFYFIALDHYTYEAEEAKFGPGVTVVPRNHPQDRSPTWTGIGFVNVPEGAFLEFSIDNIPYSMEYDLIIRYEPQLPEQWEEVLMTVIRPRVITADSRCANTMPDDDNQMVSLHPGSRYVVLPRPVCFEEGLNYTVRLSLSLYSALSDVQSPYTLIDSIVLMPHCKNLDIFSGSGTEGGNLVTNSAWENFQRYRCLENSQAVVKTPMTDICRNYIFSVSALLHQGVKACQCDPQGSLSTVCDPSGGQCQCRPNVVGRNCDRCAPATFLFGPQGCRSCDCSPEGSVHSYCHEATGQCECIAGAYGRQCDRCLPGYWGFPNCRPCTCNGHAEQCDPQTGQCLSCRDHTTGHNCERCLGGYYGDPVLGSGDHCRPCMCPDGPGSGRQFSGACYKSPDSSQVFCVCNQGYKGARCEECAPGYYGNPHEVGGECRPCQCNSNIDMMDPESCDARTGACVKCLYHTEGESCNRCRLGYYGNALTQSCRKCVCNQMGTVEEMCPSSGNCNCDLTSGQCLCLPNVVGQHCDQCAPDTWNMASGKGCEDCDCD-PNHSFGSSCNEIMGQCSCKPGFGGRTCRECRELFWGNPEV--KCHACDCDPRGIAEQQCNKVTGHCVCVEGVSGPRCDTCARGYTGEFPQCERCHQCFAEWDIIVGDLTNQTHRLVQKVNTIKATGITGPYQA--TINNVENSANSIRNILAQNPATQPLTEIQGLLEQATALMAEM-NSN-LNLTEETLSEISSDNNSTDTKLKSLKEEAQKLEQTVKDLREQVEFVKNSDIRGARASVTRYYEQSQNAEIRANASTIDPYNLVNQSATLRTETEELMNQTKEEFNQRQDEFSKKLDNLAGQLETLDLSELSEKTCGSPAGSENCADSP-CGGLSCVDTQGSRKC-GGEGCDGLTTLAHNAW------QKAKDFDLEIISAMEEVDKLSKMVSEAKVKADEAKLNAQEVLAKTNETKKRVDSSNEELRQLIKQIRDFLTQDGADLESIEAVANEVLQMQMPTTPAQLQNLTEEIRERVGSLTDVEDILNQSAADILRAESLLEQARKARKEASDVKSTAEMV---NEALQHAERAQNSVAEALKQAAVDIKGTQDLLVSVESETSDSELKLSNATRRLLKLESDVALLKEKALNTSISANSTEKEAESINALAEQLKKDLDSELKDKYSTVEELITQKAEGVAEAKKRAEKLQDEARNL--LLQASE-KLQLLKNLEKNYDQNQKLLEDKANELVDLEKAVKELLQEI 1773          
BLAST of Netrin-4 vs. Ensembl Zebrafish
Match: lamb1b (laminin, beta 1b [Source:ZFIN;Acc:ZDB-GENE-041210-197])

HSP 1 Score: 781.171 bits (2016), Expect = 0.000e+0
Identity = 505/1547 (32.64%), Postives = 768/1547 (49.64%), Query Frame = 3
Query:   84 IIFVARYILEIESD--NVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCL-------KCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYI-----------------------------EKPTYP------LEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLS-IYHVGKSS-CQSYQDTMQLI---KDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVL---------------GECLNYA-NLVSSKKCDFLNAEI-STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK--WQGI--CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAM---------------ISKNKIR--------DVTGAFNELKKSLKNILNG-----ASESKKIYQNITLIKD--KLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSI-ILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI--DVTRGAIQSR-RIESV-----NLLIKIKTYLNGSADLKDFESLIENINKFEI 4379
            I+ +A + L    D  ++C +  C P  GDLLIGR   L ASSTCGL + E +C+V   +    + C  CDS+  Y  F+   SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + F+T+RPAAM IERS DYGRTW  Y Y++ NC   +P +P+     +++V+C S +S + PS  G V+F      +   D Y    +N +  ITN+R+   +LH  GD   +     R KY+YA+ + +IRG C CYGHASKC     +  V+ MV+G C C H+T G +CE+C+DFY D PW PA    TN C+KCECN HS SCHFD  VY  S   SGGVCD+C+HNT+ + CE CK  YY++    I   + C  C CD  G+ +  +C     +   + AG C CK NVEG +CD CK G +  + ++  GC         C+C  +GTL     CD  TG CYCK  VTG +C  C   ++ LSN +++GC  C C + G   N  C + +G+C CK    G RCD+++S +Y                               KPT+       +   + +  N+    +S  YN +I  +      ++  I+ L     + +S+ C +  D  Q++     SRY+V+PN  CLE      L +   + ++    S    +V  L+ +   +   +                  CL  + +++     D     I S + +  +  ++CKC+  GS +  C+ IGGQCQC PNVSGK C+ CA  +Y F   GC+ C C+  GS N  C+  TG+CLC  G  G+ C  CKP +W +P C  C CN  S  C   TGKCLNC+G++ G+NC+ CE+GY+  T  G    C+ C CP G  S    S  C    NT    C+C  GY G  C++C + ++GN     G C PC+C+GNI+ +  +SC+++TG C KCLF+T G  C+ C  GY+G+   + C +C+CN +G++ +    G+  C+  +G+CPCLP V G  CDRC    +N++S  GC PC C +P  + + SC+ L+GQC C+ G  GK C  C++ FWGDP     C  C C+  G   +QCN+ +G C C  G+ GR+CD C +G  G  P+C +C  C+ +WD  +  + N   +L ++    M +        D+  SL+   + L+EI     +  D +   F+     +K   Y ++++  +  ++       STD+ +A+               I+ +K +        D  GA + ++   +           + S+ + Q+  L KD      R E   N+  +   Q+   ++  +N  S ++   +   C     +  L   E CGG+GCK      H     +C G+           ++ R+  S+   K  +Q+   ++   +  +  V          KL   DV   A QS+ R+E       NL+ +I+ +L    D K  E +   + K  +
Sbjct:    7 ILAIALHTLAQLPDHNDMCAEGSCYPATGDLLIGRAHRLTASSTCGLNSPEEFCMVNILED---TVCFECDSRRLYNEFTHPDSHTIENVVTTFAPNRLKTWWQSENGVENVTIQLDLEAEFHFTHLIMTFRTFRPAAMLIERSADYGRTWQVYRYYAFNCNESYPHVPKGPIKKVDDVICDSRYSGMEPSTEGEVIFRVLDPAFKIPDPYSPHIQN-LLKITNLRIAMEKLHKLGDLS-NYRKEARKKYFYAVYDMVIRGNCFCYGHASKCAPIGNEAGVEGMVHGHCMCNHHTTGLNCEECEDFYQDQPWRPAVGRETNACKKCECNRHSDSCHFDMAVYLSSGNRSGGVCDDCEHNTQGQWCENCKPFYYKHPQRDIRDPRICEPCDCDPRGSLYEGLCDSATNVMRDMIAGQCHCKANVEGQRCDHCKKGHYGLS-DDPLGCRLWLPRSSSCSCNPLGTLPGGTPCDIQTGSCYCKRLVTGRNCDQCLPQHWGLSN-DMDGCRPCDC-DVGGALNNNCSQETGQCACKEHMFGRRCDQLQSGYYFAALDHYIYEAEFASFGPAVKVVQRPLPQDRKPTWTGTGFVNVPEGETLTFNINNFPRSMEYNLMIRYEPLLPDEWEQVIVKLERPRDIDQSTHCTTTYDDEQMVSLHPGSRYVVVPNPVCLETGQNYTLKISFPQYSSYSYHSSPRTLVDSLVLLPEVQDLDLFCGGDHQQKNWEMFQKYRCLERSQSVIKIPLTDICKDYIFSVSALLHNGALECKCDPRGSLSTVCDPIGGQCQCRPNVSGKNCDACAPATYLFGPSGCRACDCNPLGSQNLFCHPSTGQCLCVPGAFGRQCGNCKPNHWGYPTCKPCSCNGNSEQCHPLTGKCLNCRGHTSGHNCERCESGYHRSTLLGSRDQCRPCMCPNGPGSGMQFSESCYQNPNTLQMVCVCNAGYKGPKCEECASGYYGNTRVPGGRCHPCQCNGNINMQDPESCDARTGACLKCLFHTDGTECQYCSRGYYGDARSQNCRRCMCNLVGSSRQSCVDGLCECDRISGQCPCLPGVEGQLCDRCAPNTWNINSGRGCQPCRC-HPEHSYSSSCDLLSGQCSCKPGFGGKTCEECRELFWGDPEV--ECHACDCDPRGIATQQCNKTSGDCVCIEGVAGRSCDTCGRGFVGTFPDCEACHHCFREWDVNVGELTNHTQRLVDTVEE-MKDSGVATPYKDIIKSLDDESRQLREI-----LEDDKVQQTFAHTQRMMKKARYTASLLRKSMDRSETDLDMVSTDHHRAIKDLKSLTKEAQNLQEITSDKQQQVLNIKHSDPRGAVDSIRDYYRESAEADFRVSQAISEPVRQSALLRKDAEAKLERTENEFNLKHQLYTQRLSKIETELN--STDLSRLSRQVCGG---AAGLDGCEDCGGLGCK------HEDGMSHCGGEG-------CDTIVTRSQDSLNKAKNLDQEVLHTLKEVDKLNRMVSDARGRADEAKLSAQDVLLRANQSKARVEQTNEDLRNLIQQIRDFLTNETDPKRIEEVANEVMKLSL 1518          
BLAST of Netrin-4 vs. Ensembl Zebrafish
Match: lamb2l (laminin, beta 2-like [Source:ZFIN;Acc:ZDB-GENE-030131-4205])

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 444/1299 (34.18%), Postives = 673/1299 (51.81%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQD---PFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMG-TLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEI------KINLPPVSKSGY-------------------------------------YNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLI-----KDSRYIVIPNK-CLEKDLPIV--------------LTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGE--CL-NYANLVSSKKCDFLNAEI-STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTS--RGILCKKCQCPG-LSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT--NSKWQGI--CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKE-IKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNK-IRDVTGAFNELKKSLKNILNGA 3785
            C    C P  G+LLIGR   L  SSTCGL   E YC+V  S      KC ICDS+NPY       SHR+ENV+   P D      WWQ+++G  NVS+ ++ E+EF FT   ++FKT+RPAAM IERS D+GRTW  Y YF+ NC + FP +P      I+EV+C   +S I PS  G V++          D Y +    D+  ITN+R+ F +LHT GD  +D  P++  KYYYA+ E ++RG C CYGHAS+C    G   +   M++G C C+HNT G +CE+C+DFY+D+PW PA+ ++ + CR+C CN HS+ CHFD  VY  +  +SGGVC+NC HNT  +NCE CK  YY++    I     C+ C CD +G+    +C    +LDLG+  G C CK+NV G +CD CK G +  + ++  GC  CNC   G T     CD  +G C CK +VTG  C+ C   Y+ LS+ ++ GC  C C ++G   +  C   SG+C C+    G +C E++  ++     Y     + +       + LPP   S +                                     Y+ +I  + ++ + +++ + V S+       C +   T QL       + RYI +P   C E +   V              LT F +  +  + P   ++      +    + R+ +    CL ++  +      +   + I S + +  +  + C+C+  GS +  C+++GGQC+C PNV G+ C +CA  +YGF   GC  C C   GS+   C   TG+C+CR G  G+ C  C+PG W FP C  C+CN  + +CD ++G C +C+ N+ G  C+ C +GYYG+ +   G  C+ C CPG   S  +N   C + + +    C C +GY+G  CD+C   ++G+     G+C+PC+C+GNID +  +SC+ +TG C KCL+NT G +C +C  GY+GN  ++ C +C C   GT  NS   G+  C+ +TG+CPC  N++G  CD+C    +N  S  GC PC C  P  AL+  CN  +GQC+CQ G  G+ CN C+   WGDP     C +C C+  GS   QC+R  G C CK G +G+ CD C +G  G  P C  C  C+  WD  +  V+       +   + +   + P   D     LE+ +   +E ++     G   +IS   + L R +  + +  ++      N  +T +++ D  + + +  K ++D+    ++L++ L+N L   
Sbjct:   16 CMDGSCYPATGNLLIGRAINLTTSSTCGLDGPEPYCIV--SHLKDSEKCFICDSENPYDANYHRDSHRVENVI--YPMDSTGELTWWQAVNGEENVSVRLNLEAEFHFTHLIMKFKTFRPAAMIIERSSDFGRTWRIYRYFAYNCTKTFPRVPAHSLRFIDEVICEERYSDIEPSTDGEVIYKVLDPAIHVKDPY-SLDIQDLLRITNLRINFTKLHTLGDNLLDRRPDVLQKYYYALYELVVRGSCFCYGHASECAPVPGVTTRDSGMIHGRCVCKHNTVGLNCERCRDFYHDAPWRPAETDNAHTCRECNCNGHSNQCHFDMAVYLATGNVSGGVCNNCLHNTMGRNCESCKPFYYQDPEKDIRDPAACVPCDCDPVGSVEGGVCDSHTDLDLGMIGGQCRCKQNVRGQRCDYCKEGHYGLSLDDPLGCQPCNCDPRGITTLGVPCDQISGDCSCKRYVTGRYCNQCLPEYWGLSH-DLAGCRPCNC-DFGGATSSRCMMDSGQCDCRPHLIGRQCSEVQPAFFCASLDYYKYEAEAVMGRSPEDLTLPPSVSSVHRERQPGQMVTWTGPGFARVKDGAGLEFAISNIPYAMEYDIMIRYEPESTEDWEALVSVTSVNLPISLRCGNMLPTEQLYTVPMPHNVRYIKMPKPFCFEPNNRYVVSIRFQRHAVSHRHLTAFILIDSLVLIPRYEELTGFQGDEGADERRRQEMESYMCLESFMTMPMPALAELCTSLICSISAIMHNGALGCQCDPQGSLSAECDRVGGQCRCKPNVIGRKCNQCAPGTYGFGPYGCTVCDCHSQGSVGHHCDPVTGQCMCRHGAIGRQCSECQPGQWGFPNCRQCQCNSHAESCDPESGACYDCRDNTAGQLCERCVDGYYGNPALGSGEHCRPCPCPGHPDSGHSNGASCEVDYASNQILCQCGQGYAGPRCDRCAPGYYGDPEHPGGSCRPCQCNGNIDPQDPESCDPRTGLCLKCLYNTDGDSCSECKLGYYGNALIQDCRRCTCVTAGTLPNSCTDGVCQCDKQTGQCPCKQNIIGHNCDQCATNHWNFGSDCGCEPCGCVQP-NALSTHCNMFSGQCHCQPGFGGRQCNECEAFHWGDPRVQ--CEECNCHPLGSETSQCDRTTGACVCKDGASGQRCDECARGFTGNFPKCVPCHPCFQLWDDVVCQVRRDLTHFRDIIAMILEKGEVPGVSDKRILELEKKLAQAQELVRDGDREGTFNLISQTVDDL-RAEIALTDGRLMGVIRDLN--VTTDHNNDLKQNLTALEKELKDLNNTLHQLRRELENYLTAG 1301          
BLAST of Netrin-4 vs. Ensembl Zebrafish
Match: lamb1b (laminin, beta 1b [Source:ZFIN;Acc:ZDB-GENE-041210-197])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 461/1315 (35.06%), Postives = 686/1315 (52.17%), Query Frame = 3
Query:   78 VFIIFVARYILEIESD--NVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYI-----------------------------EKPTYP------LEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLS-IYHVGKSS-CQSYQDTMQLI---KDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVL---------------GECLNYA-NLVSSKKCDFLNAEI-STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK--WQGI--CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNI 3815
              +I +A + L    D  ++C +  C P  GDLLIGR   L ASSTCGL + E +C+V   +    + C  CDS+  Y  F+   SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + F+T+RPAAM IERS DYGRTW  Y Y++ NC   +P +P+     +++V+C S +S + PS  G V+F      +   D Y    +N +  ITN+R+   +LH  GD   +     R KY+YA+ + +IRG C CYGHASKC     +  V+ MV+G C C H+T G +CE+C+DFY D PW PA    TN C+KCECN HS SCHFD  VY  S   SGGVCD+C+HNT+ + CE CK  YY++    I   + C  C CD  G+ +  +C     +   + AG C CK NVEG +CD CK G +  + ++  GC  C+C  +GTL     CD  TG CYCK  VTG +C  C   ++ LSN +++GC  C C + G   N  C + +G+C CK    G RCD+++S +Y                               KPT+       +   + +  N+    +S  YN +I  +      ++  I+ L     + +S+ C +  D  Q++     SRY+V+PN  CLE      L +   + ++    S    +V  L+ +   +   +                  CL  + +++     D     I S + +  +  ++CKC+  GS +  C+ IGGQCQC PNVSGK C+ CA  +Y F   GC+ C C+  GS N  C+   G+CLC  G  G+ C  CKP +W +P C  C CN  S  C   TGKCLNC+G++ G+NC+ CE+GY+  T  G    C+ C CP G  S    S  C    NT    C+C  GY G  C++C + ++GN     G C PC+C+GNI+ +  +SC+++TG C KCLF+T G  C+ C  GY+G+   + C +C+CN +G++ +    G+  C+  +G+CPCLP V G  CDRC    +N++S  GC PC C +P  + + SC+ L+GQC C+ G  GK C  C++ FWGDP     C  C C+  G   +QCN+ +G C C  G+ GR CD C +G  G  P+C +C  C+ +WD  +  + N   +L ++    M +        D+  SL+   + L+EI     +  D +   F+     +K     ++++  +  ++       STD+ +A      I+D+      L K  +N+    S+ ++   NI
Sbjct:    8 ALVISIALHTLAQLPDHNDMCAEGSCYPATGDLLIGRAHRLTASSTCGLNSPEEFCMVNILED---TVCFECDSRRLYNEFTHPDSHTIENVVTTFAPNRLKTWWQSENGVENVTIQLDLEAEFHFTHLIMTFRTFRPAAMLIERSADYGRTWQVYRYYAFNCDESYPHVPKGPIKKVDDVICDSRYSGMEPSTEGEVIFRVLDPAFKIPDPYSPHIQN-LLKITNLRIAMEKLHKLGDLS-NYRKEARKKYFYAVYDMVIRGNCFCYGHASKCAPIGNEAGVEGMVHGHCMCNHHTTGLNCEECEDFYQDQPWRPAVGRETNACKKCECNRHSDSCHFDMAVYLSSGNRSGGVCDDCEHNTQGQWCENCKPFYYKHPQRDIRDPRICEPCDCDPRGSLYEGLCDSATNVMRDMIAGQCHCKANVEGQRCDHCKKGHYGLS-DDPLGCRSCSCNPLGTLPGGTPCDIQTGSCYCKRLVTGRNCDQCLPQHWGLSN-DMDGCRPCDC-DVGGALNNNCSQETGQCACKEHMFGRRCDQLQSGYYFAALDHYIYEAEFASFGPAVKVVQRPLPQDRKPTWTGTGFVNVPEGETLTFNINNFPRSMEYNLMIRYEPLLPDEWEQVIVKLERPRDIDQSTHCTTTYDDEQMVSLHPGSRYVVVPNPVCLETGQNYTLKISFPQYSSYNYHSSPRTLVDSLVLLPEVQDLDLFCGGDHQQKNWEMFQKYRCLERSQSVIKIPLTDICKDYIFSVSALLHNGALECKCDPRGSLSTVCDPIGGQCQCRPNVSGKNCDACAPATYLFGPSGCRACDCNPLGSQNLFCHPSNGQCLCVPGAFGRQCGNCKPNHWGYPTCKPCSCNGNSEQCHPLTGKCLNCRGHTSGHNCERCESGYHRSTLLGSRDQCRPCMCPNGPGSGMQFSESCYQNPNTLQMVCVCNAGYKGPKCEECASGYYGNTRVPGGRCHPCQCNGNINMQDPESCDARTGACLKCLFHTDGTECQYCSRGYYGDARSQNCRRCMCNLVGSSRQSCVDGLCECDRISGQCPCLPGVEGQLCDRCAPNTWNINSGRGCQPCRC-HPEHSYSSSCDLLSGQCSCKPGFGGKTCEECRELFWGDPEV--ECHACDCDPRGIATQQCNKTSGDCVCIEGVAGRRCDTCGRGFVGTFPDCEACHYCFREWDVNVGELTNHTQRLVDTVEE-MKDSGVATPYKDIIKSLDDESRQLREI-----LEDDKVQQTFAHTQRMMKKASETASLLRKSMDRSETDLDMVSTDHHRA------IKDL----KSLTKEAQNLQEITSDKQQQVLNI 1295          
BLAST of Netrin-4 vs. Ensembl Xenopus
Match: LAMB1 (laminin subunit beta 1 [Source:NCBI gene;Acc:100495516])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 567/1785 (31.76%), Postives = 881/1785 (49.36%), Query Frame = 3
Query:   63 MTLNYVFIIFV-ARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQ-VKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTY----------------PLEHLKE---IKINLPPVSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESN----------------NKXXXXXXXXXXXXXXXXNSTKTRKVLGECL-NYANLVSSKKCDFL-NAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT-----NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHN-SSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDII-ISNFSEKLSRLKYYVYNS--------NIIDFNTQQNSIITIENSTDYAKAM------ISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNI---NLKFIRQKSKDMDNLINEMSKN--VITFNGVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI---DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNK-SNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKL--IVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            +T    FI+ + A Y    +  + C +  C P  GDLLIGR   L ASSTCG+   E +C+V  S    + KC ICDS +PY   ++T SHRIENVV+   P     WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V++      +  +D Y  + ++ +  ITN+R++F++LHT GD  +D    I+ KYYYAI + ++RG C CYGHAS+C   +G    V+ MV+G C C+HNTKG +CE+C DFY+D PW PA+  S+N C+KC CN HS+ CHFD  VY  +   SGGVCD+CQHNT  +NCE+CK  +Y++    I     C  C+CD  G++   IC +  +  +GL AG C CK NVEG +CD+CK GF+  N  +  GC  C C  +GT+     CDS  G C+CK FVTG  C  C   ++ LSN +++GC  C C   GS DN  C   SG+C C+    G +C+E++S +Y   ++  TY                PL H +      I    V +  Y  F I     +M+ +D  I             V+++   GK    S            ++ L   SRYI +P   C EK L     + L  +++ SN                 K             +  N+         CL N  ++V +   D   N   + + +     ++C+C+  GS ++ C+  GGQCQC PNV G+ C +CA  ++GF   GCK C+CD+ GS +  C+ +TG+C C  G  G+ CD C PGYW FP C  C+CN  +  C++ TG+C NCK +S GY+C+ C +GYYGD     G  C+ C CP G  S +  + GC     T    C C  GY+G  CD C + +FGN     G CQPC C+ NID     +C+ ++G C KCL++T G NC++C  GY+GN   + C +CVCN++GT     + +    CN   G+CPCLPNV+G  CDRC    +NL+S  GC PC CD    +L  SCN+ TGQC C  G  G+ C+ C++ FWG+P     C  C C+  G    QCNR  G C CK G+ G  CD C +G  G  P C+ C  C+  WD  +  + N   +L N ++ + +S V  P +       +++ ++ ++ I  + P    +  I N  E+  +LK  V             I  N  +       ++  + KA+      +   KI +V GA + + K  +  L           N   I +      +E+ N+   NL   +++ ++   L++E++ N   +  + ++  T   S  L+C +  CGG+ CK D   R       C G      + + +     T +   L E  +       SK + ++ ++ E    +   ++   + T+  +     +  NL+ +I+ +L    ADL   E++   + K ++     ++  L ++IR R+  L+ V+ IL +S  +  + +     A  + +  + +  ++  +        K +   ++ +     A   +KG    +   E+EA   +  ++  T+R+  L+  I  + K  +   Q     ++       N     KV+  + +N +K      +K +E  +    K+  L  + K      + NKKL  I D E   +   + ++EK  +L+ L++ + +
Sbjct:    3 VTFRLTFILMLGAAYAQSPDFSHGCAEGSCYPATGDLLIGRSDQLTASSTCGIQKPESFCIV--SHLQEEKKCFICDSLDPYNEQNNTESHRIENVVTTFAPNRLNLWWQSENGLENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWKIYRYFAYDCETSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIYRVLDPAFRIDDPYSLRIKS-MLRITNLRIKFLKLHTLGDNLLDSRVEIKEKYYYAIYDMVVRGNCFCYGHASECAPVKGYSDNVEGMVHGRCVCRHNTKGLNCEQCLDFYHDLPWRPAEGRSSNACKKCNCNEHSTHCHFDMAVYMSTGNTSGGVCDDCQHNTMGRNCEQCKPFFYQHPDKDIRDPNICQPCNCDPAGSQDGGICDRYSDFSVGLIAGQCRCKLNVEGERCDQCKEGFYDLNAEDPEGCQFCGCNPLGTIPGGNSCDSRNGNCFCKRFVTGRKCDQCAPEFWGLSN-DLDGCRPCDCDHGGSEDN-NCSPESGQCRCRPHMIGRQCNEVESGFYFISLDHYTYEAEYANFGPDVRIVERPLPHDRTPSWTGIGFARVPEGAYLEFHINDIPTSME-YDLLIRYEPQLPEQWEEAVITVIRPGKIPTSSRCGNTVPSDDNQSVALPPGSRYITLPRPICFEKGLNYTIRLELPRYSVNSNVENPYTLIDSIVLLPHVKSLDIFSMGGSGDDVTTNTAWQTFQRYRCLENSQSVVKTPLTDVCKNFLFTISALLHKSALECQCDPQGSLSSVCDPNGGQCQCRPNVIGRNCNKCAPGTFGFGPNGCKPCECDVRGSSHPFCHTETGQCPCIHGAFGRQCDVCLPGYWGFPSCRQCQCNGHAEDCNALTGECTNCKDHSEGYSCERCLSGYYGDPRLGSGDHCRPCPCPDGPGSERQFASGCYKDPTTLQVVCSCNMGYTGIRCDGCASGYFGNPEEIGGVCQPCHCNNNIDMSDSLACHKQSGLCLKCLYHTEGINCQECQLGYYGNAIQQDCRRCVCNYLGTEQENCSGEIDCHCNRTNGQCPCLPNVIGQSCDRCAANTWNLASGTGCEPCACDTN-RSLGLSCNEFTGQCQCMPGFGGRDCSECQELFWGNPDI--ECRACDCDSRGIQTSQCNRATGHCICKEGVEGVRCDKCARGYSGAFPYCTPCHKCFALWDIIIQELSNRTKQLLNRANDLKISGVIGPYQ--QTVDKVQEKLEEIRSILAHNPAAQPLKNIENLFEEAEKLKSEVSQKVDEVEMKLAEIKINDTEKLDALQADAESFGKALKELGDQLEFMKISNVQGAMDSINKYFQMSLEAEEMVNASVSNPDSIIEHSAATRQEVENLINENLSQFKKEQEEQTRLLDELAGNGQSLDLSSLSEKTCGNSPGLLCEDSECGGLNCKTDDGKRKC-GGPGCGGLVTVAHSAWKTASSFDTEIQNALAEVEEL------SKMVAESKLRAEEAKQSAQDVLTKANATKEKVNQSNEDLRNLIKQIREFLMQDGADLDSIEAVASEVLKMDMPTTPEQLQKLTEEIRERVESLSGVDTILKQSAGDIARAEALLDEAKESSKSAADIKATVDAVKEALMEAGKAQSAAEKAI---KRADDDIKGTNDLLTSIESEAAVSEETLNNATKRLVQLENNIDDLMKKSAANSQTANQVEKSVHEVKANANGAKKVLDGELTNKYKTVEDLIAKKAEDSEEARRKAQELQKEAKG--LLEQANKKLDTIKDLEKTYEGNERILEEKAKQLVQLEETVRA 1764          
BLAST of Netrin-4 vs. Ensembl Xenopus
Match: LAMB1 (laminin subunit beta 1 [Source:NCBI gene;Acc:100495516])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 566/1787 (31.67%), Postives = 881/1787 (49.30%), Query Frame = 3
Query:   54 LI*MTLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQ-VKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTY----------------PLEHLKE---IKINLPPVSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESN----------------NKXXXXXXXXXXXXXXXXNSTKTRKVLGECL-NYANLVSSKKCDFL-NAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT-----NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHN-SSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDII-ISNFSEKLSRLKYYVYNS--------NIIDFNTQQNSIITIENSTDYAKAM------ISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNI---NLKFIRQKSKDMDNLINEMSKN--VITFNGVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI---DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNK-SNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKL--IVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            L  M   ++ ++  A Y    +  + C +  C P  GDLLIGR   L ASSTCG+   E +C+V  S    + KC ICDS +PY   ++T SHRIENVV+   P     WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V++      +  +D Y  + ++ +  ITN+R++F++LHT GD  +D    I+ KYYYAI + ++RG C CYGHAS+C   +G    V+ MV+G C C+HNTKG +CE+C DFY+D PW PA+  S+N C+KC CN HS+ CHFD  VY  +   SGGVCD+CQHNT  +NCE+CK  +Y++    I     C  C+CD  G++   IC +  +  +GL AG C CK NVEG +CD+CK GF+  N  +  GC  C C  +GT+     CDS  G C+CK FVTG  C  C   ++ LSN +++GC  C C   GS DN  C   SG+C C+    G +C+E++S +Y   ++  TY                PL H +      I    V +  Y  F I     +M+ +D  I             V+++   GK    S            ++ L   SRYI +P   C EK L     + L  +++ SN                 K             +  N+         CL N  ++V +   D   N   + + +     ++C+C+  GS ++ C+  GGQCQC PNV G+ C +CA  ++GF   GCK C+CD+ GS +  C+ +TG+C C  G  G+ CD C PGYW FP C  C+CN  +  C++ TG+C NCK +S GY+C+ C +GYYGD     G  C+ C CP G  S +  + GC     T    C C  GY+G  CD C + +FGN     G CQPC C+ NID     +C+ ++G C KCL++T G NC++C  GY+GN   + C +CVCN++GT     + +    CN   G+CPCLPNV+G  CDRC    +NL+S  GC PC CD    +L  SCN+ TGQC C  G  G+ C+ C++ FWG+P     C  C C+  G    QCNR  G C CK G+ G  CD C +G  G  P C+ C  C+  WD  +  + N   +L N ++ + +S V  P +       +++ ++ ++ I  + P    +  I N  E+  +LK  V             I  N  +       ++  + KA+      +   KI +V GA + + K  +  L           N   I +      +E+ N+   NL   +++ ++   L++E++ N   +  + ++  T   S  L+C +  CGG+ CK D   R       C G      + + +     T +   L E  +       SK + ++ ++ E    +   ++   + T+  +     +  NL+ +I+ +L    ADL   E++   + K ++     ++  L ++IR R+  L+ V+ IL +S  +  + +     A  + +  + +  ++  +        K +   ++ +     A   +KG    +   E+EA   +  ++  T+R+  L+  I  + K  +   Q     ++       N     KV+  + +N +K      +K +E  +    K+  L  + K      + NKKL  I D E   +   + ++EK  +L+ L++ + +
Sbjct:    3 LFQMPGYFLVLMLGAAYAQSPDFSHGCAEGSCYPATGDLLIGRSDQLTASSTCGIQKPESFCIV--SHLQEEKKCFICDSLDPYNEQNNTESHRIENVVTTFAPNRLNLWWQSENGLENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWKIYRYFAYDCETSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIYRVLDPAFRIDDPYSLRIKS-MLRITNLRIKFLKLHTLGDNLLDSRVEIKEKYYYAIYDMVVRGNCFCYGHASECAPVKGYSDNVEGMVHGRCVCRHNTKGLNCEQCLDFYHDLPWRPAEGRSSNACKKCNCNEHSTHCHFDMAVYMSTGNTSGGVCDDCQHNTMGRNCEQCKPFFYQHPDKDIRDPNICQPCNCDPAGSQDGGICDRYSDFSVGLIAGQCRCKLNVEGERCDQCKEGFYDLNAEDPEGCQFCGCNPLGTIPGGNSCDSRNGNCFCKRFVTGRKCDQCAPEFWGLSN-DLDGCRPCDCDHGGSEDN-NCSPESGQCRCRPHMIGRQCNEVESGFYFISLDHYTYEAEYANFGPDVRIVERPLPHDRTPSWTGIGFARVPEGAYLEFHINDIPTSME-YDLLIRYEPQLPEQWEEAVITVIRPGKIPTSSRCGNTVPSDDNQSVALPPGSRYITLPRPICFEKGLNYTIRLELPRYSVNSNVENPYTLIDSIVLLPHVKSLDIFSMGGSGDDVTTNTAWQTFQRYRCLENSQSVVKTPLTDVCKNFLFTISALLHKSALECQCDPQGSLSSVCDPNGGQCQCRPNVIGRNCNKCAPGTFGFGPNGCKPCECDVRGSSHPFCHTETGQCPCIHGAFGRQCDVCLPGYWGFPSCRQCQCNGHAEDCNALTGECTNCKDHSEGYSCERCLSGYYGDPRLGSGDHCRPCPCPDGPGSERQFASGCYKDPTTLQVVCSCNMGYTGIRCDGCASGYFGNPEEIGGVCQPCHCNNNIDMSDSLACHKQSGLCLKCLYHTEGINCQECQLGYYGNAIQQDCRRCVCNYLGTEQENCSGEIDCHCNRTNGQCPCLPNVIGQSCDRCAANTWNLASGTGCEPCACDTN-RSLGLSCNEFTGQCQCMPGFGGRDCSECQELFWGNPDI--ECRACDCDSRGIQTSQCNRATGHCICKEGVEGVRCDKCARGYSGAFPYCTPCHKCFALWDIIIQELSNRTKQLLNRANDLKISGVIGPYQ--QTVDKVQEKLEEIRSILAHNPAAQPLKNIENLFEEAEKLKSEVSQKVDEVEMKLAEIKINDTEKLDALQADAESFGKALKELGDQLEFMKISNVQGAMDSINKYFQMSLEAEEMVNASVSNPDSIIEHSAATRQEVENLINENLSQFKKEQEEQTRLLDELAGNGQSLDLSSLSEKTCGNSPGLLCEDSECGGLNCKTDDGKRKC-GGPGCGGLVTVAHSAWKTASSFDTEIQNALAEVEEL------SKMVAESKLRAEEAKQSAQDVLTKANATKEKVNQSNEDLRNLIKQIREFLMQDGADLDSIEAVASEVLKMDMPTTPEQLQKLTEEIRERVESLSGVDTILKQSAGDIARAEALLDEAKESSKSAADIKATVDAVKEALMEAGKAQSAAEKAI---KRADDDIKGTNDLLTSIESEAAVSEETLNNATKRLVQLENNIDDLMKKSAANSQTANQVEKSVHEVKANANGAKKVLDGELTNKYKTVEDLIAKKAEDSEEARRKAQELQKEAKG--LLEQANKKLDTIKDLEKTYEGNERILEEKAKQLVQLEETVRA 1766          
BLAST of Netrin-4 vs. Ensembl Xenopus
Match: LAMB1 (laminin subunit beta 1 [Source:NCBI gene;Acc:100495516])

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 564/1779 (31.70%), Postives = 877/1779 (49.30%), Query Frame = 3
Query:   78 VFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQ-VKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTY----------------PLEHLKE---IKINLPPVSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESN----------------NKXXXXXXXXXXXXXXXXNSTKTRKVLGECL-NYANLVSSKKCDFL-NAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT-----NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHN-SSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDII-ISNFSEKLSRLKYYVYNS--------NIIDFNTQQNSIITIENSTDYAKAM------ISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNI---NLKFIRQKSKDMDNLINEMSKN--VITFNGVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI---DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNK-SNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKL--IVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
              ++  A Y    +  + C +  C P  GDLLIGR   L ASSTCG+   E +C+V  S    + KC ICDS +PY   ++T SHRIENVV+   P     WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V++      +  +D Y  + ++ +  ITN+R++F++LHT GD  +D    I+ KYYYAI + ++RG C CYGHAS+C   +G    V+ MV+G C C+HNTKG +CE+C DFY+D PW PA+  S+N C+KC CN HS+ CHFD  VY  +   SGGVCD+CQHNT  +NCE+CK  +Y++    I     C  C+CD  G++   IC +  +  +GL AG C CK NVEG +CD+CK GF+  N  +  GC  C C  +GT+     CDS  G C+CK FVTG  C  C   ++ LSN +++GC  C C   GS DN  C   SG+C C+    G +C+E++S +Y   ++  TY                PL H +      I    V +  Y  F I     +M+ +D  I             V+++   GK    S            ++ L   SRYI +P   C EK L     + L  +++ SN                 K             +  N+         CL N  ++V +   D   N   + + +     ++C+C+  GS ++ C+  GGQCQC PNV G+ C +CA  ++GF   GCK C+CD+ GS +  C+ +TG+C C  G  G+ CD C PGYW FP C  C+CN  +  C++ TG+C NCK +S GY+C+ C +GYYGD     G  C+ C CP G  S +  + GC     T    C C  GY+G  CD C + +FGN     G CQPC C+ NID     +C+ ++G C KCL++T G NC++C  GY+GN   + C +CVCN++GT     + +    CN   G+CPCLPNV+G  CDRC    +NL+S  GC PC CD    +L  SCN+ TGQC C  G  G+ C+ C++ FWG+P     C  C C+  G    QCNR  G C CK G+ G  CD C +G  G  P C+ C  C+  WD  +  + N   +L N ++ + +S V  P +       +++ ++ ++ I  + P    +  I N  E+  +LK  V             I  N  +       ++  + KA+      +   KI +V GA + + K  +  L           N   I +      +E+ N+   NL   +++ ++   L++E++ N   +  + ++  T   S  L+C +  CGG+ CK D   R       C G      + + +     T +   L E  +       SK + ++ ++ E    +   ++   + T+  +     +  NL+ +I+ +L    ADL   E++   + K ++     ++  L ++IR R+  L+ V+ IL +S  +  + +     A  + +  + +  ++  +        K +   ++ +     A   +KG    +   E+EA   +  ++  T+R+  L+  I  + K  +   Q     ++       N     KV+  + +N +K      +K +E  +    K+  L  + K      + NKKL  I D E   +   + ++EK  +L+ L++ + +
Sbjct:    2 TILMLGAAYAQSPDFSHGCAEGSCYPATGDLLIGRSDQLTASSTCGIQKPESFCIV--SHLQEEKKCFICDSLDPYNEQNNTESHRIENVVTTFAPNRLNLWWQSENGLENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWKIYRYFAYDCETSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIYRVLDPAFRIDDPYSLRIKS-MLRITNLRIKFLKLHTLGDNLLDSRVEIKEKYYYAIYDMVVRGNCFCYGHASECAPVKGYSDNVEGMVHGRCVCRHNTKGLNCEQCLDFYHDLPWRPAEGRSSNACKKCNCNEHSTHCHFDMAVYMSTGNTSGGVCDDCQHNTMGRNCEQCKPFFYQHPDKDIRDPNICQPCNCDPAGSQDGGICDRYSDFSVGLIAGQCRCKLNVEGERCDQCKEGFYDLNAEDPEGCQFCGCNPLGTIPGGNSCDSRNGNCFCKRFVTGRKCDQCAPEFWGLSN-DLDGCRPCDCDHGGSEDN-NCSPESGQCRCRPHMIGRQCNEVESGFYFISLDHYTYEAEYANFGPDVRIVERPLPHDRTPSWTGIGFARVPEGAYLEFHINDIPTSME-YDLLIRYEPQLPEQWEEAVITVIRPGKIPTSSRCGNTVPSDDNQSVALPPGSRYITLPRPICFEKGLNYTIRLELPRYSVNSNVENPYTLIDSIVLLPHVKSLDIFSMGGSGDDVTTNTAWQTFQRYRCLENSQSVVKTPLTDVCKNFLFTISALLHKSALECQCDPQGSLSSVCDPNGGQCQCRPNVIGRNCNKCAPGTFGFGPNGCKPCECDVRGSSHPFCHTETGQCPCIHGAFGRQCDVCLPGYWGFPSCRQCQCNGHAEDCNALTGECTNCKDHSEGYSCERCLSGYYGDPRLGSGDHCRPCPCPDGPGSERQFASGCYKDPTTLQVVCSCNMGYTGIRCDGCASGYFGNPEEIGGVCQPCHCNNNIDMSDSLACHKQSGLCLKCLYHTEGINCQECQLGYYGNAIQQDCRRCVCNYLGTEQENCSGEIDCHCNRTNGQCPCLPNVIGQSCDRCAANTWNLASGTGCEPCACDTN-RSLGLSCNEFTGQCQCMPGFGGRDCSECQELFWGNPDI--ECRACDCDSRGIQTSQCNRATGHCICKEGVEGVRCDKCARGYSGAFPYCTPCHKCFALWDIIIQELSNRTKQLLNRANDLKISGVIGPYQ--QTVDKVQEKLEEIRSILAHNPAAQPLKNIENLFEEAEKLKSEVSQKVDEVEMKLAEIKINDTEKLDALQADAESFGKALKELGDQLEFMKISNVQGAMDSINKYFQMSLEAEEMVNASVSNPDSIIEHSAATRQEVENLINENLSQFKKEQEEQTRLLDELAGNGQSLDLSSLSEKTCGNSPGLLCEDSECGGLNCKTDDGKRKC-GGPGCGGLVTVAHSAWKTASSFDTEIQNALAEVEEL------SKMVAESKLRAEEAKQSAQDVLTKANATKEKVNQSNEDLRNLIKQIREFLMQDGADLDSIEAVASEVLKMDMPTTPEQLQKLTEEIRERVESLSGVDTILKQSAGDIARAEALLDEAKESSKSAADIKATVDAVKEALMEAGKAQSAAEKAI---KRADDDIKGTNDLLTSIESEAAVSEETLNNATKRLVQLENNIDDLMKKSAANSQTANQVEKSVHEVKANANGAKKVLDGELTNKYKTVEDLIAKKAEDSEEARRKAQELQKEAKG--LLEQANKKLDTIKDLEKTYEGNERILEEKAKQLVQLEETVRA 1757          
BLAST of Netrin-4 vs. Ensembl Xenopus
Match: LAMB1 (laminin subunit beta 1 [Source:NCBI gene;Acc:100495516])

HSP 1 Score: 877.47 bits (2266), Expect = 0.000e+0
Identity = 566/1781 (31.78%), Postives = 882/1781 (49.52%), Query Frame = 3
Query:   78 VFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQ-VKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTY----------------PLEHLKE---IKINLPPVSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESN----------------NKXXXXXXXXXXXXXXXXNSTKTRKVLGECL-NYANLVSSKKCDFL-NAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT-----NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHN-SSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDII-ISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITI----------ENSTDYAKAM------ISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNI---NLKFIRQKSKDMDNLINEMSKN--VITFNGVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI---DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNK-SNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKL--IVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            + ++  A Y    +  + C +  C P  GDLLIGR   L ASSTCG+   E +C+V  S    + KC ICDS +PY   ++T SHRIENVV+   P     WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V++      +  +D Y  + ++ +  ITN+R++F++LHT GD  +D    I+ KYYYAI + ++RG C CYGHAS+C   +G    V+ MV+G C C+HNTKG +CE+C DFY+D PW PA+  S+N C+KC CN HS+ CHFD  VY  +   SGGVCD+CQHNT  +NCE+CK  +Y++    I     C  C+CD  G++   IC +  +  +GL AG C CK NVEG +CD+CK GF+  N  +  GC  C C  +GT+     CDS  G C+CK FVTG  C  C   ++ LSN +++GC  C C   GS DN  C   SG+C C+    G +C+E++S +Y   ++  TY                PL H +      I    V +  Y  F I     +M+ +D  I             V+++   GK    S            ++ L   SRYI +P   C EK L     + L  +++ SN                 K             +  N+         CL N  ++V +   D   N   + + +     ++C+C+  GS ++ C+  GGQCQC PNV G+ C +CA  ++GF   GCK C+CD+ GS +  C+ +TG+C C  G  G+ CD C PGYW FP C  C+CN  +  C++ TG+C NCK +S GY+C+ C +GYYGD     G  C+ C CP G  S +  + GC     T    C C  GY+G  CD C + +FGN     G CQPC C+ NID     +C+ ++G C KCL++T G NC++C  GY+GN   + C +CVCN++GT     + +    CN   G+CPCLPNV+G  CDRC    +NL+S  GC PC CD    +L  SCN+ TGQC C  G  G+ C+ C++ FWG+P     C  C C+  G    QCNR  G C CK G+ G  CD C +G  G  P C+ C  C+  WD  +  + N   +L N ++ + +S V  P +       +++ ++ ++ I  + P    +  I N  E+  +LK  V  S  +D    + + I I           ++  + KA+      +   KI +V GA + + K  +  L           N   I +      +E+ N+   NL   +++ ++   L++E++ N   +  + ++  T   S  L+C +  CGG+ CK D   R       C G      + + +     T +   L E  +       SK + ++ ++ E    +   ++   + T+  +     +  NL+ +I+ +L    ADL   E++   + K ++     ++  L ++IR R+  L+ V+ IL +S  +  + +     A  + +  + +  ++  +        K +   ++ +     A   +KG    +   E+EA   +  ++  T+R+  L+  I  + K  +   Q     ++       N     KV+  + +N +K      +K +E  +    K+  L  + K      + NKKL  I D E   +   + ++EK  +L+ L++ + +
Sbjct:   37 LVLMLGAAYAQSPDFSHGCAEGSCYPATGDLLIGRSDQLTASSTCGIQKPESFCIV--SHLQEEKKCFICDSLDPYNEQNNTESHRIENVVTTFAPNRLNLWWQSENGLENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWKIYRYFAYDCETSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIYRVLDPAFRIDDPYSLRIKS-MLRITNLRIKFLKLHTLGDNLLDSRVEIKEKYYYAIYDMVVRGNCFCYGHASECAPVKGYSDNVEGMVHGRCVCRHNTKGLNCEQCLDFYHDLPWRPAEGRSSNACKKCNCNEHSTHCHFDMAVYMSTGNTSGGVCDDCQHNTMGRNCEQCKPFFYQHPDKDIRDPNICQPCNCDPAGSQDGGICDRYSDFSVGLIAGQCRCKLNVEGERCDQCKEGFYDLNAEDPEGCQFCGCNPLGTIPGGNSCDSRNGNCFCKRFVTGRKCDQCAPEFWGLSN-DLDGCRPCDCDHGGSEDN-NCSPESGQCRCRPHMIGRQCNEVESGFYFISLDHYTYEAEYANFGPDVRIVERPLPHDRTPSWTGIGFARVPEGAYLEFHINDIPTSME-YDLLIRYEPQLPEQWEEAVITVIRPGKIPTSSRCGNTVPSDDNQSVALPPGSRYITLPRPICFEKGLNYTIRLELPRYSVNSNVENPYTLIDSIVLLPHVKSLDIFSMGGSGDDVTTNTAWQTFQRYRCLENSQSVVKTPLTDVCKNFLFTISALLHKSALECQCDPQGSLSSVCDPNGGQCQCRPNVIGRNCNKCAPGTFGFGPNGCKPCECDVRGSSHPFCHTETGQCPCIHGAFGRQCDVCLPGYWGFPSCRQCQCNGHAEDCNALTGECTNCKDHSEGYSCERCLSGYYGDPRLGSGDHCRPCPCPDGPGSERQFASGCYKDPTTLQVVCSCNMGYTGIRCDGCASGYFGNPEEIGGVCQPCHCNNNIDMSDSLACHKQSGLCLKCLYHTEGINCQECQLGYYGNAIQQDCRRCVCNYLGTEQENCSGEIDCHCNRTNGQCPCLPNVIGQSCDRCAANTWNLASGTGCEPCACDTN-RSLGLSCNEFTGQCQCMPGFGGRDCSECQELFWGNPDI--ECRACDCDSRGIQTSQCNRATGHCICKEGVEGVRCDKCARGYSGAFPYCTPCHKCFALWDIIIQELSNRTKQLLNRANDLKISGVIGPYQ--QTVDKVQEKLEEIRSILAHNPAAQPLKNIENLFEEAEKLKSEV--SQKVDEVEMKLAEIKINDTEKLDALQADAESFGKALKELGDQLEFMKISNVQGAMDSINKYFQMSLEAEEMVNASVSNPDSIIEHSAATRQEVENLINENLSQFKKEQEEQTRLLDELAGNGQSLDLSSLSEKTCGNSPGLLCEDSECGGLNCKTDDGKRKC-GGPGCGGLVTVAHSAWKTASSFDTEIQNALAEVEEL------SKMVAESKLRAEEAKQSAQDVLTKANATKEKVNQSNEDLRNLIKQIREFLMQDGADLDSIEAVASEVLKMDMPTTPEQLQKLTEEIRERVESLSGVDTILKQSAGDIARAEALLDEAKESSKSAADIKATVDAVKEALMEAGKAQSAAEKAI---KRADDDIKGTNDLLTSIESEAAVSEETLNNATKRLVQLENNIDDLMKKSAANSQTANQVEKSVHEVKANANGAKKVLDGELTNKYKTVEDLIAKKAEDSEEARRKAQELQKEAKG--LLEQANKKLDTIKDLEKTYEGNERILEEKAKQLVQLEETVRA 1792          
BLAST of Netrin-4 vs. Ensembl Xenopus
Match: LAMB1 (laminin subunit beta 1 [Source:NCBI gene;Acc:100495516])

HSP 1 Score: 869.766 bits (2246), Expect = 0.000e+0
Identity = 558/1752 (31.85%), Postives = 868/1752 (49.54%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQ-VKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTY----------------PLEHLKE---IKINLPPVSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESN----------------NKXXXXXXXXXXXXXXXXNSTKTRKVLGECL-NYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT-----NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHN-SSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDII-ISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAM------ISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNI---NLKFIRQKSKDMDNLINEMSKN--VITFNGVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI---DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNK-SNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKL--IVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C P  GDLLIGR   L ASSTCG+   E +C+V  S    + KC ICDS +PY   ++T SHRIENVV+   P     WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V++      +  +D Y  + ++ +  ITN+R++F++LHT GD  +D    I+ KYYYAI + ++RG C CYGHAS+C   +G    V+ MV+G C C+HNTKG +CE+C DFY+D PW PA+  S+N C+KC CN HS+ CHFD  VY  +   SGGVCD+CQHNT  +NCE+CK  +Y++    I     C  C+CD  G++   IC +  +  +GL AG C CK NVEG +CD+CK GF+  N  +  GC  C C  +GT+     CDS  G C+CK FVTG  C  C   ++ LSN +++GC  C C   GS DN  C   SG+C C+    G +C+E++S +Y   ++  TY                PL H +      I    V +  Y  F I     +M+ +D  I             V+++   GK    S            ++ L   SRYI +P   C EK L     + L  +++ SN                 K             +  N+         CL N  ++V +   D     + T +       KC+C+  GS ++ C+  GGQCQC PNV G+ C +CA  ++GF   GCK C+CD+ GS +  C+ +TG+C C  G  G+ CD C PGYW FP C  C+CN  +  C++ TG+C NCK +S GY+C+ C +GYYGD     G  C+ C CP G  S +  + GC     T    C C  GY+G  CD C + +FGN     G CQPC C+ NID     +C+ ++G C KCL++T G NC++C  GY+GN   + C +CVCN++GT     + +    CN   G+CPCLPNV+G  CDRC    +NL+S  GC PC CD    +L  SCN+ TGQC C  G  G+ C+ C++ FWG+P     C  C C+  G    QCNR  G C CK G+ G  CD C +G  G  P C+ C  C+  WD  +  + N   +L N ++ + +S V  P +       +++ ++ ++ I  + P    +  I N  E+  +    ++  + +     +       ++  + KA+      +   KI +V GA + + K  +  L           N   I +      +E+ N+   NL   +++ ++   L++E++ N   +  + ++  T   S  L+C +  CGG+ CK D   R       C G      + + +     T +   L E  +       SK + ++ ++ E    +   ++   + T+  +     +  NL+ +I+ +L    ADL   E++   + K ++     ++  L ++IR R+  L+ V+ IL +S  +  + +     A  + +  + +  ++  +        K +   ++ +     A   +KG    +   E+EA   +  ++  T+R+  L+  I  + K  +   Q     ++       N     KV+  + +N +K      +K +E  +    K+  L  + K      + NKKL  I D E   +   + ++EK  +L+ L++ + +
Sbjct:   27 CAEGSCYPATGDLLIGRSDQLTASSTCGIQKPESFCIV--SHLQEEKKCFICDSLDPYNEQNNTESHRIENVVTTFAPNRLNLWWQSENGLENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWKIYRYFAYDCETSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIYRVLDPAFRIDDPYSLRIKS-MLRITNLRIKFLKLHTLGDNLLDSRVEIKEKYYYAIYDMVVRGNCFCYGHASECAPVKGYSDNVEGMVHGRCVCRHNTKGLNCEQCLDFYHDLPWRPAEGRSSNACKKCNCNEHSTHCHFDMAVYMSTGNTSGGVCDDCQHNTMGRNCEQCKPFFYQHPDKDIRDPNICQPCNCDPAGSQDGGICDRYSDFSVGLIAGQCRCKLNVEGERCDQCKEGFYDLNAEDPEGCQFCGCNPLGTIPGGNSCDSRNGNCFCKRFVTGRKCDQCAPEFWGLSN-DLDGCRPCDCDHGGSEDN-NCSPESGQCRCRPHMIGRQCNEVESGFYFISLDHYTYEAEYANFGPDVRIVERPLPHDRTPSWTGIGFARVPEGAYLEFHINDIPTSME-YDLLIRYEPQLPEQWEEAVITVIRPGKIPTSSRCGNTVPSDDNQSVALPPGSRYITLPRPICFEKGLNYTIRLELPRYSVNSNVENPYTLIDSIVLLPHVKSLDIFSMGGSGDDVTTNTAWQTFQRYRCLENSQSVVKTPLTDVCKNFLFTISALLHK--KCQCDPQGSLSSVCDPNGGQCQCRPNVIGRNCNKCAPGTFGFGPNGCKPCECDVRGSSHPFCHTETGQCPCIHGAFGRQCDVCLPGYWGFPSCRQCQCNGHAEDCNALTGECTNCKDHSEGYSCERCLSGYYGDPRLGSGDHCRPCPCPDGPGSERQFASGCYKDPTTLQVVCSCNMGYTGIRCDGCASGYFGNPEEIGGVCQPCHCNNNIDMSDSLACHKQSGLCLKCLYHTEGINCQECQLGYYGNAIQQDCRRCVCNYLGTEQENCSGEIDCHCNRTNGQCPCLPNVIGQSCDRCAANTWNLASGTGCEPCACDTN-RSLGLSCNEFTGQCQCMPGFGGRDCSECQELFWGNPDI--ECRACDCDSRGIQTSQCNRATGHCICKEGVEGVRCDKCARGYSGAFPYCTPCHKCFALWDIIIQELSNRTKQLLNRANDLKISGVIGPYQ--QTVDKVQEKLEEIRSILAHNPAAQPLKNIENLFEEAEKNLNQLFLKSEVSQKVDEKLDALQADAESFGKALKELGDQLEFMKISNVQGAMDSINKYFQMSLEAEEMVNASVSNPDSIIEHSAATRQEVENLINENLSQFKKEQEEQTRLLDELAGNGQSLDLSSLSEKTCGNSPGLLCEDSECGGLNCKTDDGKRKC-GGPGCGGLVTVAHSAWKTASSFDTEIQNALAEVEEL------SKMVAESKLRAEEAKQSAQDVLTKANATKEKVNQSNEDLRNLIKQIREFLMQDGADLDSIEAVASEVLKMDMPTTPEQLQKLTEEIRERVESLSGVDTILKQSAGDIARAEALLDEAKESSKSAADIKATVDAVKEALMEAGKAQSAAEKAI---KRADDDIKGTNDLLTSIESEAAVSEETLNNATKRLVQLENNIDDLMKKSAANSQTANQVEKSVHEVKANANGAKKVLDGELTNKYKTVEDLIAKKAEDSEEARRKAQELQKEAKG--LLEQANKKLDTIKDLEKTYEGNERILEEKAKQLVQLEETVRA 1753          
BLAST of Netrin-4 vs. Ensembl Mouse
Match: Lamb1 (laminin B1 [Source:MGI Symbol;Acc:MGI:96743])

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 547/1770 (30.90%), Postives = 871/1770 (49.21%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE--------------IKINLPP--------VSKSGYYNFVITTDTKNMQF-----FDSFI------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG-----------------ECL-NYANLVSSKKCDF-LNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKW----QGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDK-LHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDI------------IISNFSEKLSRLKYYVY------NSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG-------ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFN-----GVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKP-ESEYNTTIKLI--DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVN---KSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C P  GDLLIGR   L  +STCGL   E YC+V+     +K  C ICDS++PY    +  SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+ W  Y YF+ +C   FP I       +++++C S +S I PS  G V+F A    +   D Y  + +N +  ITN+R++FV+LHT GD  +D    IR KYYYA+ + ++RG C CYGHAS+C   +G   +V+ MV+G C C+HNTKG +CE C DFY+D PW PA+  ++N C+KC CN HSSSCHFD  V+  +  +SGGVCDNCQHNT  +NCE+CK  Y+++    I     C  C CD  G++   IC    +  +GL AG C CK +VEG +CD CK GF+  +  +  GC  C C  +GT+     CDS TG CYCK  VTG  C  C   ++ LSN +++GC  C C + G   N +C + SG+C C     G +C+E++S +Y     + +   +E              I+  +P         V +  Y  F I     +M++     ++  +       V+++   GK    S             + L   SRY+V+P   C EK +     + L  +T   ++   P      ++ +    S     V G                  CL N  ++V +   D   N   S + +     + C+C+  GS ++ C+  GGQCQC PNV G+TC RCA  ++GF   GCK C C L GS ++ C   TG+C C +G+  + CD C PGYW FP C  C+CN  +  CD+ TG+CL+C+  + G+NC+ C  GYYGD     G  C+ C CP G  S +  +  C     T    C+C  GY G  CD C +  FGN     G+CQPC+C  NID    ++C+ +TG C KCL++T G +C+ C  GY+G+   + C KCVCN++GT  +        C+  TG+C CLPNV+G  CDRC    + L+S  GC PCNC+    +   SCN+ TGQC C  G  G+ C+ C++ FWGDP     C  C C+  G    QC+++ G C C  G+ G  CD C +G  G  P+C+ C  C+  WD  +  + N   K L  +  + +S V  P    +   S+E+ +  +K+I    P    +            +  + +EK+++++  +       NS   +    Q    +++ +       +   K  D+ GA + + K  +  L          ++     +   L +D++    E+L        +++ ++   L++E++  + + +      +TC T   ++   CSE  CGG  C+ D+  +           +        ++  DR  +S  L E  Q       SK + +A V+  E++ N    L+  + T+  +     +  NL+ +I+ +L   SADL   E++   + K E+     ++  L + IR R+  L+ V  IL +S  +  + ++  + A RA +  + +  +   +       +K ++  ++ +     A   ++G    +   E+E    +  ++  ++RI  L+  + ++ +  +    + +  ++   +  +N   D K  ++      Y K++S    K  E   +   K+  L ++ K    +     +L+ D E K +   K +++K   L+ L+ ++ S
Sbjct:   78 CAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKK--CFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQN-LLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSN-DLDGCRPCDC-DLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCNCNA-AHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDV--ECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGVIGPYR--ETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRV----EDLMLERESPFKEQQEEQARLLDELAGKLQSLDLSAVAQMTCGTPPGAD---CSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVLS-ALAEVEQL------SKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAI---KQADEDIQGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNAD-DVKKTLDGELDEKYKKVESLIAQKTEESADA-RRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQKYLEDKAQELVRLEGEVRS 1818          
BLAST of Netrin-4 vs. Ensembl Mouse
Match: Lamb1 (laminin B1 [Source:MGI Symbol;Acc:MGI:96743])

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 546/1767 (30.90%), Postives = 868/1767 (49.12%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE--------------IKINLPP--------VSKSGYYNFVITTDTKNMQF-----FDSFI------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG-----------------ECL-NYANLVSSKKCDF-LNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKW----QGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDK-LHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDI------------IISNFSEKLSRLKYYVY------NSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG-------ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNP--LMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKP-ESEYNTTIKLI--DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVN---KSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C P  GDLLIGR   L  +STCGL   E YC+V+     +K  C ICDS++PY    +  SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+ W  Y YF+ +C   FP I       +++++C S +S I PS  G V+F A    +   D Y  + +N +  ITN+R++FV+LHT GD  +D    IR KYYYA+ + ++RG C CYGHAS+C   +G   +V+ MV+G C C+HNTKG +CE C DFY+D PW PA+  ++N C+KC CN HSSSCHFD  V+  +  +SGGVCDNCQHNT  +NCE+CK  Y+++    I     C  C CD  G++   IC    +  +GL AG C CK +VEG +CD CK GF+  +  +  GC  C C  +GT+     CDS TG CYCK  VTG  C  C   ++ LSN +++GC  C C + G   N +C + SG+C C     G +C+E++S +Y     + +   +E              I+  +P         V +  Y  F I     +M++     ++  +       V+++   GK    S             + L   SRY+V+P   C EK +     + L  +T   ++   P      ++ +    S     V G                  CL N  ++V +   D   N   S + +     + C+C+  GS ++ C+  GGQCQC PNV G+TC RCA  ++GF   GCK C C L GS ++ C   TG+C C +G+  + CD C PGYW FP C  C+CN  +  CD+ TG+CL+C+  + G+NC+ C  GYYGD     G  C+ C CP G  S +  +  C     T    C+C  GY G  CD C +  FGN     G+CQPC+C  NID    ++C+ +TG C KCL++T G +C+ C  GY+G+   + C KCVCN++GT  +        C+  TG+C CLPNV+G  CDRC    + L+S  GC PCNC+    +   SCN+ TGQC C  G  G+ C+ C++ FWGDP     C  C C+  G    QC+++ G C C  G+ G  CD C +G  G  P+C+ C  C+  WD  +  + N   K L  +  + +S V  P    +   S+E+ +  +K+I    P    +            +  + +EK+++++  +       NS   +    Q    +++ +       +   K  D+ GA + + K  +  L          ++     +   L +D++    E+L        +++ ++   L++E++  + + +      +T   P    CSE  CGG  C+ D+  +           +        ++  DR  +S  L E  Q       SK + +A V+  E++ N    L+  + T+  +     +  NL+ +I+ +L   SADL   E++   + K E+     ++  L + IR R+  L+ V  IL +S  +  + ++  + A RA +  + +  +   +       +K ++  ++ +     A   ++G    +   E+E    +  ++  ++RI  L+  + ++ +  +    + +  ++   +  +N   D K  ++      Y K++S    K  E   +   K+  L ++ K    +     +L+ D E K +   K +++K   L+ L+ ++ S
Sbjct:   30 CAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKK--CFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQN-LLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSN-DLDGCRPCDC-DLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCNCNA-AHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDV--ECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGVIGPYR--ETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRV----EDLMLERESPFKEQQEEQARLLDELAGKLQSLDLSAVAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVLS-ALAEVEQL------SKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAI---KQADEDIQGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNAD-DVKKTLDGELDEKYKKVESLIAQKTEESADA-RRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQKYLEDKAQELVRLEGEVRS 1770          
BLAST of Netrin-4 vs. Ensembl Mouse
Match: Lamb2 (laminin, beta 2 [Source:MGI Symbol;Acc:MGI:99916])

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 431/1169 (36.87%), Postives = 626/1169 (53.55%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE-MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEW---YIEKPTYP--------LEHLKEIKIN--LPPVSKSGY--------YNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQS-------YQDTMQ--LIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXX----------------------XXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGI-----CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFL 3410
            C +  C P  GDLL+GR   L ASSTCGL + + YC+V+      + KC +CDS+ P+    + +SHRI+NVV+   PQ    WWQS +GV  V+I++  E+EF FT   + FKT+RPAAM +ERS D+GRTW+ Y YFS +C  DFP IP       ++V+C S +S I PS  G V++          D Y ++ +N +  ITN+RV   RLHT GD  +D    IR KYYYA+ E +IRG C CYGHAS+C    G     E MV+G C C+HNT+G +CE+C+DFY D PW PA+   T+ CRKCECN H+ SCHFD  VY  S  +SGGVCD CQHNT  ++CE C+  +YR+    +     C  C CD +G++    C    +  LGL +G C CKE+V G +C +C+ GF+  + ++  GC +C C   GT+     CDSS+G C+CK  VTG+ C  C  G++ LS+ ++ GC  C C   G+ D + CD+ +G+C C+    G RC++++  +   +++  T+         LE ++ +  N   P  +  G+          F++T+  + M  +D  +            + L +   G  S  S         D +Q  L  ++R++V P   CLE  +   L +  I +  +  P                               L    + +  +   E L  +    S+ C  L   IS + +  +  + C+C+  GS ++ C+  GGQC+C P V G+ C+ CA+  YGF   GC+ C+C   G+L++ C   +G+C CR G  G  CD C+ G W FP C  C CN  +  CD+ TG CL C+  + G +C+ C  G++GD     G  C+ C CP G  S ++ +  C     +    C C++GY+G  C+ C   HFG+     G CQ C CSGNID    D+C+  TG+C +CL NT G +C  C  G+ G  A ++C +C CN +GT+ +         C+  TG+CPCLP+V GL CD C   F+N +S  GC PC C +P  A   +CN+ TGQC+C AG  G+ C+ C++ +WGDP     C  C C+  G    QC+R+ G C C+PG++G  CD C +G  G  P C  C  C+  WD  +
Sbjct:   45 CSRGSCYPATGDLLVGRADRLTASSTCGLHSPQPYCIVSHLQD--EKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQN-LLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHTHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRDPTKDMRDPAVCRPCDCDPMGSQDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASDPRGCQRCQCNSRGTVPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSH-DLLGCRPCDCDVGGALDPQ-CDEATGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEAAQGQGLEVVERLVTNRETPSWTGPGFVRLREGQEVEFLVTSLPRAMD-YDLLLRWEPQVPEQWAELELMVQRPGPVSAHSPCGHVLPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKLKLKLIGTGGRAQPETSYSGLLIDSLVLQPHVLVLEMFSGGDAAALERRTTFERYRCHEEGLMPSKAPLSETCAPLL--ISVSALIYNGALPCQCDPQGSLSSECSPHGGQCRCKPGVVGRRCDVCATGYYGFGPAGCQACQCSPDGALSALCEGTSGQCPCRPGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGACLGCRDYTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCQCREGYTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHNTEGPHCGYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHCAPNFWNFTSGRGCQPCAC-HPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQ--CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDRVV 1202          
BLAST of Netrin-4 vs. Ensembl Mouse
Match: Lama2 (laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912])

HSP 1 Score: 363.614 bits (932), Expect = 4.218e-103
Identity = 318/1137 (27.97%), Postives = 489/1137 (43.01%), Query Frame = 3
Query:  168 LLIGRESFLRASSTCGLTNSERYCVVTTSDSG---RKSKCTICD--SKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMS---GV--HNVSIEISFESEFQFTFTHLRFK-TYRPAAMYIERSKD--YGRTWNKYAYFSDNCP---RDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTF-GDWKV-------DDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQ-------SRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQ-EPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKS---GYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLT---VFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDAR----GCKKCKCDLTGSLNSQCYNDTGKCL-CREGVEGQHCDTCKPGYWNFPF------CHSCKC------NQMSTTCDSKTGKCLNCKGNSFGYN---CQNCENGYYGDTS-RGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFT---CMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWL 3392
            L +   + +  ++TCG    E YC +     G   R  +C IC+  S NPYQR   T++   +N           WWQS S   GV  H V+I +  +  FQ  +  ++   + RP    +ERS D    + W  +A     C      +P       +  +EV+CTS +S I P E G +  S        +D   + +  + T+   IR++F R+ T   D  +       + +P +  +YYY++ +  + G C CYGHA  C       + +      C+C+HNT G+ C++C   ++  PW      + +EC  C C+  +  C++D  V  +        + + GGVC NC HNT   NCE C  G++R   V+ N  + C  CHCD  G+    +C++ E     GL  G C CK    G  CD+C  G+  +       C  CNC  +G+      D   G C CK  V G DCS CK G+FNL   N  GC  C CS   +R   +   Y      +  +       I+    ++ P  P    ++I I+     KS   GYY         N        +  +I +  +      +  +QL+     I+        DL I      V+   S   I    +      +   N   TRK     L     V  +    +   +  + + +   +  +  V    +         CQC P  SG +CE C       +       C+ C+C    +    C + TG+CL C++   G +C+ C PG++  P       C  C C      N  S TC       L C     GY    C+ C  GY+G  S  G  C+ CQC       N+++  S+  +  + +    +CK G +G++C+ C   +FG+A++    CQPCRC  NI+    + C+++TG+C +C  N  G +C++C    FG    R C  C CN  G+ S         +G+C C P V G +CDRC   +FN   + GC+ C+C +    L ++C+  TGQC C    +G+ C+ C    WG  + + GC  C C+  GS+  QCN N G C C P  +G  C  C +G     P C+ C DC+L
Sbjct:   40 LNLASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNT----------WWQSPSIKNGVEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDP--SPELLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNKSR------CECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNLSLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGS-LSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGY-----PDCQPCNCSGLGSTNE---DPCVGPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWYLTDLSGRIRMAPQLDNPDSP----QQISISNSEARKSLLDGYYWSAPPPYLGNRLPAVGGQLSFTISYDLEEEEDDTEKILQLM-----IIFEG----NDLRISTAYKEVYLEPSEEHIEEVSLKEEAFTIHGTNLPVTRKDFMIVLTNLERVLMQ----ITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVCQCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQC---FAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQC-------NDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAK-NCQPCRC--NINGSFSEICHTRTGQC-ECRPNVQGRHCDECKPETFGLQLGRGCLPCNCNSFGSKS----FDCEASGQCWCQPGVAGKKCDRCAHGYFNF-QEGGCIACDCSH----LGNNCDPKTGQCICPPNTTGEKCSECLPNTWGH-SIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPKFSGMKCSECSRG-HWNYPLCTLC-DCFL 1106          

HSP 2 Score: 160.229 bits (404), Expect = 9.059e-39
Identity = 156/570 (27.37%), Postives = 230/570 (40.35%), Query Frame = 3
Query: 2205 CNKIGGQC-QCLPNVSGKTCERCASESYGFDARG----CKKCKCDL---TGSLNSQCYNDTGKCL----CREGVEGQHCDTCKPGYWNFPF-----CHSCKCN-----QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRK-----CLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNR---------NNGVCRCKPGITGRNCDMCMK---GTDGKMP-NCSSC------GDC---------WLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVY--NSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAF 3743
            C+ I G+C  C  +  G  C  C    YG   RG    C+ C C L   + + +  C+ D    L    C  G  G  C+ C  GY+  P      C  C+CN      +  +CDS +G CL CK  + G  C+ C +GY+GD      C+ C+C       N +   S I +T    C C+    G+ CD+C+   FG  + +   C PC C         +S  SK+ +C       C    +G  C++C  GYF N     C  C C+H+G N      C+ +TG+C C PN  G +C  C    +  S   GC  CNC   +G+L   CN  TGQC C    SG  C+ C  G W  P     CT C C L G+    C+            G C CK  + G +CD C     G D K P  CSSC        C         W+       ++    + L +++      + F K   ++   +++  + L     Y+ +              +LKY +Y    +   F T +  +I I   T     +I+++    + G  
Sbjct:  762 CDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRC-------NINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRG--CLPCNC---------NSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYF-NFQEGGCIACDCSHLGNN------CDPKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCST-VGSLASQCNVNTGQCSCHPKFSGMKCSECSRGHWNYPL----CTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSEAKGLIRTWVTLSDEQTILPLVDEALQHTT---TKGIAFQKP--EIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDETGFATYKPQVI-IRGGTPTHARIITRHMAAPLIGQL 1295          

HSP 3 Score: 132.88 bits (333), Expect = 2.019e-30
Identity = 127/443 (28.67%), Postives = 196/443 (44.24%), Query Frame = 3
Query: 2061 VLGECLNYANLVSSKKCD----FLNAEISTNTVTKSDPIKCKCNVTGSR-NNNCN---KIGGQC-QCLPNVSGKTCERCASESYG---FDARGCKKCKCD--LTGSLNSQCYNDTGKCL-CREGVEGQHCDTCKPGYW----NFPFCHSCKCN---QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYP--------IGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWG-DPTKLNGCTKCYCNLDGSVFKQCNRNNGVCR 3296
            + GECLN  +      C+        + +  +     P  C  N+  +  +  C+    +G  C +C    +G  CERCA   +G        C+ C+C+  L  S+   C + +G CL C+ G  G++C+ C  GY+    N   C  C+CN     S  C ++TG+C  C+ N  G +C  C+   +G    G  C  C C        NS G        +  C C+ G +G+ CD+C   +F     ++G C  C CS      + ++C+ KTG+C  C  NT+G  C +C+   +G+  V  C  C C+ +G+ +     CN  TG+C C P   G++C  C    +N      C  C+C  P        +     SC+  TGQC C+    G  C+ C+ G +G D     GC+ CYC     V  QC+   G+ R
Sbjct:  765 ITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQC-ECRPNVQGRHCDECKPETFG-LQLGRGCLPCNC--------NSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFN---FQEGGCIACDCS-----HLGNNCDPKTGQC-ICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQ---CNVNTGQCSCHPKFSGMKCSECSRGHWNYPL---CTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCF---GVTSQCSEAKGLIR 1179          

HSP 4 Score: 122.865 bits (307), Expect = 2.419e-27
Identity = 87/280 (31.07%), Postives = 127/280 (45.36%), Query Frame = 3
Query: 2658 TTAFTCMCKKGYSGQFCDQCETNHFG-NAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGN---GAVRTCTKCVCNHMGTNSKWQGICNHETG------KCPCLPNVVGLQCDRCQDKFFNLSSQIG--CLPCNC----DYPIGALNHSCNQLTGQCY-CQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDG-----------------KMPNCSSCGDCWLQ 3395
            T    C C  GYSG  C+ C   H   N     G C+PC+C  +      ++C+  TGEC  C  +T G  C +C+ G++G+   G+   C  C C     ++ +   C+ +        +CP      G +C+RC + +F   S  G  C PC C    DY I     SC+ L+G C  C+ G +G+ C  C DG++GD      C  C CN++GS  + C+   G C C+P + GR+CD C   T G                 K  +C + G CW Q
Sbjct:  715 TDVEVCQCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHA-----EACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPI--GYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPG---SCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRGCLPCNCNSFGSKSFDCEASGQCWCQ 984          

HSP 5 Score: 81.2629 bits (199), Expect = 1.163e-14
Identity = 77/259 (29.73%), Postives = 110/259 (42.47%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCD---------KYSGKCLCKNGFAGIRCDEIK 1682
            G C+C+ N +G+HC++CK    ++  L   +     C  C CNS  S   FD          + G C  CQ     K C+RC  GY+            C+ C C  LG             +     G CIC  N  G +C +C    W  +    TGC  CNC  +G+L ++ C+ +TG+C C    +G  CS C  G++N        C+LC C   G+ D  TCD           +G+C CK    G+ CD  +
Sbjct:  931 GQCECRPNVQGRHCDECKP---ETFGLQLGRG----CLPCNCNSFGSK-SFD--------CEASGQC-WCQPGVAGKKCDRCAHGYFNF------QEGGCIACDCSHLGN------------NCDPKTGQCICPPNTTGEKCSECLPNTWGHS--IVTGCKVCNCSTVGSLASQ-CNVNTGQCSCHPKFSGMKCSECSRGHWNYPL-----CTLCDCFLPGT-DATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCR 1145          
BLAST of Netrin-4 vs. Ensembl Mouse
Match: Lamb3 (laminin, beta 3 [Source:MGI Symbol;Acc:MGI:99915])

HSP 1 Score: 353.984 bits (907), Expect = 8.132e-101
Identity = 194/538 (36.06%), Postives = 284/538 (52.79%), Query Frame = 3
Query:   63 MTLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLC--TSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRC 1670
            MT  ++  + +  ++    +   C +  C P  GDLLIGR   LRASSTCGLT  E YC   T     + KC  CDS+ P     + +SHR+ENV S     P RWWQS + V  VS+++  +   Q     + FK   PA M IERS D+G+TW  Y Y + +C   FP + + +  N  +V C   S+  +   + G   L   D +  +      +KK  ++  ITN+RV F +L       V    +     Y+A+S+  ++G C C+GHA +C    G       V  VC CQHNT G +C++C  FYN+ PW PA+   T+EC++C+CN HS +CHFDP V+  S+  +GGVCDNC+ +TE KNCERC+  Y+RN   +    +TC+ C CD  G    + C +          G C+CKE V+G +CD CK GF         GC  C+C ++G  ++  C+  TG+C C   V G  C  C   ++ L++    GC  C C    S  ++ C++++G+C C+ GF G+ C
Sbjct:    1 MTAFFLLWLALPGFLC---AQQACSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYC---TQYGQWQMKCCKCDSRLP----RNYNSHRVENVASS--SGPMRWWQSQNDVSPVSLQLDLDKRMQLQDIMMDFKGLTPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQRPNGHLTGGKVQLNLMDLASAI--PASQSKKIQELGDITNLRVNFTKLAP-----VPQRGSYPPSAYFAVSQLRLQGSCFCHGHADRCAPNPGGSTTAVQVNNVCVCQHNTAGPNCDRCAPFYNNRPWRPAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNGGVCDNCRDHTEGKNCERCQLHYFRNRRPSAPIHETCIPCECDPDGAVQGAPCDR--------LTGQCVCKEYVQGERCDLCKPGFTGLTFANPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASG--LGCEPCACDPRNSLSSQ-CNQFTGQCPCREGFGGLTC 508          

HSP 2 Score: 142.895 bits (359), Expect = 1.464e-33
Identity = 116/415 (27.95%), Postives = 174/415 (41.93%), Query Frame = 3
Query: 2370 CLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGN---AISKDGTCQPCRCSGNIDQRIEDS-CNSKTGECRKCLFNTSGFNCEKCVSGYFGN--GAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNN-----CKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNS-----SGVFMSNVKFPKEIDDVCTSLEQNMKSLK 3536
            C+C+    G +CD C P Y N P+          C  C CN  S TC          +G + G     C+N                                          C+    G+ C++C+ ++F N   +     TC PC C  + D  ++ + C+  TG+C  C     G  C+ C  G+ G      + C  C C+ +G        C  ETG+C CLPNVVG +CD+C    + L+S +GC PC CD P  +L+  CNQ TGQC C+ G  G  C++     C D  +G      GC  C C+  G+    C++ +G C C+PG TG  CD C +G   + P C +C  C+  +D  L         L N+     +G  + +      + D  + +EQ  + L+
Sbjct:  276 CVCQHNTAGPNCDRCAPFYNNRPWRPAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNGGV----CDN------------------------------------------CRDHTEGKNCERCQLHYFRNRRPSAPIHETCIPCEC--DPDGAVQGAPCDRLTGQC-VCKEYVQGERCDLCKPGFTGLTFANPKGCHACDCSILGARKDMP--CEEETGRCLCLPNVVGPKCDQCAPSHWKLASGLGCEPCACD-PRNSLSSQCNQFTGQCPCREGFGGLTCSSAAIRQCPDQTYGHVA--TGCRACDCDFRGTEGPGCDKASGRCLCRPGFTGPRCDQCQRGHCDRYPVCVACHSCFQAYDTDLQEQARRLHSLRNATEGLWTGTGLEDHGLASRLLDAKSKIEQIRQILE 636          

HSP 3 Score: 103.99 bits (258), Expect = 1.330e-21
Identity = 70/227 (30.84%), Postives = 111/227 (48.90%), Query Frame = 3
Query: 1050 CECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQ---TCLKCHCDSLGTKFPSICIQEPEL---DLGLNAGHCI-CKENVEGNQCDKCKIGFWK---FNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE-IKSEWYI 1697
            C C+ H+  C  +P     + +++  VC  CQHNT   NC+RC + +Y N        Q    C +C C+         C  +P +     G N G C  C+++ EG  C++C++ +++    +      C+ C C   G ++   CD  TG+C CK +V G  C  CK G+  L+ AN  GC  C CS  G+R +  C++ +G+CLC     G +CD+   S W +
Sbjct:  250 CFCHGHADRCAPNPGGSTTAVQVNN-VC-VCQHNTAGPNCDRC-APFYNNRPWRPAEGQDTHECQRCDCNG----HSETCHFDPAVFAASQGTNGGVCDNCRDHTEGKNCERCQLHYFRNRRPSAPIHETCIPCECDPDGAVQGAPCDRLTGQCVCKEYVQGERCDLCKPGFTGLTFANPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKL 469          

HSP 4 Score: 89.3521 bits (220), Expect = 3.586e-17
Identity = 62/205 (30.24%), Postives = 95/205 (46.34%), Query Frame = 3
Query: 2163 IKCKCNVTGS-RNNNCNKIGGQCQCLPNVSGKTCERCASESYGF---DARGCKKCKCDLTGSL-NSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF---CHSCKC---NQMSTTCDSKTGKCLNCKGNSFGYNC-----QNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNH 2729
            I C+C+  G+ +   C+++ GQC C   V G+ C+ C     G    + +GC  C C + G+  +  C  +TG+CLC   V G  CD C P +W       C  C C   N +S+ C+  TG+C  C+    G  C     + C +  YG  + G  C+ C C           GC    +  +  C+C+ G++G  CDQC+  H
Sbjct:  374 IPCECDPDGAVQGAPCDRLTGQCVCKEYVQGERCDLCKPGFTGLTFANPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASGLGCEPCACDPRNSLSSQCNQFTGQC-PCREGFGGLTCSSAAIRQCPDQTYGHVATG--CRACDC---DFRGTEGPGC----DKASGRCLCRPGFTGPRCDQCQRGH 568          

HSP 5 Score: 83.5741 bits (205), Expect = 2.342e-15
Identity = 103/384 (26.82%), Postives = 150/384 (39.06%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCAS--------ESYGFDARGCKKCKC---------DLTGSLNSQCYNDTGKCL-CREGVEGQHCDTCKPGYW-----NFPF---CHSCKCNQ----MSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT---SRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNC-----EKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCD-YPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFW 3200
            +C  N  GS      ++   C C  N +G  C+RCA          + G D   C++C C         D      SQ  N  G C  CR+  EG++C+ C+  Y+     + P    C  C+C+         CD  TG+C+ CK    G  C  C+ G+ G T    +G  C  C C  L + K+      +        C+C     G  CDQC  +H+   ++    C+PC C  +    +   CN  TG+C  C     G  C      +C    +G+ A   C  C C+  GT       C+  +G+C C P   G +CD+CQ               +CD YP+    HSC Q       +  R      N  +G W
Sbjct:  258 RCAPNPGGS--TTAVQVNNVCVCQHNTAGPNCDRCAPFYNNRPWRPAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNG-GVCDNCRDHTEGKNCERCQLHYFRNRRPSAPIHETCIPCECDPDGAVQGAPCDRLTGQCV-CKEYVQGERCDLCKPGFTGLTFANPKG--CHACDCSILGARKD------MPCEEETGRCLCLPNVVGPKCDQCAPSHW--KLASGLGCEPCAC--DPRNSLSSQCNQFTGQC-PCREGFGGLTCSSAAIRQCPDQTYGHVAT-GCRACDCDFRGTEGPG---CDKASGRCLCRPGFTGPRCDQCQRG-------------HCDRYPVCVACHSCFQAYDTDLQEQARRLHSLRNATEGLW 607          
BLAST of Netrin-4 vs. UniProt/SwissProt
Match: sp|P07942|LAMB1_HUMAN (Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2)

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 550/1767 (31.13%), Postives = 870/1767 (49.24%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE--------------IKINLPP--------VSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKD----LPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG-----------------ECL-NYANLVSSKKCDF-LNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT------NSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKN-TFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDI------------IISNFSEKLSRLKYYV------YNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG-------ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNP--LMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLL-LDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASN--SKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C P  GDLLIGR   L  +STCGL   E YC+V+     +K  C IC+S++PY    +  SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FP I       +++++C S +S I PS  G V+F A    +   D Y  + +N +  ITN+R++FV+LHT GD  +D    IR KYYYA+ + ++RG C CYGHAS+C   +G   +V+ MV+G C C+HNTKG +CE C DFY+D PW PA+  ++N C+KC CN HS SCHFD  VY  +  +SGGVCD+CQHNT  +NCE+CK  YY++    I     C +C CD  G++   IC    +   GL AG C CK NVEG  CD CK GF+  +  +  GC  C C  +GT+     CDS TG CYCK  VTG  C  C   ++ LSN +++GC  C C + G   N +C   SG+C C+    G +C+E++  +Y     + L   +E              I+  +P         V +  Y  F I     +M+ +D  I             V+++   G+    S             + L   SRY+V+P   C EK     + + L  +T   ++   P  +   ++ +    S     V G                  CL N  ++V +   D   N   S + +     + C+C+  GS ++ C+  GGQCQC PNV G+TC RCA  ++GF   GCK C+C L GS+N+ C   TG+C C +GV  + CD C PG+W FP C  C+CN  +  CD  TG+CLNC+  + G+NC+ C  GYYGD     G  C+ C CP G  S +  +  C     T    C+C  GY G  CD C + +FGN     G+CQPC+C  NID    ++C+ +TG C KCL++T G +C+ C  GY+G+   + C KCVCN++GT       S  Q  C+  TG+C CLPNV+G  CDRC    + L+S  GC PCNC+    +   SCN+ TGQC C  G  G+ C+ C++ FWGDP     C  C C+  G    QC+++ G C C  G+ G  CD C +G  G  P+C+ C  C+  WD  +  + N T   L  +  + +S V  P    +   S+E+ +  +K+I    P    +            +I + +E +++++  +       NS   + ++ Q    +++N+       +   K  D+ GA + + K  +  L          +E     +   L++D++    E++        ++K ++   L++E++  + + +      +T   P    CSE  CGG  C+ D+  R       C G      N +   + LD+  +S + +   +Q +  ++  +++    K  +E    +   + T+  +     E  NL+ +I+ +L   SADL   E++   + K E+     ++  L + IR R+  L+ V  IL  S  +  + ++  + A RA +  + +  +   +       +K ++  ++ +     A   ++G    +   E+E    +  +   ++RI  L+  + ++ +  +    + +  ++      ++ + D K  ++     K K   N  +K +E       K+  L ++ K    +     +L+ D E K +   + +++K   L  L+ ++ S
Sbjct:   30 CAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKK--CFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQN-LLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSN-DLDGCRPCDC-DLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSME-YDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQ--CDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNA-AHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDV--ECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYR--ETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDRV----EDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKC-GGPGCGGLVTVAHNAWQKAMDLDQDVLSALAE--VEQLSKMVSEAKLRADEAKQSAE--DILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAI---KQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAE-DVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRS 1770          
BLAST of Netrin-4 vs. UniProt/SwissProt
Match: sp|P02469|LAMB1_MOUSE (Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 546/1767 (30.90%), Postives = 868/1767 (49.12%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE--------------IKINLPP--------VSKSGYYNFVITTDTKNMQF-----FDSFI------IVLSIYHVGKSSCQSY---------QDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG-----------------ECL-NYANLVSSKKCDF-LNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKW----QGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDK-LHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDI------------IISNFSEKLSRLKYYVY------NSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG-------ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNP--LMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKP-ESEYNTTIKLI--DVTRGAIQSRRIESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVN---KSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C P  GDLLIGR   L  +STCGL   E YC+V+     +K  C ICDS++PY    +  SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + FKT+RPAAM IERS D+G+ W  Y YF+ +C   FP I       +++++C S +S I PS  G V+F A    +   D Y  + +N +  ITN+R++FV+LHT GD  +D    IR KYYYA+ + ++RG C CYGHAS+C   +G   +V+ MV+G C C+HNTKG +CE C DFY+D PW PA+  ++N C+KC CN HSSSCHFD  V+  +  +SGGVCDNCQHNT  +NCE+CK  Y+++    I     C  C CD  G++   IC    +  +GL AG C CK +VEG +CD CK GF+  +  +  GC  C C  +GT+     CDS TG CYCK  VTG  C  C   ++ LSN +++GC  C C + G   N +C + SG+C C     G +C+E++S +Y     + +   +E              I+  +P         V +  Y  F I     +M++     ++  +       V+++   GK    S             + L   SRY+V+P   C EK +     + L  +T   ++   P      ++ +    S     V G                  CL N  ++V +   D   N   S + +     + C+C+  GS ++ C+  GGQCQC PNV G+TC RCA  ++GF   GCK C C L GS ++ C   TG+C C +G+  + CD C PGYW FP C  C+CN  +  CD+ TG+CL+C+  + G+NC+ C  GYYGD     G  C+ C CP G  S +  +  C     T    C+C  GY G  CD C +  FGN     G+CQPC+C  NID    ++C+ +TG C KCL++T G +C+ C  GY+G+   + C KCVCN++GT  +        C+  TG+C CLPNV+G  CDRC    + L+S  GC PCNC+    +   SCN+ TGQC C  G  G+ C+ C++ FWGDP     C  C C+  G    QC+++ G C C  G+ G  CD C +G  G  P+C+ C  C+  WD  +  + N   K L  +  + +S V  P    +   S+E+ +  +K+I    P    +            +  + +EK+++++  +       NS   +    Q    +++ +       +   K  D+ GA + + K  +  L          ++     +   L +D++    E+L        +++ ++   L++E++  + + +      +T   P    CSE  CGG  C+ D+  +           +        ++  DR  +S  L E  Q       SK + +A V+  E++ N    L+  + T+  +     +  NL+ +I+ +L   SADL   E++   + K E+     ++  L + IR R+  L+ V  IL +S  +  + ++  + A RA +  + +  +   +       +K ++  ++ +     A   ++G    +   E+E    +  ++  ++RI  L+  + ++ +  +    + +  ++   +  +N   D K  ++      Y K++S    K  E   +   K+  L ++ K    +     +L+ D E K +   K +++K   L+ L+ ++ S
Sbjct:   30 CAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKK--CFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQN-LLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSN-DLDGCRPCDC-DLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCNCNA-AHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDV--ECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGVIGPYR--ETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRV----EDLMLERESPFKEQQEEQARLLDELAGKLQSLDLSAVAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVLS-ALAEVEQL------SKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAI---KQADEDIQGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNAD-DVKKTLDGELDEKYKKVESLIAQKTEESADA-RRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQKYLEDKAQELVRLEGEVRS 1770          
BLAST of Netrin-4 vs. UniProt/SwissProt
Match: sp|A4D0S4|LAMB4_HUMAN (Laminin subunit beta-4 OS=Homo sapiens OX=9606 GN=LAMB4 PE=2 SV=1)

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 541/1783 (30.34%), Postives = 859/1783 (48.18%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENV-VSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSA-DTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIR-NKYYYAISEWIIRGRCSCYGHASKCKAKE---GQV-QVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKE----------------------IKINLP----PVSKSG---------------------YYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSC-----QSYQDTMQLIKDSRYIVIPNK-CLEKDLPIVLTVF---TIESNNKXXXXXXXXXXXXXXXXNSTK---TRKVLGE-----CLNYANLVSSK----KCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK------WQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTS----LEQNMKSLKEIKKY--FPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG----ASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSE---------FCGGVGCKPDKCYRHAPMNKYCMGKS-NQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSR---RIESVNLLI-KIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDT-----------------SYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFS-LKGNLFHMFKN----ENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYS 5096
            C +  C+P  GDLL+GR + L ASSTCGL+ +++YC+++  +   + KC ICDS+ PY  +   +SH IENV VS  P    +WWQS +G+ +VSI +  E+ F+F+   L FKT+RPAAM +ERS DYG  W  + YF+ +C   FP+I   +   + +++C S++S I PS GG V+    D S  + N   ++    D+  +TN+R+ F +LHT GD  +    N   +KYYYA+ E I+RG C C GHAS+C+  +   G V     MV+G C CQHNT G +CE+CKDF+ D+PW PA     N CR C CNSHSS CHFD   Y  S  +SGGVC++CQHNTE ++C+RC+  +YR+    I+    C+ C CD  GT    IC+   +  LG  AG C+CKENVEG +CD+CK   +  +  +  GC  C+C  +G+L    CD  TG+C C S+VTG  C  C +GY+ L N +++GCS C C   G+  N  C   +G+C C+    G  C E    ++     + L   +E                      + +  P    PV+ +G                       +F I    +     D  + ++     G   C     QS   +  L   +R +++P   CLE D+   + V+    ++  +     ++   +  +  +NS +   +++ L E     C+  A+ +  +     C+ L   IS +       + CKC+  GS  ++C+++GGQCQC P V G+ C+RC++ SY     GC  C C   GS ++ C   TG+C C   V G+ CD C  GY+ FP CH C CN+ +  CD +TG C NC G + G NC+ C +GYYG+ S G  C+ C CP   SS +  +  C     ++   C C +GY+G  C +C T  +GN       CQPC C+ NID    +SC+  TGEC +CL NT G NC+ C  G++G+   +TC +C C+  G +           +C+  TG CPCLPNV GL CDRC D ++NL    GC  C+CD P  + +  C+QLTGQC C+ G  GK C+ C++ ++GDP     C  C CN  G+    C+ + G+CRC+ G++G+ CD C +G   + P C  C  C+ QWDH +  +      L        +N++  +E   VC +    L  N+  ++ I K+  FP G  + + ++ + + R         I+  N Q  ++   ++  D  +   +KN+   +     E      ++LN     +SE+ K Y +I+   +K         N +          +D L ++ + ++     +    I   N  +C +          CGG  C   K +R       C G   +    L  + L        I++  ++Q     N  +I+    + E   N  ++L +   G I+++     E++NL I K+K +L           L EN+   +I    N ++ +   I S+     N+ + L K + + + C+ ++    R  E+                  + LLN  K   TLN++ Q       Q     AN+  + L  N+  + KN    EN+  + ++ +    +R        +   K+  +    +  K + + A+ +   ++ + V  K  Y  L+  +++  +   +  L K   L D  +      +   + I D E K+Q L+     K  +L +L+D++ +
Sbjct:   23 CNRGACHPTTGDLLVGRNTQLMASSTCGLSRAQKYCILSYLEG--EQKCFICDSRFPYDPYDQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDLEALFRFSHLILTFKTFRPAAMLVERSTDYGHNWKVFKYFAKDCATSFPNITSGQAQGVGDIVCDSKYSDIEPSTGGEVVLKVLDPSFEIENP--YSPYIQDLVTLTNLRINFTKLHTLGDALLGRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGMVHGQCVCQHNTDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCEDCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVAGQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSYVTGAHCEECTVGYWGLGN-HLHGCSPCDCDIGGAYSN-VCSPKNGQCECRPHVTGRSCSEPAPGYFFAPLNFYLYEAEEATTLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFARVLPGAGLRFAVNNIPFPVDFTIAIHYETQSAADWTVQIVVNPPGGSEHCIPKTLQSKPQSFALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLQGESHAHSHVLVDSLGLIPQINSLENFCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLI--ISMSAKLHDGAVACKCHPQGSVGSSCSRLGGQCQCKPLVVGRCCDRCSTGSYDLGHHGCHPCHCHPQGSKDTVCDQVTGQCPCHGEVSGRRCDRCLAGYFGFPSCHPCPCNRFAELCDPETGSCFNCGGFTTGRNCERCIDGYYGNPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNPRISGAPCQPCACNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCRRCSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLVPGRGCQSCDCD-PRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPP--GRCIPCDCNRAGTQKPICDPDTGMCRCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMR----LAANMEDKRETLPVCEADFKDLRGNVSEIERILKHPVFPSGKFLKVKDYHDSVRR--------QIMQLNEQLKAVYEFQDLKDTIER--AKNEADLLLEDLQEEIDLQSSVLNASIADSSENIKKYYHISSSAEKKINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPGNVPCVPLPCGGALCTGRKGHRK------CRGPGCHGSLTLSTNALQKAQEAKSIIRNLDKQVRGLKN--QIESISEQAEVSKNNALQLRE-KLGNIRNQSDSEEENINLFIKKVKNFL-----------LEENVPPEDIEKVANGVLDIHLPIPSQ-----NLTDELVKIQKHMQLCEDYRTDENRLNEEADGAQKLLVKAKAAEKAANILLNLDK---TLNQLQQ------AQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELELAKQRSGLEDGLSLLQTKLQRHQDHAVNAKVQAESAQHQAGSLEKEFVELKKQYAILQRKTST--TGLTKETLGKVKQLKDAAEKLAGDTEAKIRRITDLERKIQDLNLSRQAKADQLRILEDQVVA 1744          
BLAST of Netrin-4 vs. UniProt/SwissProt
Match: sp|P55268|LAMB2_HUMAN (Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2)

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 461/1392 (33.12%), Postives = 709/1392 (50.93%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE-MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---------------------IEKPTYP-------------LEHLKEIKINLPPVSKSGYYNFVITTDTK-NMQFFDSFIIVLSIYHVGKSSCQSY----QDTMQ--LIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYAN-------------------LVSSK-----KCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKW-----QGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSS---------GVFMSNVKFPKEIDDV-----------CTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQ------QNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMD--NLINEMSKNVITFNGVTCNTITESNPLMC 3992
            C +  C P  GDLL+GR   L ASSTCGL   + YC+V+      + KC +CDS+ P+    + HSHRI+NVV+   PQ    WWQS +G+  V+I++  E+EF FT   + FKT+RPAAM +ERS D+GRTW+ Y YFS +C  DFP +P     + ++V+C S +S I PS  G V++          D Y ++ +N +  ITN+RV   RLHT GD  +D    IR KYYYA+ E ++RG C CYGHAS+C    G     E MV+G C C+HNT+G +CE+C+DFY D PW PA+   ++ CRKCEC+ H+ SCHFD  VY  S  +SGGVCD CQHNT  ++CE C+  +YR+    +     C  C CD +G++    C    +  LGL +G C CKE+V G +C +C+ GF+  + ++  GC +C C   GT+  +  CD ++G CYCK  VTG  C  C  G++ LS+ ++ GC  C C   G+ D + CD+ +G+C C+    G RC++++  ++                     +E+   P             L+  + ++  +  V K+  Y+ ++  + +   Q+ +  +IV     V   S   +     D +Q  L   +RY++ PN  CLE  +   L +  + +     P         L+D      R ++ E  +  +                   LV SK      C  L   IS +T+  +  + C+CN  GS ++ CN  GGQC C P V G+ C+ CA   YGF   GC+ C+C   G+L+S C   +G+CLCR G  G  CD C+ G W FP C  C CN  +  C++ TG CL C+ ++ G +C+ C  G++GD     G  C+ C CP G  S ++ +  C     +    C C+ GY+G  C+ C   HFG+     G CQ C CSGNID    D+C+  TG+C +CL +T G +C  C  G+ G  A ++C +C CN +GTN +      Q  C+  +G+CPCLPNV G  CDRC   F+NL+S  GC PC C +P  A   +CN+ TGQC+C+AG  G+ C+ C++  WGDP     C  C C+  G    QC+R  G C C+PG++G  CD C +G  G  P C  C  C+  WD  +  +     +L   +         G F S+    +E   +             S  Q +++ +E+++         I   +E L++L+  + +    +FN        +   + +  +       +   K  +  GA++    S+++  + ++E+++      L        +   R+     +  + +D +  ++ N+ +   ++ +  T  ++T+ N L+C
Sbjct:   42 CSRGSCYPATGDLLVGRADRLTASSTCGLNGPQPYCIVSHLQD--EKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRRAAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQN-LLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDGGRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPGSTPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSH-DLLGCRPCDCDVGGALDPQ-CDEGTGQCHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFVRLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPKDDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVLLPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLL--ISLSTLIYNGALPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALSSLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGYTGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCAPNFWNLTSGHGCQPCAC-HPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQ--CHACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRVVQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVEATEELRRE--------IGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYD----SIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTL-SLTDINELVC 1410          
BLAST of Netrin-4 vs. UniProt/SwissProt
Match: sp|P15800|LAMB2_RAT (Laminin subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Lamb2 PE=1 SV=1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 435/1185 (36.71%), Postives = 630/1185 (53.16%), Query Frame = 3
Query:   96 ARYILEIESDNV--CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE-MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEW---YIEKPTYP--------LEHLKEIKINLPPVSKSGY----------YNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQS-------YQDTMQ--LIKDSRYIVIPNK-CLEKDLP------------------------IVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGI-----CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFL 3410
            A  + ++ S +V  C +  C P  GDLL+GR   L ASSTCGL + + YC+V+      + KC +CDS+ P+    + +SHRI+NVV+   PQ    WWQS +GV  V+I++  E+EF FT   + FKT+RPAAM +ERS D+GRTW  Y YFS +C  DFP IP       ++V+C S +S I PS  G V++          D Y ++ +N +  ITN+RV   RLHT GD  +D    IR KYYYA+ E +IRG C CYGHAS+C    G     E MV+G C C+HNT+G +CE+C+DFY D PW PA+   T+ CRKCECN HS SCHFD  VY  S  +SGGVCD CQHNT  ++CE C+  +YR+    +     C  C CD +G++    C    +  LGL +G C CKE+V G +C +C+ GF+  + +   GC +C C   GT+     CDSS+G C+CK  VTG+ C  C  G++ LS+ ++ GC  C C   G+ D + CD+ +G+C C+    G RC++++  +   +++  T+         LE ++ +  N    S +G             F++T+  + M  +D  +            + L +   G  S  S         D +Q  L  ++R +V P   CLE  L                         I++    ++ +  +           L    + +  +   E L  +    S+ C  L   IS +++  +  + C+C+  GS ++ CN  GGQC+C P V G+ C+ CA+  YGF   GC+ C+C   G+L++ C   +G+CLCR G  G  CD C+ G W FP C  C CN  +  CD+ TG CL C+  + G +C+ C  G++GD     G  C+ C CP G  S ++ +  C     +    C C+ GY+G  C+ C   HFG+     G CQ C CSGNID     +C+  TG+C +CL +T G +C  C  G+ G  A ++C +C CN +GT+ +         C+  TG+CPCLP+V GL CDRC   F+N +S  GC PC C +P  A   +CN+ TGQC+C AG  G+ C+ C++  WGDP     C  C C+  G    QC+R+ G C C+PG++G  CD C +G  G  P C  C  C+  WD  +
Sbjct:   31 AATLAQVPSLDVPGCSRGSCYPATGDLLVGRADRLTASSTCGLHSPQPYCIVSHLQD--EKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWRVYRYFSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQN-LLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPGAPAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHSHSCHFDMAVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDMRDPAACRPCDCDPMGSQDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASNPRGCQRCQCNSRGTVPGGTPCDSSSGTCFCKRLVTGDGCDRCLPGHWGLSH-DLLGCRPCDCDVGGALDPQ-CDEATGQCPCRPHMIGRRCEQVQPGYFRPFLDHLTWEAEGAHGQVLEVVERLVTNRETPSWTGVGFVRLREGQEVEFLVTSLPRAMD-YDLLLRWEPQVPEQWAELELVVQRPGPVSAHSPCGHVLPRDDRIQGMLHPNTRVLVFPRPVCLEPGLSYKLKLKLTGTGGRAHPETPYSGSGILIDSLVLQPHVLMLEMFSGGDAAALERRTTFERYRCHEEGLMPSKTPLSEACVPLL--ISASSLVYNGALPCQCDPQGSLSSECNPHGGQCRCKPGVVGRRCDACATGYYGFGPAGCQACQCSPDGALSALCEGTSGQCLCRTGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDAHTGACLGCRDYTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCHCRAGYTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPTDPGACDPHTGQCLRCLHHTEGPHCGHCKPGFHGQAARQSCHRCTCNLLGTDPQRCPSTDLCHCDPSTGQCPCLPHVQGLSCDRCAPNFWNFTSGRGCQPCAC-HPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELHWGDPGLQ--CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDRVV 1204          
BLAST of Netrin-4 vs. TrEMBL
Match: A0A0X3PV22 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR117450 PE=4 SV=1)

HSP 1 Score: 1019.22 bits (2634), Expect = 0.000e+0
Identity = 542/1383 (39.19%), Postives = 785/1383 (56.76%), Query Frame = 3
Query:   48 RELI*MTLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLK-EIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSS------------KKCD--FLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFL--------------------------IVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLK-------EIKKYFPIGYDIIISNFSEKLSRL-----KYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISK---NKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKP 4025
            R+LI   L  +  +F++++ L  E +  C  TIC+P+AGDLLIGRES L+ASSTCGL + + YCVVT   +G KS C  C SK  Y + ++ +SHRIENV+SR+P DP RWWQS + VHNVSI I+ E++FQF  T +RFKT+RPAAMY+ERS ++G+TW  YAYFS+NCPRD+P IPER R  +N+V CT+ +S + PSEGG V F A  S+   N   ++++R +++AITN+R+ F RL+T GD ++DD+  I+ KYYYAI EW + GRCSC+GHA++C+ K   +++  E VYGVC+C HNT G +CE+C DFY   PW PA + S N C +CECN HS+ C+F+P++Y QS  +SGG C  CQHNTE  +CE C  G+YR    +I+  QTC  C+C   G+  P  C Q  +      AG C CKENV G++CD+C++G+W F  +   GC  C C M+GT EN GCD  TGKC CK  V G  C TC+ G+FNL+++ + GC  C CS +GS     CDK +G+C CK GF G  C +++  +YI  P   ++  +  + +++   SK G Y  V+  D K     D + + L    +  S C + +  +++ +D+  IV+P  CLE      +T+F      +  P    +    +L  +   T +V   C  + +L+              ++C+  F   +I  N  T    I C+CNVTGS +  C+K+ GQC C P V G+TC +C    Y F A GC  C C+  GSLN QC   T +C CREG+EG+ CD C+ GYW+FP+C  C+CN MS TCD  TG+CL C+ N+ G  C+ C  GYYGD  RG+ C+ C+CPG     ++S GC+L        C CK GY+G  C +C  N+FGN     GTC+PC CSGN+    E  CN  TGEC  CL NT G  C++C  G++GN +++ C +C C H+G        C+  TG+C CLPNV+G +C  C    FNL+S +GC  C CD PIG+L   C+ ++G C C+  RSG+ C+ C+  ++GDP    GC  C C+  GS+   C+  +G C+C+PGI+GR CD C +GT G +PNC  CG+CW  WD  +                            + N  +++    G  ++N K   E D +   LE+ +K+L        E+ K   +  D++    +   + L     K    +  + D   +   I  ++    YA  + ++   +++ D   +  + + SL+ +   A ES            K    +EE R +  K + ++ KD+   I ++++ +   NG   +    ++   C   CGG  C P
Sbjct:    3 RQLI---LRLLISVFISKFALAYEEEYSCENTICSPKAGDLLIGRESALQASSTCGLNDVQPYCVVT---AGGKSHCKECYSKQEYNQITNPNSHRIENVISRVPSDPDRWWQSENAVHNVSIVINLETQFQFISTIMRFKTFRPAAMYLERSDNFGQTWKPYAYFSNNCPRDYPGIPERPRRTLNDVTCTNVYSQLTPSEGGVVAFMAAPSEMHANLPLFSEERQNLSAITNLRITFSRLNTLGDMELDDSSAIKRKYYYAIYEWNVWGRCSCFGHATRCRPKSPHELENMEKVYGVCECTHNTAGDNCERCADFYQAKPWRPATRESANACERCECNGHSNQCYFNPLLYLQSNNVSGGQCHACQHNTEGIHCEFCADGFYRYPGYSIDHPQTCQPCNCHGDGSIDPDKCQQYTDPQQNTVAGRCNCKENVAGDKCDRCRVGYWNFQASNPKGCEACRCHMLGTWENSGCDPMTGKCTCKRHVGGEYCDTCQPGFFNLTDSPL-GCQPCACSPFGSL-GAECDKKTGRCHCKQGFVGRDCGQVEDGYYIRPPELMIDQPRIPVDVSIESPSKDGSYVIVLAIDPKQFGPGDRWTVTLEPKQL-DSRCINRKYIVEITRDTSKIVLPEVCLEAGKKTFVTIFA--DPRQFSPYTSVLFADIILIPDEGDTGRVAEYCEQFRHLIMQIAQGEVDPARMPRQCEEYFRLPQIHWNE-TGMVTIPCECNVTGSVSAVCDKMTGQCLCKPGVVGRTCAQCEPFHYHFSASGCTACDCNAQGSLNRQCDPSTSQCPCREGIEGRQCDRCRSGYWDFPYCRKCECNGMSDTCDQLTGRCLACRDNTGGDRCETCAQGYYGDPLRGVPCRPCECPGGGV--DHSEGCNL-HPVAGVVCRCKPGYAGPRCSECAPNYFGNPTELGGTCKPCECSGNLPP--EGGCNQVTGECLVCLHNTEGPRCDQCKLGFWGNASLQLCQRCSCYHLGAVGGADAACDRTTGECNCLPNVLGPRCFECVPYHFNLTSGVGCESCACD-PIGSLFPECHPISGACTCKPDRSGRKCDQCQRTYFGDPRDGGGCKPCDCDRSGSLSDVCDPASGQCQCRPGISGRRCDRCDRGTTGTLPNCRPCGECWTNWDKAIDRVIVEMRRLENQTSNQLPPDLKPVFTAISNLVEQIELLPGAKLTNEKL-NEFDGLLALLEKKVKTLDNLDTQTGELSKAIAV-LDMLTKEQTSITNTLSGSEKKLEALSVLLDDMKNRSAQIAILDPHGAYAALLAAREEVSRLDDTQRSLQKRRTSLEAMRQSAMESVS----------KREAADEEFRKLT-KQLEERIKDLQEEIRQLNRLICGDNGQVPD--GSADRATCPSACGGTSCDP 1352          
BLAST of Netrin-4 vs. TrEMBL
Match: A0A4S2L4E2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009869 PE=4 SV=1)

HSP 1 Score: 1014.22 bits (2621), Expect = 0.000e+0
Identity = 525/1305 (40.23%), Postives = 757/1305 (58.01%), Query Frame = 3
Query:   78 VFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVK-EMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRK-----------VLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESK-KIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSK-NVITFNG 3950
            VF +F+         +  C  TICNPRAGDLLIGRES L ASSTCGL   E YCVVTTS    +S C  C S  PY   ++  SHRI+NVVSR+P +P RWWQS + VHNVSI ++ +++FQF  T LRFKTYRPAAMY+ERS D+GRTW KYAYFS+NC RDFP++PE  R ++ +V CT  +S + PSEGG V + A  S+   +   ++K+R ++TAITN+R  F RL+T GD  VDD+  IR KYYYA+ EW + GRC+C+GHA +CK K     +K E VYGVC+C H+T G++CE C+DFY + PW PA K+S N C KCECN H+++C F+P++Y  S  +SGG C  C HNTE  NCE C+  +YR+    IN S TC  C+C + G  +   C Q    +    AG C+CK+NV G +CD+CK+G+W F  +   GC  C C MMGTL+N GCD  TG C CK FV G +C  C  GYFNL+ A + GC  C CS+ G++ N  C++ +G+C CK GF G  C +++  +Y+  PT  ++   E +I +      G +  V+  D K     D + I++  Y  G + CQ+   T+ + +D+  I+I + CLE  LP+VL +      +     I+   ++ +   +S   R+           + G   +   L    +  F    +S    T S   +C CN T S  + C+K+ GQC C P V G+ C+RCA   Y F +RGCK C C+  GS++ QC  +T  C C EG+ G+HCDTCKPG WNFP C  C CN+MS  C+  TG C NC+ N+ G  C+ C+ G+YGD  RG  CK C CPG     N++  C +        C C+ GY+G  CD+C  N+FGN     G+C+PC+CSGNI       C+ +TG C KCL N+ GFNC+ C  GY+G+   + C  C C   G+  + +  CN + G+CPCLPNVVG +C  C   FFNL+S  GC PC CD P G+++  C+ +TGQC C+  RSG+ C+ C+  F+G P +L+GC  C C+  G++   C+   G C C+ G+ GR CD C +GT+G++PNC  CG+CW  WD  +  V    D+L N +G      + P +++ +   L   ++ ++++  +  I  D  +    + L+R    +   +  +   +  + ++ + ++D  + M   N++  +     EL + L +IL  A +++ ++ +   L   +     +++R+I      Q++   DNL    ++ N I   G
Sbjct:    9 VFGVFLGNIFRSSSEEYSCENTICNPRAGDLLIGRESSLWASSTCGLNEVEAYCVVTTSG---RSFCKECTSSQPYNALTNPESHRIDNVVSRVPSNPGRWWQSENAVHNVSIVLNLDTQFQFISTILRFKTYRPAAMYLERSYDFGRTWKKYAYFSNNCKRDFPAVPEGSRRSLTDVTCTGVYSQLTPSEGGVVAYMAAPSEMHESWPQYSKERMNLTAITNLRAVFTRLNTLGDMNVDDSSLIRRKYYYALYEWNVWGRCTCFGHAKQCKPKSTAEIIKPEKVYGVCECTHHTAGENCETCEDFYWNKPWRPATKDSPNACEKCECNGHATACFFNPILYASSGNVSGGNCHGCMHNTEGVNCEYCQQNFYRHPDYPINHSMTCQPCNCHTDGALYAGFCQQYTIPEQNSVAGRCLCKKNVGGEKCDRCKVGYWNFQASNPEGCEPCTCNMMGTLDNGGCDPYTGLCTCKRFVGGPNCDQCLEGYFNLTLAPL-GCQECACSQLGAK-NPNCNRDTGQCECKVGFTGRDCAQVEDGYYVVPPTEIIDGRAEKEITVDGPKGEGRFVIVLDVDPKQFGEGDQWTIIVKPYQHGATRCQNPSQTVNVYQDTSKIIISDVCLEAGLPLVLRIMPESQPSGPYTEILITDIVLVPTDDSGLARRCEVYRELAMDILSGRTEDRRGLPPECEVYFRLPRVSWRE-TGSVAERCLCNTTWSETDICDKMTGQCVCKPGVVGRRCDRCAPYHYEFGSRGCKDCACNPQGSVSLQCDPETTLCRCHEGIVGKHCDTCKPGTWNFPRCQPCFCNEMSNMCNQTTGHCENCRENTGGMYCEKCKEGFYGDPQRGTPCKPCACPGGGV--NHATECRM-GPLEEQICYCQVGYTGARCDECAMNYFGNPTELGGSCRPCQCSGNIALNEPGGCDPQTGRCLKCLHNSEGFNCDVCKLGYWGDATRQMCQPCNCYAPGSVDEAKAGCNRDDGQCPCLPNVVGARCYECAPGFFNLTSGKGCEPCQCD-PTGSVSDKCDAITGQCQCKPDRSGRKCDRCRPTFYGSPNELDGCKPCNCDRSGAISDFCDSVTGQCPCRTGVAGRRCDRCDRGTEGQLPNCLPCGECWTNWDKAIDKVTAELDRLRNQTG-----RQLPSDLEVLFNGLVDLLQQIEKV-PWMNI-EDEKMEELQKILNRTNSALQELSSFEETPESLNALSEKLNSDLHEEMNRANEVAKLHMKMTELTERLDSILEEAKKAETQLPEGAYLAVQRAIEIEKQVRSIKETIEGQRALMEDNLSKAKAEVNAIKLRG 1296          
BLAST of Netrin-4 vs. TrEMBL
Match: G4LWP4 (Laminin beta chain-related OS=Schistosoma mansoni OX=6183 GN=Smp_148790 PE=4 SV=1)

HSP 1 Score: 1006.9 bits (2602), Expect = 0.000e+0
Identity = 594/1749 (33.96%), Postives = 901/1749 (51.52%), Query Frame = 3
Query:   81 FIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVK-EMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRK-----------VLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCP--GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIEN--STDYAKAMISKNKIRDVTGAFNELKKSLKNILNGAS-----ESKKIYQNITLIKD---------------------KLFYRNEELRNINLKFIRQKS--KDMDNLINEMSKNVITFNGVTC-----NTITESNPLMCSEFCGGVGC--------------------------------------KPDKCYRHAPMNKYC---MGKSNQFFNLY-ASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAI---QSRRIESVNLLIKIKTYLNGSADLKDFESLIENINKFEINF--KENEIIALDKQIRSR-IRKLNNVNNILDKSKFNRKQCDVFKKS-AVRAKEDTSYLLNSIKNISTLNRMTQKFEII--MKQFVMNF----------ANALFSLKGNLFHMFK-NENEAFQKQNNISYVTERIKFLKLYIMKIHKVFS--NTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLK 4988
            +++  + Y +    D  C  TICNPRAGDLLIGRES L ASSTCGL   E YCVVTTS    KS C  C SK PY   ++  SHR+ENVVSR+P +P RWWQS + VHNVSI ++ +++FQF  T LRFKTYRPAAMY+ERS D+GRTW +YAYFS+NC RDFP++PE  R ++ +V CT  +S + PSEGG V + A  S+   +   ++K+R ++TAITN+R  F R++T GD +VDD+P  R KYYYA+ EW + GRC+C+GHA +CK K     +K E VYGVC+C HNT G++CE C DF+ + PW+PA +++ N C KC CN+H+++C F+PV++ +S  +SGG C  C HNTE  NCE C+  +YR+ +  I+   TC  C+C   GT + + C Q    +    AG CICK+NV G +CD+CK+GFW F      GC  C+C M+GT++N GCD  TG C CK FV G +C  C  GYFNLS   + GC  C CS+ GS  N  C++ SG+C CK GF G  C E+++ +YI  P   ++   E +I L      G Y  V+  D K     D + IV++ +  G + CQ+   ++ + +D+  ++I + CLE  LPIVL +            I+   +I +   +S   R+           + G   +   L    +  F    +S    + S   +C CN TGSR+  C+K+ GQC C   V G+ C+RCA   YGF ARGC  C CD  GS++ QC+ DT  C CR G+ G+HC+ C PG+W+FP C  C CN+ S  C+  TG C NC+ N+ G +C+ C  G+YGD  R   CK C CP  GL+  K   +G           C+CK GY+G  C QC  N+FGN     G+C+ C CSGNI   +  SC+  TG+C KCL NT G+ C+ C  G++G+   + C  C C  +G+  +  G CN E G+C CLPNV+G +C  C   FFNL+S  GC PC CD P G+++  C+ + GQC C+  RSG+ C+ C+  F+ DPT  + C  C C+  GS    C+   G C C+ GITG+ CD C +GT+G +P+C  CG+CW  WD  +  V +  D+L N      ++ + PKE+  +  SL   +  ++ +   +    D  ++   + L R +  +   + +D     +S++  ++  +   A+ +  K  + +       LK  +++I++ +      + +  Y +I   KD                     +L     EL  +  +  +  S    +D  I E  + +   N + C     +   +++  +C   CGG GC                                        +     + M +Y    +  +N  +N+Y A   + + N S  + E     N++I + +IK+        YN T  LI+     +    S R +  + ++K       +  L + E +I+ + K+ I+   K   I+A  +  R R +  L     I DK+K   +Q +  K++  +    +   ++  + ++   +++TQ  E I   K  V+ F          A   F +  +L         E       I  V    K L   ++++ K+    +T  +    ++     L +     + + N ++  +L +     I    + L  +S  L D++K    K++
Sbjct:   13 YVLTTSSYEIAFSEDYSCENTICNPRAGDLLIGRESSLVASSTCGLNEVEAYCVVTTSG---KSYCKECTSKQPYNSITNPESHRVENVVSRVPSNPGRWWQSQNAVHNVSIVLNLDTQFQFISTILRFKTYRPAAMYLERSYDFGRTWARYAYFSNNCKRDFPAVPEGPRRSLTDVTCTGVYSQLTPSEGGVVAYMAAPSEMHQSWPQYSKERMNLTAITNLRAVFTRINTLGDMRVDDSPLTRRKYYYALYEWNVWGRCTCFGHALRCKPKSSAEIIKPEKVYGVCECTHNTAGENCETCADFHWNKPWMPATRDAANACEKCNCNNHATACFFNPVLFSKSGNVSGGNCHGCIHNTEGVNCEFCQPNFYRHPSYPIDHPLTCQPCNCHLDGTLYDNFCQQYTIPEQNTIAGRCICKKNVGGEKCDRCKVGFWNFQAENPDGCEACSCNMIGTIDNGGCDPFTGLCICKRFVGGPNCDRCLEGYFNLSTTPL-GCQECACSQIGSL-NPNCERVSGQCACKVGFTGRDCSEVENGYYIVPPHEIIDRPDEKEITLIGPKGEGKYVIVLDVDPKQFGSGDRWSIVVTPFQYGATKCQNPPQSVNIYQDTHKVIISDVCLEPGLPIVLRIVPESYPEGAFTEILITDIILIPTDDSELARRCEVYREIAMEILAGRREDRTGLPPECEVYFRLPRLSWKE-SSSVAQRCLCNSTGSRSEICDKLTGQCPCKDGVVGRQCDRCAPYHYGFSARGCTDCACDPQGSVSLQCHEDTSLCECRPGIVGKHCNMCNPGFWDFPNCRPCICNEFSDFCNQTTGICENCRDNTGGDHCETCREGFYGDPLRKTPCKPCSCPGGGLNHAKECHMG-----PLEEQICICKVGYTGPRCSQCAMNYFGNPTEPGGSCRQCECSGNIAVNVPGSCDPITGQCLKCLHNTEGYYCDVCKDGFWGDATRQMCQPCNCYPLGSIDEGAGGCNRENGQCSCLPNVIGPRCYECAPYFFNLTSGKGCEPCLCD-PTGSIDDLCDPVMGQCRCKPDRSGRRCDQCRRLFYSDPTTPDRCLPCDCDRVGSTSDLCDPLTGQCPCRTGITGQRCDRCDRGTEGILPDCVPCGECWNNWDKAIDKVISELDRLQN-----QTSQQLPKELKIMFDSLVSLLDQIEHVP--WMTTDDTRLNELRDVLKRSEETIMRLSSLD--QFADSLVKWDDLITERLAQQLERKGVVNEAKARLETLKTQMQSIMDESMKLEHLDKRGAYLSILRSKDIGDRVINTQTSIEYQRGGLEAELLNSKRELEAVQTRADQLNSDWAQLDRRIEEFREKIRQTNRLICGDNGLSPTEDTDQKVCPSTCGGAGCDYFFSKSASLNTISNTNILMNNLNTGLISTCGVNPGCNASNAGRLRSRMEEYLNLQIRLTNALYNVYRAENAISKVNSSRRIAE-QTITNLTIQATDIKERIA---DMYNLTNHLINEAEKYVNLYSSMRQDKFDEILKSLQNAKLNVSLYEAEQIIQQLEKYAIDLEDKAKRILAETESDRQRSVNLLRRAETIRDKAKDFMEQINQLKEADKIYQGIEKEPIIQKVDDVELFDQITQLTEQIDGFKNQVIMFSRDSSLQSDKAKEAFEVADDLLSSTNVARRETLDTLQQIELVEVSFKQLDEKMLELDKLMRALDTGDRGTGDEDLPDTTLTDPAKLMEEIQNYTSTLELNTDEVKSIITNLKRLEIESELLTDELKGYMDKMQ 1736          
BLAST of Netrin-4 vs. TrEMBL
Match: A0A4Z2DB14 (Laminin subunit beta-2 OS=Schistosoma japonicum OX=6182 GN=EWB00_002741 PE=4 SV=1)

HSP 1 Score: 1004.59 bits (2596), Expect = 0.000e+0
Identity = 570/1596 (35.71%), Postives = 857/1596 (53.70%), Query Frame = 3
Query:   78 VFIIFVARYILEIES-------DNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCD----------FLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCP--GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIEN--STDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASE---------------SKKIYQNITLIKDKLFYRN-----------EELRNINLKF--IRQKSKDMDNLINEMSKNVITFNGVTCN-----TITESNPLMCSEFCGGVGC----KP-------------DKCYRHAPMNKYCM-GKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISI-------NSKEIKDAYVKPESEYNTTIK-LIDVTRGAIQSR-RIESV-----NLLIKIKTYLNGSADLKD--FESLIENINKFEINFKENEIIALDKQIRSRIRKLNN-VNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKF 4595
            + +IF   +I  + S       D  C  TICNPRAGDLLIGRES L ASSTCGL   E YCVVTTS    KS C  C SK PY   ++  SHR+ENVVSR+P DP RWWQS + VHNVSI ++ +++FQF  T LRFKTYRPAAMY+ERS D+GRTW +YAYFS+NC RDFPS+PE  R ++ +V CT  +S + PSEGG V + A  S+   +   ++K+R ++TAITN+R  F R++T GD +VDD+P  R KYYYA+ EW + GRC+C+GHAS+CK K   ++   E VYGVC+C HNT G++CE C DF+ + PW+PA +++ N C KC CN+H+++C F+PV+Y +S  +SGG C  C HNTE  NCE C+  +YR+ +  I+   TC  C+C   GT + + C Q    +    AG CICK+NV G +CD+CK+GFW F      GC  C+C M+GT++N GCD  TG C CK FV G +C  C  GYFNLS A + GC  C CS+ GS  N  C++ SG+C CK GF G  C E+++ +Y+  P   +    E +I+L      G Y  V+  D K     D + IV++ +  G ++CQ+   ++ + +D+  ++I + CLE  LPIVL +            I+   +I +   +S   R+          +++ ++ D          +      +   + S   +C CN TGSR + C+K+ GQC C   V G+ C++CA   YGF ARGC  C CD  GS++ QC+  T  C CR G+ G+HC+ C PG+W+FP C  C CN +S  C+  TG C NC+ N+ G +C+ C  G+YGD  R   CK C CP  GL+  K   +G           C CK GY+G  C QC  N+FGN     G+C+PC CSGNI   +  SC+S TG+C KCL+NT G+ C+ C  G++G+   + C  C C  +G+ ++  G CN + G+C CLPNV+G +C  C   FFNL+S  GC PC CD P G+++  C+ + GQC C+  RSG+ C+ C+  F+ DPT  +GC  C C+  GS    C+   G C C+ G+TG+ CD C +GT+G +PNC+ CG+CW  WD  +  V    D+L N      ++ + PKE+  +  SL   +  ++ +   + I  D  ++ F   L R +  V   + +D     +S+I  ++  +    + +  K  + +       LK  LK+I++ + +               SK+I   +  I+  + Y+             EL  +  +   +      ++  I E  + +   N + C         +S+  +C   CGG GC    KP             D+        K  M G++        +L  + +N   +     +  N+ I       N    ++A  K  S      + ++D+T  A   + RI  +     NL+ + + Y+N  + ++   F+ ++  + + ++N    E   + +Q+      L +    IL +++ +R++     + A   ++     +  I  +   +++ Q+ 
Sbjct:    5 LLVIFTVSHISTLASYETAFTEDYFCENTICNPRAGDLLIGRESSLIASSTCGLNGIEAYCVVTTSG---KSHCEECISKQPYNPEANPESHRVENVVSRVPSDPGRWWQSQNAVHNVSIVLNLDTQFQFISTILRFKTYRPAAMYLERSYDFGRTWARYAYFSNNCKRDFPSVPEGPRRSLTDVTCTGVYSQLTPSEGGVVAYMAAPSEMHESWPQYSKERMNLTAITNLRAVFTRINTLGDMRVDDSPLTRRKYYYALYEWNVWGRCTCFGHASRCKPKSSVEILKPEKVYGVCECTHNTAGENCETCADFHWNKPWMPATRDAANACEKCNCNNHATACFFNPVLYIKSGNVSGGNCHGCMHNTEGVNCEFCQPNFYRHPSYPIDHPLTCQPCNCHLDGTLYNNFCQQYTIPEQNTIAGRCICKKNVGGEKCDRCKVGFWNFQAENPDGCESCSCNMIGTIDNGGCDPFTGLCTCKRFVGGPNCDRCLEGYFNLSTAPL-GCQECACSQIGSL-NPNCERVSGQCACKVGFTGRDCSEVENGYYVVPPHEIISGSDEKEISLIGPKGEGKYVIVLDVDPKQFGSGDRWSIVITPFQYGATTCQNPPQSVNIYQDTHKVIISDVCLEPGLPIVLRIVPESYPEGAFTEILITDIILIPSDDSDLARRCESYREIAMEILAGRREDRTGIPPECEVYFRLPRLSWRESSSVAQRCLCNSTGSRTDICDKLTGQCPCKDGVVGRQCDQCAPHHYGFSARGCTDCACDPQGSISLQCHETTSLCECRPGIVGKHCNMCNPGFWDFPNCRPCTCNGLSEFCNQTTGICENCRDNTGGDHCETCREGFYGDPLRKTPCKPCSCPGGGLNHAKECRMG-----PLEEQICTCKVGYTGPRCSQCAVNYFGNPTEPGGSCRPCECSGNIAVNVPGSCDSVTGQCLKCLYNTEGYYCDICKEGFWGDATRQMCQPCNCYPLGSVNEGAGGCNRDNGQCSCLPNVIGPRCYECAPYFFNLTSGKGCEPCLCD-PTGSIDDLCDPVMGQCRCKPDRSGRKCDQCRRMFYSDPTSPDGCRPCNCDRAGSTSDLCDALTGQCPCRTGVTGQRCDRCDRGTEGILPNCNPCGECWNNWDKSIDKVIIELDRLQN-----QTSQQLPKELKILFDSLVSLLDQIEHLP--WMITEDARLNEFRNVLKRSEDIVMRLSSLD--QFADSLIKYDDLMTERLTQQLERKVLVNEAKTRLESLKNQLKSIMDESMKLEHLDQKGAYLSLLRSKEIADRVADIQTSIEYQRGGFQTELSDSKRELEAVQTRADQLTLDWAQLERRIEEFREKIRQTNRLICGDNSSPPTEDSDQKVCPSTCGGAGCDYFSKPTSLSTISSLSVGNDRNPSSTATTKEMMNGRTGLISTCGLNLGCNASNAGRLRSRMEEYLNLQIRLTNALHNVYRAENAISKVHSSRKIAEETVMDLTLNATNIKERIADMYNLTQNLINEAEKYVNIYSSMRQDKFDEILRTLQESKLNVSRQEAEQIIQQLEKYATDLEDKAIRILAETESDRQRTGNLLRRAETIRDKAKDFMEQINQLKEADKIYQEI 1580          
BLAST of Netrin-4 vs. TrEMBL
Match: A0A0R3T2Q6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS1240 PE=4 SV=1)

HSP 1 Score: 1001.5 bits (2588), Expect = 0.000e+0
Identity = 568/1588 (35.77%), Postives = 857/1588 (53.97%), Query Frame = 3
Query:  132 CRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLK---EIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTK-----------------SDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNT---------------QQNSI-ITIENSTDYAKA-------MISKNK---IRDVTGAFNELKKSLKN-----ILNGASESKK-----IYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLM--CSEFCGGVGCKP--------DKCYRHAPMNKY----------------CMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKE----IKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESV-NLLIK-----IKTYLNGSAD-LKDFESLIENINKFEINFK-----ENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFE 4598
            C+ TIC+PRAGDLLIGR++ L ASSTCGL N + YCVVT S    KS C+ C SK  Y   ++ +SHRIENV+SR+P DP RWWQS + + NV++ ++ E++FQF  T LRFKT+RPAAMY+ERS D+ +TW  YAYFS+NCPRDFP+IPER R  +++V CTS +S + PSEGG V F A  S+   N   ++++R ++TAITN+RV F RL+T GD  +D++  IR KYYYA+ EW + GRCSC+GHA++CK K   ++   E VYGVC+C HNT G +CE+C  FY + PW PA ++S N C +CEC+ HS  C+F+P++Y QS  +SGG C  C HNTE   CE C  GYYR+    IN  QTC  C+C + G++    C Q      G  AG C+CK+NV G++CD+CK+G+W F      GC +C C M+GTLEN GCD  TG C CK FV G +C  C  GYFNL+++++ GC  C C+  GS     CD   G C CK  F+G  C ++   +YI +P   +       +I I +P    +G Y  VI TD K+   FD + I + I     SSC++    +++  ++R IVIPN CL  D    + +  + ++    P     +   ++  +  +   +   C +Y  +        L+ EI  N + +                 +  + C+CNVTGS    C+K+ GQC C P V G+ C++C +  Y F + GC  C C   GS   QC   T +C CR+G+EG+ CD C  GYWNFP+C  C+CN  +  CD  TG C++C+ N+ G  C+NC  G+YGD  RG+ C+ C+CPG     ++S GC+ +       C C+ GY+G  C +C  N++GN     G+CQPC CSGN+    E  C+  TG C+ CL+NT G  C++C++G++GN + +TC  C C  +GT      +C+ ETG C CLPNV+G +C  C  + FNL+S  GC  CNCD P G+++ +C+ LTGQC C+  RSG+ C+ C+  F+GDP   +GC +C C+  GS+   C+   G C C+PGI GR CD C +GT G +P+C  CG+CW  WD  +  V +   +L N      ++ + P ++  V   L+  ++ L+ I       Y   +  F E L  ++  V      D NT               QQN +  T+ ++  Y K        M+  ++   I+D  GA++ L  + ++      L  + ES+K     + Q+ +         +EE + + +KF+ ++ KD+ + I ++++ +   N      + ES   +  C   CGG  C P        D+    +  N                   M    +   L A  L  +  ++ +L+   Q  N+ I+S      +     + +    +  K ++  RG +   R++++ N +I+     +K Y N +AD   +  S I  +N   +N        N +  L  Q+R ++   N       ++   +++ D+  + A   +E     L  +  +S ++++  + E
Sbjct:   35 CQNTICSPRAGDLLIGRDNALVASSTCGLENVDTYCVVTASG---KSHCSECYSKQAYNSITNPNSHRIENVISRVPSDPGRWWQSENALRNVTLTLNLETQFQFISTILRFKTFRPAAMYLERSVDFAQTWQPYAYFSNNCPRDFPAIPERPRRALSDVTCTSIYSQLTPSEGGVVAFMAAPSEMHANLPPYSEERQNLTAITNLRVTFTRLNTLGDMNLDNSSAIRRKYYYAMYEWNVWGRCSCFGHATRCKPKSASEIPNLEKVYGVCECTHNTAGDNCERCASFYQNKPWRPASRHSANACERCECHDHSDQCYFNPILYLQSGNVSGGHCYQCHHNTEGPQCEFCSVGYYRHPDYPINHPQTCQPCNCHAGGSETHESCDQYTNPVEGKIAGRCVCKKNVGGDKCDRCKVGYWNFRAENPDGCEECKCHMLGTLENMGCDQITGACTCKRFVEGENCDRCMPGYFNLTSSSM-GCQPCACNPVGSL-GPECDIERGICKCKANFSGRDCSQVDDGYYIRRPQIVVNQPGTTIDIPIEVP--KNTGNYIVVIATDPKHFSRFDRWSITVDIRQ-DDSSCRNSPTHLEITAETRKIVIPNVCLTGDRKTFIAI--MPTSRYGSPYSEITIGNIIVKQDDGEASAIAEYCESYREIYER----ILDGEIEPNRLPQRCQTYFNIQESQWKDDSAISVPCECNVTGSVTPICDKLNGQCPCRPGVVGRKCDQCEAYHYHFSSSGCTACNCHPKGSTGLQCDPLTSQCPCRQGIEGRKCDICGSGYWNFPYCQRCECNGKADECDQVTGACIDCRDNTGGARCENCAQGFYGDPFRGVPCRPCECPGGGV--DHSEGCT-VHPVAGMQCHCQMGYTGPRCSECAPNYYGNPTEYGGSCQPCDCSGNLPP--EGGCDQVTGACQVCLYNTEGEKCDRCIAGFWGNASQQTCQPCSCYQLGTAGGGSAVCDRETGACNCLPNVLGPRCFECAPQHFNLTSGKGCESCNCD-PTGSIHLNCHPLTGQCTCRPDRSGRKCDQCQRTFYGDPRTPDGCKRCDCDRAGSLSDTCDPITGQCVCRPGIAGRRCDRCDRGTKGTLPHCEPCGECWTNWDKAITAVVDEMGRLKN-----QTSSQLPADLKPVFDILQGLVEQLELIPASNLTDYQ--LKKFEEVLLFIEEQVSGLESPDGNTGKLPEVEEALNKLQEQQNKLNQTVGDNEKYLKQISDELEKMVESSRNISIQDPFGAYDALLMAQRDAQKIEALQKSLESRKATLEALLQSTSTSVASRSEADEEFKRL-IKFLSERIKDLQDEIRQLNRMICGDN----QRVPESGADLRTCPSTCGGASCDPITAEIFDLDEQRGTSTPNDLPNFFGLISSCAGTIGCSMSSEGRLKELLAEHLTAQNALANVLQNAAQVENL-IDSASPNFCVNATRTEADEIMTSLFKELETLRGRV--FRVQNITNAIIEEGQEAVKKYENITADYYNELVSKIRGLN-HAVNIDGALRLGNTLEKLSAQLRDKVEHFNT------ETSGQKREADLLLERAKNIREKAEGFLEQMNKLSNVSKIYDEME 1580          
BLAST of Netrin-4 vs. Ensembl Cavefish
Match: lamb1a (laminin subunit beta-1 [Source:NCBI gene;Acc:103026996])

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 548/1802 (30.41%), Postives = 895/1802 (49.67%), Query Frame = 3
Query:   63 MTLNYVFIIFV-ARYILEI-ESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQ-VKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY----------------------IEKPTYPLEHLKE--------------IKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHV--GKSSCQSY--QDTMQLI---KDSRYIVIPNK-CLEKDL--PIVLTVFTIESNNKXXXX-------------------XXXXXXXXXXXXNSTKTRKVLGECL-NYANLVSSKKCDFL-NAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTN-----SKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKL-HNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDI------------IISNFSEKLSRLKYYV---------YNSNIIDFNTQ----QNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIK----DKLFYRNEELRNINLKFIRQKSKDMDNLINEMSK-NVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISIN-----SKEIKDAYVKP-ESEYNTTIKLIDV--TRGAIQSRRIESVNLLIKIKTYLNG-SADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXX---XLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLN---KSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKI 5090
            M L    ++++ A  + EI E  +VC +  C P  GDLLIGR   L A+STCGL   E +C+V  S    + KC +CDS   +     T SHRIENVV+    +  + WWQS +G+ NV+I+++ E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FPS+ +     +++V+C + +S I PS  G V+F      +   D Y  + +N +  ITN+RV+F +LHT GD  +D    I+ KYYYAI + ++RG C CYGHAS+C   +G  + V  MV+G C C HNT G +CE+C+DFY+D PW PA+  +TN C+KC CN HS SCHFD  VYQ S  +SGGVCD+C HNT   NCE+CK  +Y++    I     C  C+CD +G+    IC    ++ LGL +G C CK NVEG +CD+CK G +  + ++  GC  C C  +GT+     CD+ +G CYCK  VTG DC  C   ++ LSN +++GC  C C + G   N  C   +G+C C+    G RCD+++S +Y                      +++P +P +                  ++ N+  +  S  Y+ +I  + +  + ++  ++ +    V    S C +    D  Q++     SRYIV+P   C E+ L   I L++    +N+ I                               L+ NS         CL N  ++V +   D   N   S + +       C C+  GS +  C+  GGQCQC  NV G+ C+ CA  ++ F   GC+ C+CD  GSL++ C+  TG+C C  G  G+ CD C PG+W FP C  C CN  +  CD  TG+CLNCK ++ G+NC+ C NG+YGD     G  C+ C CP G  S +  +  C    ++    C+C +GY G  CD+C   ++GN     G C+PC+C+ NID     SC++ TG C KCL++T G  C +C  GY+GN   + C +CVCNHMGT      S  +  C+  +G+C CLPNVVG  CD C    +N++S  GC  C+CD P  + + SCN+L+GQC C+ G  GK C  C++ FWG+P     C  C C+  G   +QCN+  G C C  G++G  CD C +G  G+ PNC  C  C+ +WD  +  + N   +L    + +  S +  P +  D   ++E++  ++++I    P    +            +++  +EKL++ + ++          N+ +  F+ +    Q ++  +++  ++ +    +     ++  F + + +   +    S+ + + Q    ++    D +    EE  N   ++    +  +DNL  ++   ++   +  TC +   S     S  CGG+GC   +  R     + C+G +    N +              K+F+Q    ++      SK + +A VK  E++ N    L+    T+  +     E   L+ +I+ +L    ADL+  E++   + + ++     ++  L  +IR R+  L++V +IL++S  +  + +   + A +A+++ + + ++ + +     + +K +  + +       A   +KG    +   E+E    +  +S  T R+  L+  +  + +   NT    +  +E   +       LK D    + K  Y    S+    I+E+ Q +++   K+  L  + K    +     +L+ D E       K +++K ++L+ L+  +
Sbjct:    2 MMLQLAALLYLGAISLAEIPELGDVCTEGSCYPATGDLLIGRAQQLSATSTCGLGKPEPFCIV--SHLQEEKKCFVCDSNKSFDETEHTTSHRIENVVTTFAPNRLKTWWQSENGMENVTIQLNLEAEFHFTHLIMTFKTFRPAAMVIERSADFGKTWQVYRYFAYDCESSFPSVSQGPMKKVDDVICDTRYSDIEPSTEGEVIFRVLDPVFRIEDPYSPRIQN-MLKITNLRVKFTKLHTLGDNLLDSRIEIKEKYYYAIYDMVVRGNCFCYGHASECAPVDGAGEMVDGMVHGHCMCNHNTMGLNCERCQDFYHDLPWRPAEGRNTNACKKCNCNQHSDSCHFDMAVYQASSNVSGGVCDDCLHNTMGHNCEQCKPFFYQHHERDIRDPNICEPCNCDPVGSLNGGICDALTDVSLGLISGQCRCKPNVEGERCDQCKQGHYGIS-DDPLGCKPCTCNALGTVPGGSPCDTDSGDCYCKRLVTGRDCDQCLPQHWGLSN-DMDGCRPCDC-DVGGAVNNDCSAETGQCQCREHMFGRRCDQVESGFYFIALDHYVYEAEDAKFGPGVTVVQRP-FPQDRTPTWTGIGFVNVPEGAYLEFNIDNIPHSMEYDILIRYEPQLPEQWEEVLMTVIRPRVITADSRCANTMPDDDNQMVSLHPGSRYIVLPRPVCFEQGLNYTIRLSLPRYSTNSDIQSPYTLIDSIVLMPHCKNLEIFSGSGSEGGDLETNSAWDTFQRYRCLENSQSVVKTPMPDICKNYIFSVSALLHQGAKACACDPQGSLSTVCDPNGGQCQCRANVVGRNCDTCAPATFLFGPLGCRHCECDPQGSLHAFCHEATGQCECIPGAYGRQCDRCLPGHWGFPNCRPCTCNGHAEQCDPLTGQCLNCKDHTTGHNCERCLNGHYGDPILGSGDHCRPCMCPDGPGSRRQFAGACYKNHDSYQVFCVCNQGYKGARCDECAPGYYGNPHEAGGECRPCQCNNNIDLVDPGSCDAHTGACLKCLYHTEGEGCSRCKLGYYGNALTQNCRRCVCNHMGTRKETCPSVGECHCDLSSGQCQCLPNVVGQHCDLCAPDTWNMASGRGCEACDCD-PNHSFSSSCNELSGQCSCKPGFGGKTCRECRELFWGNPEI--KCHACDCDPRGIAEQQCNKATGHCVCVEGVSGPRCDTCARGYFGEFPNCERCHQCFSEWDIIIGDLTNQTHRLMQKVNTIKSSGITGPYQ--DTINNVERSANTIRDILAQNPATQPLTEMQALLEQATTLMAEMNEKLNQTEEFMSQISDENNGTNTKLESFSEEAQKLQRTVKDLQDQVEFIRNSDVRGASDSISRYFQQSEAAEARVNASTSDPESLVQQSASVRRETEDMMNQTKEEFNNKQDEY----ATALDNLAGQLETLDLSDLSEKTCGSPAGSEACADSP-CGGLGCVDAEGIRKC-GGEGCLGLTTLAHNAWQK-----------AKDFDQDIVSAMQEVDKLSKMVLEAKVKADEAKLNAQEVLLKTNETKQRVDLSNEELRKLIKQIRDFLTQEGADLESIEAVANEVLQMQMPTTPAQLQNLTDEIRERVNSLSDVEDILNQSATDIHRAEDLLEQAQKARKEAADVKSTAEMVQEALDLAEKAQTTVTEA---LKQASTDIKGTQDLLVSVESETADSEFKLSNATVRLLQLERDVALLKEKALNTSISAEKTEEDADSINEMAEQLKKDLDTEL-KDKY----SSVEELITEKAQGVVDAKKKAEVLQQEAKDLLLQASDKLRLLKDLEKSYDENQKKLEDKANQLVDLEKAV 1766          
BLAST of Netrin-4 vs. Ensembl Cavefish
Match: lamb1b (laminin subunit beta-1-like [Source:NCBI gene;Acc:103026945])

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 459/1326 (34.62%), Postives = 690/1326 (52.04%), Query Frame = 3
Query:   66 TLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKC-KAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY----------------------IEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFII-------------VLSIYHVGKSSCQSY-------QDTMQLIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG---------------ECLNYANLVSSKKCDFLNAE--ISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK----WQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPK------EIDDVCTSLEQNMKSLKEI-------------------KKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKK 3758
            TL  + +  +A+Y+   + ++ C +  C P  GDLLIGR   L ASSTCGL   E YC+V+   +G   KC  CDS+  Y  +S  +SH I+NVV+    +  + WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS DYG++W  Y YF+ +C   FP I +    N+++++C S +S + PS  G V+F A    +   D Y  + +N +  ITN+RV+ ++LHT GD  +D    +R KYYYA+ + ++RG C CYGHAS+C   +E +     MV+G C C+H+T G +CE+C++FY D+PW PA   STN C+KCECN HS  CHFD  VY  S  +SGGVCDNCQHNT+ ++C+ CK  YY++    +   + C  C CD LG+    IC    ++  GL AG C CK NVEG  C+ CK G +  +     GCL C+C  MGTL     CD+ TG+CYC+  VTG  C  C   ++ LSN +++GC  C C + G   N  C   +G+C+C+    G RCD+++S +Y                      + +P     H     I    V + G   F I    ++M++  S +I             ++ +   G  S  ++       Q +  L    RY+V+P   CLEK     + +     ++        +++  ++ V + K  ++                  CL     V       +  E   S + +     ++C+C+  GS +  C+ IGGQC C PNV GK C+ C+  ++     GC+ C+CD  GSLN  C   TG+C C  GV G+ C  C   +W FP C  C CN  S  C  +TG+CL C+ ++ G +C+ CE+GY+G+   S G  C+ C CP G  S +  +  C    N     C+C  GY G  C++C   ++GN     G C PC+C+GNI      SC+S+TG C +CLF+T G  C+ C  GY+G+ + ++C KC+C  +GT S+     +  C+  +G+CPCLP VVGL CDRC    +N++S+ GC PC C +P  + + SC+ L+GQC C+ G  G+ C  C++ FWGDP     C  C C+  G    QCN+  G C C  G++G+ CD C +G  G  P+C  C  C+ +WD        T ++L N +   + NV+  K         D  +SLE  +K L +I                    KY  +G  +   N +E+        +   + D NT       +++ST+  +A + + K  ++ GA + +++
Sbjct:    3 TLESLGLGLLAQYV--PDHNDKCAEGSCYPATGDLLIGRAHRLMASSTCGLNGPETYCIVSNMQAG---KCFDCDSRETYDEYSYPNSHTIDNVVTTFTPNRLKTWWQSQNGMENVTIQLDLEAEFHFTHLIMTFKTFRPAAMVIERSADYGQSWKVYRYFAFDCSESFPYISQGPVVNVDDIICDSRYSDMEPSTAGEVIFRALDPVFKIPDPYSQRIQN-LLRITNLRVRMLKLHTLGDDLLDGGEEVRRKYYYALYDMVVRGNCFCYGHASECAPVRESERGEDGMVHGHCMCKHHTTGLNCEECEEFYQDAPWKPAQGRSTNACKKCECNYHSDECHFDMAVYLSSGNVSGGVCDNCQHNTQGQHCDDCKPFYYQHPNKHLRDPRICRPCDCDPLGSLNDGICDSVTDVLKGLIAGQCRCKPNVEGESCNHCKPGHYGLS-EHPLGCLPCSCNPMGTLPGGNPCDTETGRCYCRRLVTGQYCDQCLPQFWGLSN-DMDGCRPCDC-DLGGALNNDCPPVTGQCVCREHMFGRRCDQMESGYYFASLDHYIYEAEDAAFDPAVKVVPRPLPADRHPTWTGIGFANVPEGGTLRFTIDNVPQSMEY--SLLIRYEPQLPDVWEQVMVDVKRTGFPSPSAHCSPPYADQQSASLPPGYRYVVLPRPVCLEKGQTYTVEMLMALYSSNDLHQNPHMLIDSIVLVPAVKDLELFSGSPDRQEAWTMFQKYRCLEQGQSVQKTPMTDICREYIFSASALMHQGAMECQCDPRGSVSLLCDSIGGQCSCRPNVVGKRCDTCSPGTFQLGPSGCRSCECDPMGSLNDFCDTTTGQCPCLPGVYGRQCAHCLHNHWGFPHCQECFCNGHSHHCHPQTGQCLECRDHTTGQHCERCESGYHGNALLSSGEHCRPCMCPDGPGSGRQFADTCYHNPNLRQLVCVCSPGYKGSRCEECMPGYYGNPHVVGGRCHPCQCNGNIHMHDPGSCDSRTGVCLRCLFHTEGHGCQHCRRGYYGDASTQSCQKCMCLPLGTASQSCRDGECECDRVSGQCPCLPGVVGLNCDRCAPNTWNINSKEGCQPCKC-HPTHSYSLSCDLLSGQCSCKPGFGGRACGECRELFWGDPEI--KCHACDCDPRGIATPQCNKMTGTCVCAEGVSGKRCDSCGRGYVGTFPDCQRCHKCFSEWDL-------TVNELTNQTQHLVGNVEELKVSGLVSAYQDTVSSLEGGIKELTQIVEDNKAHQTLTHSENLLRQAKYLVLGRSL---NRTEQTVGQVSADHTRALDDLNTLSEEAQRLQDSTEDKQAQVLRIKHSNIRGAADSIRE 1304          
BLAST of Netrin-4 vs. Ensembl Cavefish
Match: lamb2 (laminin, beta 2 (laminin S) [Source:ZFIN;Acc:ZDB-GENE-081030-4])

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 483/1409 (34.28%), Postives = 715/1409 (50.75%), Query Frame = 3
Query:   63 MTLNYVFIIFVA-RYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKI----------------------NLPPVSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQS-------YQD--TMQLIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXX-----XXXXXXXNSTKTRKVLGECLNYANLVSSKK------------------CDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTN-----SKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIG-YDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYA----KAMIS--KNKIRDVTGAFNELKKSLKNIL-------NGASESKKIYQNITLIKDKLFYRNEELRNIN-------LKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLM 3989
            +T+  +F   +A   I E +  + C    C P  GDLL+GRE  L+ASSTCGLT  E YC+V  S    + KC  CDS+ PY    +  SHRIENV++    D  + WWQS +G  +V I++  E+EF FT   + FKT+RPAA+ IERS D+GRTW  Y YF+ +C   FP I       +++V+C S +S I PS  G V+F          D Y  + +N +  ITN+RV F  LHT GD  +D    I+ KYYYA+ E ++RG C CYGHAS+C   +G +  ++ MV+G C C+HNTKG +CE+C DF+N+ PW PA+  +TN C+KC CN+HSS CHFD  VY  +  +SGGVCDNC HNT  +NCE CK  YY++ +  I   + C+ C CD  G+    +C    +  LG+ AG C CK+NVEG++CDKCK GF+  + ++  GC  C C   GTL     CD   G C+CK  VTG  C+ C   ++ LS+ + +GC  C C   G+ DN+ C   SG CLC++   G +C +++S ++     Y L   +  K+                            + G   F+I     +M+ +D  I            + +++   G     S         D  T+ +   SR++V+P   CLEK +   L +  +   +K               I LL  +++    V G+  + A   S ++                  C  L + +S   +  + P  C+C+  GS ++ C+  GGQC+C PN+ G+ C++CA  +YGF   GC+ C+C   GS    C  +TG+C C  G  GQ CD C+ G+W FP C  C+CN  +  C  +TG CL+C+ N+ G  C+ C +G+YG+     G  C+ C CP G +S ++ +  C    +     C CK+GY+G  C++C   ++GN     G CQPCRCS NID    ++C+ +TG+CRKCL+NT G +C  C SGY+G+G+ R C KC CN +GT      S+ + +C   TG+C CLPNVVGL CD C   ++NL+   GC  C CD P  A   +CN+ TGQC C+ G  G+ C +C++ FWGDP  L  C  C C+  G    QCNR  G C C+ G++G  CD C +G  G  P C  C  C+  WD                             + D+ T  +      +EI+     G ++       EKL+                Q  SI+   N+T  A      MI   +++I + T   N L+  L  +        N  S+ ++  + + L  ++L ++ + L+N N       ++    KS+D +   N+ + +  +    +  T  ++  L+
Sbjct:    2 LTILLLFCCALANAAIKEPDQAHGCTHGSCYPATGDLLVGREKNLKASSTCGLTRREPYCIV--SHLQEEKKCFQCDSRRPYDPQYNIISHRIENVITTFRPDRKKCWWQSENGKSDVYIQLDLEAEFHFTHLIMTFKTFRPAALLIERSADFGRTWQVYRYFAYDCASVFPGISPGPLRKVDDVICESRYSDIEPSTEGEVIFRVLDPAIRIEDPYSPRIQNQLK-ITNLRVNFTSLHTLGDNLLDSRLEIKEKYYYAMYELVVRGNCFCYGHASECAPIQGIRDDIEGMVHGRCVCKHNTKGLNCEQCDDFHNEHPWKPAEGRNTNACKKCNCNAHSSKCHFDMAVYLSTGNVSGGVCDNCLHNTMGRNCETCKPFYYQDPSKDIRDPRVCIACDCDPDGSVNGGMCDGHDDPSLGMIAGQCRCKQNVEGSRCDKCKPGFFGLSPDDPLGCQPCKCDPRGTLSGSSQCDPVKGDCFCKRLVTGRSCNQCLPEHWALSH-DASGCRACDCDVGGAVDNQ-CSMESGHCLCRSHMVGRQCSQVESGYFFMALDYYLYEAELAKLGQGCTVEEKEHQPGHVASWTGTGFARAPEGGTLEFIINNIPYSME-YDVLIRYELQMPRDWEEVRVTVVRPGPIPTSSPCGNTIPADDLLTVSMPSGSRFMVLPQPVCLEKGIRYTLRLEFVRYADKNSIPSFSNANILIDSIALLPRHTSLEMFVAGDPASLARKQSYERHRCHETAKSVTRPALTDACAKLISSMSAIIIDGALP--CECDPQGSVSSECDVRGGQCRCRPNIIGRRCDQCAPGTYGFGPSGCRLCECSQEGSRGRFCDENTGQCPCLPGAFGQRCDGCQAGHWGFPNCRPCQCNGHADECHQRTGACLSCRSNTAGDKCEKCASGFYGNPILGSGNQCRPCPCPEGPNSGRHFAASCYQDNHNRQVVCNCKQGYTGVRCEECAPGYYGNPSQPGGRCQPCRCSNNIDLSDPEACDRRTGQCRKCLYNTEGSDCSICKSGYYGDGSRRNCRKCTCNFLGTERSQCLSREECLCQRPTGQCQCLPNVVGLTCDHCAPNYWNLAGGRGCESCGCD-PNNAYTSACNEFTGQCQCRDGFGGRTCRDCQENFWGDPRIL--CRACDCDRRGIETSQCNRVTGHCACRQGVSGVRCDQCARGFSGTFPACQPCHQCFGDWDRI---------------------------VQDLATKTKALAARSQEIQTTGMTGPFEKRFKELEEKLA----------------QAQSIVNARNATAEAVTNLMGMIEELRSRIGETTDTLNRLEGDLTAVQDSNYEASNELSKLEREAKELNLTSEQLNHQLDILKNSNFLGAYDSIRASYNKSRDAERRANQSTTDTPSTVSQSAGTRKKTERLI 1356          
BLAST of Netrin-4 vs. Ensembl Cavefish
Match: lamb1b (laminin subunit beta-1-like [Source:NCBI gene;Acc:103026945])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 454/1308 (34.71%), Postives = 680/1308 (51.99%), Query Frame = 3
Query:  117 ESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCK-AKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY----------------------IEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFII-------------VLSIYHVGKSSCQSY-------QDTMQLIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLG---------------ECLNYANLVSSKKCDFLNAE--ISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK----WQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPK------EIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISN------------FSEKLSRLKYYV------YNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKK 3758
            + ++ C +  C P  GDLLIGR   L ASSTCGL   E YC+V+   +G   KC  CDS+  Y  +S  +SH I+NVV+    +  + WWQS +G+ NV+I++  E+EF FT   + FKT+RPAAM IERS DYG++W  Y YF+ +C   FP I +    N+++++C S +S + PS  G V+F A    +   D Y  + +N +  ITN+RV+ ++LHT GD  +D    +R KYYYA+ + ++RG C CYGHAS+C   +E +     MV+G C C+H+T G +CE+C++FY D+PW PA   STN C+KCECN HS  CHFD  VY  S  +SGGVCDNCQHNT+ ++C+ CK  YY++    +   + C  C CD LG+    IC    ++  GL AG C CK NVEG  C+ CK G +  +     GCL C+C  MGTL     CD+ TG+CYC+  VTG  C  C   ++ LSN +++GC  C C + G   N  C   +G+C+C+    G RCD+++S +Y                      + +P     H     I    V + G   F I    ++M++  S +I             ++ +   G  S  ++       Q +  L    RY+V+P   CLEK     + +     ++        +++  ++ V + K  ++                  CL     V       +  E   S + +     ++C+C+  GS +  C+ IGGQC C PNV GK C+ C+  ++     GC+ C+CD  GSLN  C   TG+C C  GV G+ C  C   +W FP C  C CN  S  C  +TG+CL C+ ++ G +C+ CE+GY+G+   S G  C+ C CP G  S +  +  C    N     C+C  GY G  C++C   ++GN     G C PC+C+GNI      SC+S+TG C +CLF+T G  C+ C  GY+G+ + ++C KC+C  +GT S+     +  C+  +G+CPCLP VVGL CDRC    +N++S+ GC PC C +P  + + SC+ L+GQC C+ G  G+ C  C++ FWGDP     C  C C+  G    QCN+  G C C  G++G+ CD C +G  G  P+C  C  C+ +WD        T ++L N +   + NV+  K         D  +SLE  +K L +I +       +  S                 L+R +  V      +   + D NT       +++ST+  +A + + K  ++ GA + +++
Sbjct:   23 DHNDKCAEGSCYPATGDLLIGRAHRLMASSTCGLNGPETYCIVSNMQAG---KCFDCDSRETYDEYSYPNSHTIDNVVTTFTPNRLKTWWQSQNGMENVTIQLDLEAEFHFTHLIMTFKTFRPAAMVIERSADYGQSWKVYRYFAFDCSESFPYISQGPVVNVDDIICDSRYSDMEPSTAGEVIFRALDPVFKIPDPYSQRIQN-LLRITNLRVRMLKLHTLGDDLLDGGEEVRRKYYYALYDMVVRGNCFCYGHASECAPVRESERGEDGMVHGHCMCKHHTTGLNCEECEEFYQDAPWKPAQGRSTNACKKCECNYHSDECHFDMAVYLSSGNVSGGVCDNCQHNTQGQHCDDCKPFYYQHPNKHLRDPRICRPCDCDPLGSLNDGICDSVTDVLKGLIAGQCRCKPNVEGESCNHCKPGHYGLS-EHPLGCLPCSCNPMGTLPGGNPCDTETGRCYCRRLVTGQYCDQCLPQFWGLSN-DMDGCRPCDC-DLGGALNNDCPPVTGQCVCREHMFGRRCDQMESGYYFASLDHYIYEAEDAAFDPAVKVVPRPLPADRHPTWTGIGFANVPEGGTLRFTIDNVPQSMEY--SLLIRYEPQLPDVWEQVMVDVKRTGFPSPSAHCSPPYADQQSASLPPGYRYVVLPRPVCLEKGQTYTVEMLMALYSSNDLHQNPHMLIDSIVLVPAVKDLELFSGSPDRQEAWTMFQKYRCLEQGQSVQKTPMTDICREYIFSASALMHQGAMECQCDPRGSVSLLCDSIGGQCSCRPNVVGKRCDTCSPGTFQLGPSGCRSCECDPMGSLNDFCDTTTGQCPCLPGVYGRQCAHCLHNHWGFPHCQECFCNGHSHHCHPQTGQCLECRDHTTGQHCERCESGYHGNALLSSGEHCRPCMCPDGPGSGRQFADTCYHNPNLRQLVCVCSPGYKGSRCEECMPGYYGNPHVVGGRCHPCQCNGNIHMHDPGSCDSRTGVCLRCLFHTEGHGCQHCRRGYYGDASTQSCQKCMCLPLGTASQSCRDGECECDRVSGQCPCLPGVVGLNCDRCAPNTWNINSKEGCQPCKC-HPTHSYSLSCDLLSGQCSCKPGFGGRACGECRELFWGDPEI--KCHACDCDPRGIATPQCNKMTGTCVCAEGVSGKRCDSCGRGYVGTFPDCQRCHKCFSEWDL-------TVNELTNQTQHLVGNVEELKVSGLVSAYQDTVSSLEGGIKELTQIVEDNKAHQTLTHSENLLRQAKEMKLVLGRSLNRTEQTVGQVSADHTRALDDLNTLSEEAQRLQDSTEDKQAQVLRIKHSNIRGAADSIRE 1311          
BLAST of Netrin-4 vs. Ensembl Cavefish
Match: lamb2 (laminin, beta 2 (laminin S) [Source:ZFIN;Acc:ZDB-GENE-081030-4])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 394/1192 (33.05%), Postives = 592/1192 (49.66%), Query Frame = 3
Query:  708 WNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKIN----------------------LPPVSKSGYYNFVITTDTKNMQFFDSFI------------IVLSIYHVGKSSCQS-------YQD--TMQLIKDSRYIVIPNK-CLEKDLPIVLTVFTIESNNKXXXXXXXXX-----XXXXXXXNSTKTRKVLGECLNYANLVSSKK------------------CDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTN-----SKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIG-YDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYA----KAMIS--KNKIRDVTGAFNELKKSLKNIL-------NGASESKKIYQNITLIKDKLFYRNEELRNIN-------LKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLM 3989
            W +  ND   ITN+RV F  LHT GD  +D    I+ KYYYA+ E ++RG C CYGHAS+C   +G +  ++ MV+G C C+HNTKG +CE+C DF+N+ PW PA+  +TN C+KC CN+HSS CHFD  VY  +  +SGGVCDNC HNT  +NCE CK  YY++ +  I   + C+ C CD  G+    +C    +  LG+ AG C CK+NVEG++CDKCK GF+  + ++  GC  C C   GTL     CD   G C+CK  VTG  C+ C   ++ LS+ + +GC  C C   G+ DN+ C   SG CLC++   G +C +++S ++     Y L   +  K+                            + G   F+I     +M++ D  I            + +++   G     S         D  T+ +   SR++V+P   CLEK +   L +  +   +K               I LL  +++    V G+  + A   S ++                  C  L + +S   +  + P  C+C+  GS ++ C+  GGQC+C PN+ G+ C++CA  +YGF   GC+ C+C   GS    C  +TG+C C  G  GQ CD C+ G+W FP C  C+CN  +  C  +TG CL+C+ N+ G  C+ C +G+YG+     G  C+ C CP G +S ++ +  C    +     C CK+GY+G  C++C   ++GN     G CQPCRCS NID    ++C+ +TG+CRKCL+NT G +C  C SGY+G+G+ R C KC CN +GT      S+ + +C   TG+C CLPNVVGL CD C   ++NL+   GC  C CD P  A   +CN+ TGQC C+ G  G+ C +C++ FWGDP  L  C  C C+  G    QCNR  G C C+ G++G  CD C +G  G  P C  C  C+  WD                             + D+ T  +      +EI+     G ++       EKL+                Q  SI+   N+T  A      MI   +++I + T   N L+  L  +        N  S+ ++  + + L  ++L ++ + L+N N       ++    KS+D +   N+ + +  +    +  T  ++  L+
Sbjct:  107 WWQSENDQLKITNLRVNFTSLHTLGDNLLDSRLEIKEKYYYAMYELVVRGNCFCYGHASECAPIQGIRDDIEGMVHGRCVCKHNTKGLNCEQCDDFHNEHPWKPAEGRNTNACKKCNCNAHSSKCHFDMAVYLSTGNVSGGVCDNCLHNTMGRNCETCKPFYYQDPSKDIRDPRVCIACDCDPDGSVNGGMCDGHDDPSLGMIAGQCRCKQNVEGSRCDKCKPGFFGLSPDDPLGCQPCKCDPRGTLSGSSQCDPVKGDCFCKRLVTGRSCNQCLPEHWALSH-DASGCRACDCDVGGAVDNQ-CSMESGHCLCRSHMVGRQCSQVESGYFFMALDYYLYEAELAKLGQGCTVEEKEHQPGHVASWTGTGFARAPEGGTLEFIINNIPYSMEY-DVLIRYELQMPRDWEEVRVTVVRPGPIPTSSPCGNTIPADDLLTVSMPSGSRFMVLPQPVCLEKGIRYTLRLEFVRYADKNSIPSFSNANILIDSIALLPRHTSLEMFVAGDPASLARKQSYERHRCHETAKSVTRPALTDACAKLISSMSAIIIDGALP--CECDPQGSVSSECDVRGGQCRCRPNIIGRRCDQCAPGTYGFGPSGCRLCECSQEGSRGRFCDENTGQCPCLPGAFGQRCDGCQAGHWGFPNCRPCQCNGHADECHQRTGACLSCRSNTAGDKCEKCASGFYGNPILGSGNQCRPCPCPEGPNSGRHFAASCYQDNHNRQVVCNCKQGYTGVRCEECAPGYYGNPSQPGGRCQPCRCSNNIDLSDPEACDRRTGQCRKCLYNTEGSDCSICKSGYYGDGSRRNCRKCTCNFLGTERSQCLSREECLCQRPTGQCQCLPNVVGLTCDHCAPNYWNLAGGRGCESCGCD-PNNAYTSACNEFTGQCQCRDGFGGRTCRDCQENFWGDPRIL--CRACDCDRRGIETSQCNRVTGHCACRQGVSGVRCDQCARGFSGTFPACQPCHQCFGDWDRI---------------------------VQDLATKTKALAARSQEIQTTGMTGPFEKRFKELEEKLA----------------QAQSIVNARNATAEAVTNLMGMIEELRSRIGETTDTLNRLEGDLTAVQDSNYEASNELSKLEREAKELNLTSEQLNHQLDILKNSNFLGAYDSIRASYNKSRDAERRANQSTTDTPSTVSQSAGTRKKTERLI 1247          

HSP 2 Score: 80.4925 bits (197), Expect = 1.446e-14
Identity = 50/127 (39.37%), Postives = 71/127 (55.91%), Query Frame = 3
Query:   63 MTLNYVFIIFVA-RYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVS-IEISFES 434
            +T+  +F   +A   I E +  + C    C P  GDLL+GRE  L+ASSTCGLT  E YC+V  S    + KC  CDS+ PY    +  SHRIENV++    D  + WWQS +    ++ + ++F S
Sbjct:    2 LTILLLFCCALANAAIKEPDQAHGCTHGSCYPATGDLLVGREKNLKASSTCGLTRREPYCIV--SHLQEEKKCFQCDSRRPYDPQYNIISHRIENVITTFRPDRKKCWWQSENDQLKITNLRVNFTS 126          
BLAST of Netrin-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.189 bits (731), Expect = 6.298e-79
Identity = 267/1045 (25.55%), Postives = 432/1045 (41.34%), Query Frame = 3
Query:  438 FQFTFTHLRFK-TYRPAAMYIERSKDYGRTWNKYAYFS---DNCPRDF---PSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTF-GDWKV-------DDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMS-------GGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQ-----EPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSR-------DNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPP----VSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTM-----QLIKDSRYIVIPNKCLEKDLPIVLT---VFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKC--NVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF------CHSCKC------NQMSTTCDSKTGKCLNCK---GNSFGYNCQNCENGYYGD-TSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCM-CKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSC 3377
            FQ  +  ++   + RP    +ERS D G T++ + Y+S     C   +   P++        +EV+CTS +  ++    G +  S        +D   + K  D T+   IR++  R+ T   D          + +P +  +YYY+I +  + G C C GHAS C   E   +++      C C+HNT G++C+ C   YN   W P   N+ N C KC C+  +  C++D  V + +R +S       GGVC NC  NT   NCE C+ G+YR   V  N    C  C CD  G+    +CI+     +PE D  L+ G C+C+    G +C++C   +  +       C  C C M G   +   D  +  C CK  V G  C  C+ G+++L   N  GCS C C    S          +  D    +   + G         K + ++E     + +  +++  LP     ++ + Y    +T    ++++  S+ I +       S   S  D +     Q +      ++     E+ L + L     F   SN  +    +   +  +  +    +   + + +   + VS    D  + + +  +    D  +C C     G+   +C +  G  +    + G  CE C    +  D        CD    L+  C      C  R    G HC+ C+PG++          C  C C      N  S TC       L C        G  C+ C + ++G+ +S G  C++C+C G       + G   + +     C+ C++  +G  C++C    +G+A    G CQPC+C  + +      C+   G+C  C  +  G  CE+C  G++G  +   C+ C C+ +GT     G+     G+C C P V G  CDRC    +    + GC PCNC +     NH C+Q TG+C C     G  C+ C D  WG      GC  C C+   S   +C+  +G C C  G  GR C  C +G  G  P C  C
Sbjct:    3 FQVAYVIVKAANSPRPGNWILERSLD-GATYHPWQYYSVSDSECLTRYGITPTVGNPVYRRDDEVICTSYYVVLLMLARGKIHTSLINGRPSADDP--SPKLLDFTSARYIRLRLQRIRTLNADLMTLSHRDPREVDPIVTRRYYYSIKDISVGGMCICSGHASTCPWNEDTQKME------CQCEHNTCGENCQHCCPGYNQRRWRPGTINNGNTCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGS-LSQVCIKDEKHADPEKD--LSPGQCLCRPGFAGERCERCAFAYRGY-----PDCKPCLCSMAGGTND---DPCSEPCVCKERVEGEHCDRCRAGFYDLRPRNPRGCSACFCFGLSSSCRSLPWGVTQVVDMRGWRVTDRQGLR-------KVKTFVEVDQVAVRN-ADVRRTLPALYYWLAPTSYLGNKLTAYAGHLRYSVSYDIPVDST---DSEMISDVDVIIEGNGQALSSGSLGLMLQPFEEQTLSLRLLPENFFDFRSNAPVSRDALMTALANVTRLQIRASYSSVKQAVYRLSAVS---LDVASPDAAVGSPAALDVEQCHCPHGYAGTSCESCMR--GHRRVDGTLHGGRCEPCRCHGHADD--------CD---DLSGDCMLPLSGC--RHNTMGPHCELCRPGFYGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRGVLTCDQCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNG----NEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGG-CQPCQC--HPEGATAPQCDRINGQC-PCRPSVVGRTCEQCAIGFYGLSSGAGCSPCPCHPVGT----AGVACSADGRCHCWPGVEGRSCDRCTSGHYGF-KEGGCTPCNCSH----TNHHCDQETGRCLCPPNTEGTRCHRCIDDHWGV-NPHAGCRACNCSAAHSRGARCDEASGQCSCLDGYGGRTCGECAQGRWG-YPACRPC 979          

HSP 2 Score: 158.688 bits (400), Expect = 3.709e-39
Identity = 131/438 (29.91%), Postives = 190/438 (43.38%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQ-----CLPNVSGKTCERCASESYGFDARG----CKKCKCDLTGSLN---SQCYNDTGKCL----CREGVEGQHCDTCKPGYWNFPF-----CHSCKCNQ------MSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQC--PGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFG--NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQ-----------CNRNNGVCRCKPGITGRNCDMCMKGTDG 3353
             C+C+      ++C+ + G C      C  N  G  CE C    YG   RG    C  C C L+ + N     C+ D    L    C  G  G  C+ C   ++  P      C  C+CN           CD++TG+CL C+  + G++C+ C +G+YGD +    C+ CQC   G ++ + + I            C C+    G+ C+QC    +G  +S    C PC C       +  +C S  G C  C     G +C++C SG++G   G    CT C C+H  TN      C+ ETG+C C PN  G +C RC D  + ++   GC  CNC     +    C++ +GQC C  G  G+ C  C  G WG P     C  C C+ +G+               C+   G C CK  + G  CD C+ GT G
Sbjct:  624 PCRCH---GHADDCDDLSGDCMLPLSGCRHNTMGPHCELCRPGFYGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRGVLTCDQCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGGCQPCQCHPEGATAPQCDRIN---------GQCPCRPSVVGRTCEQCAIGFYG--LSSGAGCSPCPCHPVGTAGV--AC-SADGRC-HCWPGVEGRSCDRCTSGHYGFKEGG---CTPCNCSH--TNHH----CDQETGRCLCPPNTEGTRCHRCIDDHWGVNPHAGCRACNCSA-AHSRGARCDEASGQCSCLDGYGGRTCGECAQGRWGYPA----CRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPGTFG 1029          

HSP 3 Score: 100.523 bits (249), Expect = 2.112e-21
Identity = 101/357 (28.29%), Postives = 144/357 (40.34%), Query Frame = 3
Query: 2229 QCLPNVSGKTCERCASESYGFDAR---GCKKCKC---DLTGSLNSQCYNDTGKCL-CREGVEGQHCDTCKPGYWNFPF----CHSCKCNQMSTT---CDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFG-----------------NGAV----------------RTCTKCV-------------CNHMGTNSKWQGI--------CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQ--IGCLPCNC 3089
            QCLP   G  CERCA + +G  +     C++C+C   +        C   TG+CL CRE   G HC+ C  G++        C  C+C+    T   CD   G+C  C+ +  G  C+ C  G+YG +S G  C  C C        + +G + +  +    C C  G  G+ CD+C + H+G    K+G C PC CS          C+ +TG C  C  NT G  C +C+  ++G                  GA                 RTC +C              C+  GT +             C+  TG+C C  NV G +CD C    F L+ +   GC  C C
Sbjct:  706 QCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGGCQPCQCHPEGATAPQCDRINGQC-PCRPSVVGRTCEQCAIGFYGLSS-GAGCSPCPC--------HPVGTAGVACSADGRCHCWPGVEGRSCDRCTSGHYG---FKEGGCTPCNCS-----HTNHHCDQETGRC-LCPPNTEGTRCHRCIDDHWGVNPHAGCRACNCSAAHSRGARCDEASGQCSCLDGYGGRTCGECAQGRWGYPACRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPGTFGLNREDPRGCTACFC 1043          

HSP 4 Score: 98.2117 bits (243), Expect = 1.063e-20
Identity = 88/312 (28.21%), Postives = 126/312 (40.38%), Query Frame = 3
Query:  858 RCSC------YGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLE-HLKEIKINLPPVSKSG 1769
            RC C      +G    C A+ GQ            C+  T G HCE+C D FY D+         T  C+ C+C       H +     Q  +++G     C+ +   + CE+C  G+Y      ++S   C  C C  +GT   +              G C C   VEG  CD+C  G + F   +E GC  CNC    +  N  CD  TG+C C     G  C  C   ++ ++     GC  C CS   SR  + CD+ SG+C C +G+ G  C E     +      P E H +  + N  P   +G
Sbjct:  736 RCECNGNEEAWGGGRVCDARTGQCL---------RCRERTAGFHCERCADGFYGDA-------TGTGGCQPCQC-------HPEGATAPQCDRINGQC--PCRPSVVGRTCEQCAIGFY-----GLSSGAGCSPCPCHPVGTAGVACSAD----------GRCHCWPGVEGRSCDRCTSGHYGF---KEGGCTPCNC----SHTNHHCDQETGRCLCPPNTEGTRCHRCIDDHWGVNPHA--GCRACNCSAAHSRGAR-CDEASGQCSCLDGYGGRTCGECAQGRWGYPACRPCECHPEGTRANTCPAPPTG 997          

HSP 5 Score: 84.7297 bits (208), Expect = 1.590e-16
Identity = 56/170 (32.94%), Postives = 81/170 (47.65%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDAR-GCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTT--------------CDSKTGKCLNCKGNSFGYNCQNCENGYYG---DTSRGILCKKCQCPGLSSL 2621
             C C+ T   N++C++  G+C C PN  G  C RC  + +G +   GC+ C C    S  ++C   +G+C C +G  G+ C  C  G W +P C  C+C+   T               CD +TG+C  CK N  G  C  C  G +G   +  RG  C  C C G+SS+
Sbjct:  886 PCNCSHT---NHHCDQETGRCLCPPNTEGTRCHRCIDDHWGVNPHAGCRACNCSAAHSRGARCDEASGQCSCLDGYGGRTCGECAQGRWGYPACRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCA-CKENVGGTRCDACLPGTFGLNREDPRG--CTACFCFGVSSV 1049          
BLAST of Netrin-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 1.297e-62
Identity = 137/365 (37.53%), Postives = 183/365 (50.14%), Query Frame = 3
Query:  438 FQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINE------VLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDC 1514
            F  T+  L+F T RP +  I +       W  Y Y+S +C    P+  +R R  +         LCT EFS I P  GG V FS         +   +    D    T IRV   RL+TFGD   +D+  +R+ YYYAIS++ + GRC C GHAS+C   E       +    C C+HNT G  CEKC   YND PW  A   S NEC  C+CN  +  C+FDP +Y+ +    GG C NC+ NT+ K CERC   +YR  A     S+ CL C+C+ +G+ +   C ++         G C CK+ V G +CD+C  GF      +E GC  C C   GTLE+  C   TG+C CK  V G +C
Sbjct:    4 FDITYVRLKFHTSRPESFAIYKRASMDGPWTPYQYYSGSCE---PTYGKRNRGFLRSGDDEQTPLCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQDWVTSTEIRVTLNRLNTFGDEVFNDHKVLRS-YYYAISDFAVGGRCKCNGHASECVKNE-------LGALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRAT--GHGGHCTNCRDNTDGKTCERCLENFYRRSA-----SEHCLPCNCNPVGS-YSRQCDEQ---------GRCSCKQGVMGERCDQCLPGFHSM---DEAGCRPCTCNPAGTLED--CQPDTGRCVCKDNVEGYNC 335          

HSP 2 Score: 81.6481 bits (200), Expect = 1.772e-16
Identity = 65/208 (31.25%), Postives = 96/208 (46.15%), Query Frame = 3
Query: 2739 AISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRT-------CTKCVCNHMGTNSKWQGICNHETGK----CPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCD 3329
            AIS       C+C+G+  + +++   +   +CR    NT G +CEKC+  Y      R        CT C CN       +       TG       C  N  G  C+RC + F+  S+   CLPCNC+ P+G+ +  C++  G+C C+ G  G+ C+ C  GF        GC  C CN  G++ + C  + G C CK  + G NCD
Sbjct:  137 AISDFAVGGRCKCNGHASECVKNELGALACKCRH---NTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFYRRSASEHCLPCNCN-PVGSYSRQCDE-QGRCSCKQGVMGERCDQCLPGFHS--MDEAGCRPCTCNPAGTL-EDCQPDTGRCVCKDNVEGYNCD 336          

HSP 3 Score: 73.1738 bits (178), Expect = 1.082e-13
Identity = 69/234 (29.49%), Postives = 102/234 (43.59%), Query Frame = 3
Query: 2517 NSFG---YNCQNCENGYYGDTSRGILCKKCQCPGLSS-LKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQC----ETNHFGNAISKDGT-CQPCRCSGNIDQRIEDS----CNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCN 3179
            N+FG   +N       YY   S   +  +C+C G +S    N +G        A  C C+    G  C++C        +  A S+    C  C C+G  D+   D          G C  C  NT G  CE+C+  ++   A   C  C CN +G+ S+    C+ E G+C C   V+G +CD+C   F ++  + GC PC C+ P G L   C   TG+C C+    G  C+
Sbjct:  118 NTFGDEVFNDHKVLRSYYYAISDFAVGGRCKCNGHASECVKNELG--------ALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFYRRSASEHCLPCNCNPVGSYSRQ---CD-EQGRCSCKQGVMGERCDQCLPGFHSM-DEAGCRPCTCN-PAGTL-EDCQPDTGRCVCKDNVEGYNCD 336          

HSP 4 Score: 72.0182 bits (175), Expect = 2.754e-13
Identity = 48/113 (42.48%), Postives = 60/113 (53.10%), Query Frame = 3
Query: 2217 GGQC-QCLPNVSGKTCERCASESYGFDA-RGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNF--PFCHSCKCNQMSTT--CDSKTGKCLNCKGNSFGYNC 2537
            GG C  C  N  GKTCERC    Y   A   C  C C+  GS + QC ++ G+C C++GV G+ CD C PG+ +     C  C CN   T   C   TG+C+ CK N  GYNC
Sbjct:  225 GGHCTNCRDNTDGKTCERCLENFYRRSASEHCLPCNCNPVGSYSRQC-DEQGRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCTCNPAGTLEDCQPDTGRCV-CKDNVEGYNC 335          

HSP 5 Score: 61.2326 bits (147), Expect = 8.321e-10
Identity = 31/82 (37.80%), Postives = 48/82 (58.54%), Query Frame = 3
Query: 2163 IKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCD 2408
            + C CN  GS +  C++ G +C C   V G+ C++C    +  D  GC+ C C+  G+L   C  DTG+C+C++ VEG +CD
Sbjct:  257 LPCNCNPVGSYSRQCDEQG-RCSCKQGVMGERCDQCLPGFHSMDEAGCRPCTCNPAGTL-EDCQPDTGRCVCKDNVEGYNCD 336          

HSP 6 Score: 53.9138 bits (128), Expect = 1.566e-7
Identity = 61/210 (29.05%), Postives = 82/210 (39.05%), Query Frame = 3
Query: 2310 KCKCDLTGSLNSQCYNDTGK--CLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTC---------DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEK 2876
            +CKC+  G  +    N+ G   C CR    G  C+ C P Y + P+          C  C CN  +  C             G C NC+ N+ G  C+ C   +Y   S    C  C C        N +G           C CK+G  G+ CDQC     G     +  C+PC C  N    +ED C   TG C  C  N  G+NC++
Sbjct:  146 RCKCN--GHASECVKNELGALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFY-RRSASEHCLPCNC--------NPVGSYSRQCDEQGRCSCKQGVMGERCDQCLP---GFHSMDEAGCRPCTC--NPAGTLED-CQPDTGRC-VCKDNVEGYNCDR 337          
BLAST of Netrin-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006618.1 (pep scaffold:Pmarinus_7.0:GL481588:182:19210:1 gene:ENSPMAG00000005955.1 transcript:ENSPMAT00000006618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 2.374e-54
Identity = 136/495 (27.47%), Postives = 221/495 (44.65%), Query Frame = 3
Query: 2535 CQNCENGYYGDTSRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNG-AVRTCTKCVCNHMGTNSKWQGI------CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGI---TGRNCDMCMKGTDGKMPNCSSCGD-CWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKE-----------IKKYFPIGYDI--IISNFSEKLSRLKYYV-------YNSNII--DFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLIN 3917
            C  C +GYYG    G  C+ CQCP G  + ++ + GCS    + A  C C  G++G  CDQC   H+G+     G CQPC+C+GNID     SC+ +TG C +CL +T G  C+ C  GY+G+  + R C KC C   GT     G+      C+  +G+C CLPNV GL CDRC    + LS   GC PC CD P  +   SC++  GQC+C  G  G  C+ C++  WG+P     C++C           C      C  +P +   TGR CD C +G  G  P C  C + C+  W+  +  +      L   +   ++              +E+N+   +E           +++   +  D+   +   + +L++L+  +        ++N++  + +       T  +   Y    I  +  R   GA+  +K S +     + E+++              R+E  R    KF+  K  +++  ++
Sbjct:    1 CCRCASGYYGSPGAGEQCRPCQCPEGPGTGRHFASGCSHDPRSRAVACACLPGFTGARCDQCSPGHYGDLRVAGGRCQPCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYGDATSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLSQGTGCRPCGCD-PAHSAGPSCSEFNGQCHCLPGFGGLTCSECQENHWGEPRVK--CSECL------THNLCMAQLAYCLFRPPVRSETGRRCDRCARGFSGAFPACEPCHEPCFPDWEAAISELGRRAGGLSERATRLLTGGADAGPYARRMAEVEENLAGARELLAVRNASAAAVERLSGLIDDVGRQVEAMTGRLAQLEAGIGGAAKQNGDANVLLSELDRDAREASTRASELGYQIDTIKHSNFR---GAYGSVKDSYQQ----SREAERKASGAATNPAGPVARSEATRQRAEKFMAAKRAELEQRLD 479          

HSP 2 Score: 103.219 bits (256), Expect = 3.158e-22
Identity = 92/302 (30.46%), Postives = 131/302 (43.38%), Query Frame = 3
Query: 2265 RCASESYGFDARG--CKKCKCDL---TGS-LNSQCYND----TGKCLCREGVEGQHCDTCKPGYWN-----FPFCHSCKCN-----QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTA-----FTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNV---VGLQCDRCQDKFFNLSSQIGCLPCN 3086
            RCAS  YG    G  C+ C+C     TG    S C +D       C C  G  G  CD C PG++         C  C+CN       + +CD +TG+CL C  ++ G  CQNC  GYYGD +    C+KC C    + +++   C L     A       C C     G  CD+C  NH+G  +S+   C+PC C  +       SC+   G+C  CL    G  C +C   ++G   V+ C++C+ +++         C  +   C   P V    G +CDRC   F        C PC+
Sbjct:    3 RCASGYYGSPGAGEQCRPCQCPEGPGTGRHFASGCSHDPRSRAVACACLPGFTGARCDQCSPGHYGDLRVAGGRCQPCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYGDATSQRRCQKCTCVTAGTERSS---CGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWG--LSQGTGCRPCGC--DPAHSAGPSCSEFNGQC-HCLPGFGGLTCSECQENHWGEPRVK-CSECLTHNL---------CMAQLAYCLFRPPVRSETGRRCDRCARGFSGAFP--ACEPCH 284          

HSP 3 Score: 72.7886 bits (177), Expect = 6.182e-13
Identity = 74/259 (28.57%), Postives = 109/259 (42.08%), Query Frame = 3
Query: 2226 CQCLPNVSGKTCERCASESYGFDAR----GCKKCKC--DLTGSLNSQCYNDTGKCL-CREGVEGQHCDTCKPGYWNFPF----CHSCKCNQMST------------TCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGEC--RKCLFNTSGFNCEKCVSGYFGNGAVRTCTKC 2927
            C CLP  +G  C++C+   YG D R     C+ C+C  ++  +  + C   TG+CL C    EG  C  C+PGY+        C  C C    T             CD ++G+C  C  N  G  C  C   ++G  S+G  C+ C C    S   +   CS  FN     C C  G+ G  C +C+ NH+G    K   C  C           + C ++   C  R  + + +G  C++C  G+  +GA   C  C
Sbjct:   48 CACLPGFTGARCDQCSPGHYG-DLRVAGGRCQPCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYGDATSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQC-RCLPNVQGLACDRCTPNHWG-LSQGTGCRPCGCDPAHSAGPS---CS-EFNG---QCHCLPGFGGLTCSECQENHWGEPRVK---CSEC--------LTHNLCMAQLAYCLFRPPVRSETGRRCDRCARGF--SGAFPACEPC 283          

HSP 4 Score: 67.781 bits (164), Expect = 2.273e-11
Identity = 66/249 (26.51%), Postives = 97/249 (38.96%), Query Frame = 3
Query:  978 KCKDFYNDSPWLPADKNSTNECRKCEC-------NSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCI-CKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENR--------GCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE 1676
            +C   Y  SP       +  +CR C+C          +S C  DP         S  V   C        C++C  G+Y ++ VA      C  C C+  G   P+              G C+ C  + EG+ C  C+ G++  +   +  C KC CV  GT  +          CD  +G+C C   V G  C  C   ++ LS     GC  C C    S    +C +++G+C C  GF G+ C E
Sbjct:    3 RCASGYYGSP------GAGEQCRPCQCPEGPGTGRHFASGCSHDP--------RSRAVACACLPGFTGARCDQCSPGHYGDLRVA---GGRCQPCQCN--GNIDPTDAA-----SCDGRTGRCLRCLRDTEGSACQNCRPGYYG-DATSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLSQGT--GCRPCGCDPAHS-AGPSCSEFNGQCHCLPGFGGLTCSE 223          

HSP 5 Score: 63.1586 bits (152), Expect = 5.600e-10
Identity = 45/147 (30.61%), Postives = 62/147 (42.18%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNC---------NKIGGQCQCLPNVSGKTCERCASESYGF-DARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMST--TCDSKTGKCL--NCKGNSFGYNCQNCENGYYG 2564
            KC C   G+  ++C         +   GQC+CLPNV G  C+RC    +G     GC+ C CD   S    C    G+C C  G  G  C  C+  +W  P     KC++  T   C ++   CL      +  G  C  C  G+ G
Sbjct:  132 KCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLSQGTGCRPCGCDPAHSAGPSCSEFNGQCHCLPGFGGLTCSECQENHWGEP---RVKCSECLTHNLCMAQLAYCLFRPPVRSETGRRCDRCARGFSG 275          

HSP 6 Score: 62.003 bits (149), Expect = 1.048e-9
Identity = 55/198 (27.78%), Postives = 81/198 (40.91%), Query Frame = 3
Query:  936 VCDCQHNTKGQHCEKCKDFYNDSPWLPAD-KNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCK 1526
             C C     G  C++C      SP    D + +   C+ C+CN +      DP         +G  C  C  +TE   C+ C+ GYY +      S + C KC C + GT+  S  + +        +G C C  NV+G  CD+C    W    ++ TGC  C C    +     C    G+C+C     G  CS C+
Sbjct:   47 ACACLPGFTGARCDQC------SPGHYGDLRVAGGRCQPCQCNGN-----IDPTDAASCDGRTG-RCLRCLRDTEGSACQNCRPGYYGDA----TSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGL--SQGTGCRPCGCDPAHSA-GPSCSEFNGQCHCLPGFGGLTCSECQ 225          

HSP 7 Score: 56.9954 bits (136), Expect = 3.712e-8
Identity = 68/246 (27.64%), Postives = 103/246 (41.87%), Query Frame = 3
Query: 2160 PIKCKCNVTGSRNNNCNKIGGQC-QCLPNVSGKTCERCASESYGFDA---RGCKKCKCDLTGSLNSQCYNDTGKCLC--REG-------VEGQHCDTCKPGYWNFP---FCHSCKCNQMST---TCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIF--------NTTAFTC-MCKKGYSGQF--CDQCETNHFGN---AISKDGTCQPCRCSGNIDQR 2798
            P +C  N+  +   +C+   G+C +CL +  G  C+ C    YG DA   R C+KC C   G+  S C    G C C  R G       V+G  CD C P +W       C  C C+   +   +C    G+C +C     G  C  C+  ++G+    + C +C       L +N     L +        + T   C  C +G+SG F  C+ C    F +   AIS+ G     R +G + +R
Sbjct:   79 PCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYG-DATSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLSQGTGCRPCGCDPAHSAGPSCSEFNGQC-HCLPGFGGLTCSECQENHWGEPR--VKCSEC-------LTHNLCMAQLAYCLFRPPVRSETGRRCDRCARGFSGAFPACEPCHEPCFPDWEAAISELG-----RRAGGLSER 308          
BLAST of Netrin-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008872.1 (pep scaffold:Pmarinus_7.0:GL476733:325925:343343:-1 gene:ENSPMAG00000008023.1 transcript:ENSPMAT00000008872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 1.448e-50
Identity = 121/345 (35.07%), Postives = 177/345 (51.30%), Query Frame = 3
Query: 2331 GSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNF------PFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAV-RTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMC 3335
            G+  +   +D   C C  G  G  C+ C  G+           C  C C+  +T CD  +G CLNC+ NS G  C+ C  G+YG+   G    C+ C CP G S        C +  +       C  GY+G  CD+C   ++G+     G+CQPC+C+GN+D     +C++ TGEC +C+  TSG++CE+C +GYFG+  V + C  C C+  G+ S     C+  TG+C C PNV G QCD C    +  + Q  C PC C    GA++ +C++  G+C C+   SGK C   +   +G   +  GC  C CN  G+    C+  +G C C+PG+ GR CD C
Sbjct:  335 GTRGAVAASDVELCQCPPGYSGTSCEACVRGHRRVNGSLYGGACEPCDCHGHATECDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCACPLGFSPT------CRVGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKCSSNGSQSN---TCDAVTGQCECKPNVAGRQCDHCVPNCWWDAQQRKCQPCRCSL-EGAVSSACDK-HGRCACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNSFGAFSFDCD-ESGQCHCQPGVVGRQCDRC 667          

HSP 2 Score: 122.865 bits (307), Expect = 1.226e-28
Identity = 110/337 (32.64%), Postives = 155/337 (45.99%), Query Frame = 3
Query: 2226 CQCLPNVSGKTCERCASESYGFDAR----GCKKCKCDLTGSLNSQCYNDTGKCL-CREGVEGQHCDTCKPGYW-----NFPF-CHSCKCN-QMSTTC---DSKTGKCLNCKGNSFGYNCQNCENGYYGDTS-RGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQ-IGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNC 3185
            CQC P  SG +CE C       +       C+ C C       ++C + +G CL C     G  C+ C PG++       P  C  C C    S TC    S    C  C     G  C  C +GYYG     G  C+ CQC G   L      C  +   T     C    SG  C++C T +FG+AI     CQPC+CS N  Q   ++C++ TG+C +C  N +G  C+ CV   + +   R C  C C+  G  S     C+ + G+C C P   G +C+  Q + + +S Q  GC PCNC+   GA +  C++ +GQC+CQ G  G+ C+ C
Sbjct:  348 CQCPPGYSGTSCEACVRGHRRVNGSLYGGACEPCDCH---GHATECDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCACPLGFSPTCRVGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGA-CDAV---TGECLRCVGQTSGWHCERCTTGYFGDAIVAK-NCQPCKCSSNGSQ--SNTCDAVTGQC-ECKPNVAGRQCDHCVPNCWWDAQQRKCQPCRCSLEGAVSS---ACD-KHGRCACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNS-FGAFSFDCDE-SGQCHCQPGVVGRQCDRC 667          

HSP 3 Score: 112.849 bits (281), Expect = 1.602e-25
Identity = 104/296 (35.14%), Postives = 139/296 (46.96%), Query Frame = 3
Query: 2205 CNKIGGQC-QCLPNVSGKTCERCASESYGFDARG----CKKCKCDLTGSLNSQCYNDTGKCL---CREGVEGQHCDTCKPGYWNFP-----FCHSCKCN---QMST--TCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRT-CTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRC 3035
            C+ + G C  C  N  G  CERC    YG    G    C+ C C L  S   +    +G  L   C  G  G  CD C  GY+  P      C  C+CN    +ST   CD+ TG+CL C G + G++C+ C  GY+GD      C+ C+C   SS  + S  C  +       C CK   +G+ CD C  N + +A  +   CQPCRCS  ++  +  +C+ K G C  C    SG  CE   + ++G     T C  C CN  G  S     C+ E+G+C C P VVG QCDRC
Sbjct:  390 CDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCACPLGFSPTCR-VGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKC---SSNGSQSNTCDAVTG----QCECKPNVAGRQCDHCVPNCWWDAQQRK--CQPCRCS--LEGAVSSACD-KHGRC-ACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNSFGAFSF---DCD-ESGQCHCQPGVVGRQCDRC 667          

HSP 4 Score: 107.071 bits (266), Expect = 1.038e-23
Identity = 75/238 (31.51%), Postives = 107/238 (44.96%), Query Frame = 3
Query: 2673 CMCKKGYSGQFCDQCETNHFG-NAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGN---GAVRTCTKCVCN-------HMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIG--CLPCNCDYPIG-ALNHSCNQLTGQCY-CQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMK 3341
            C C  GYSG  C+ C   H   N     G C+PC C G+  +     C+  +G C  C  N+ G  CE+C+ G++GN   G    C  C C         +G +     +C+       C P   G +CDRC D ++      G  C PC C+  +  +   +C+ +TG+C  C    SG  C  C  G++GD      C  C C+ +GS    C+   G C CKP + GR CD C+ 
Sbjct:  348 CQCPPGYSGTSCEACVRGHRRVNGSLYGGACEPCDCHGHATE-----CDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCACPLGFSPTCRVGPSGAM--LCDR------CAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKCSSNGSQSNTCDAVTGQCECKPNVAGRQCDHCVP 572          

HSP 5 Score: 85.1149 bits (209), Expect = 7.087e-17
Identity = 85/289 (29.41%), Postives = 130/289 (44.98%), Query Frame = 3
Query:  861 CSCYGHASKCKAKEGQVQVKEMVYGVC-DCQHNTKGQHCEKC-KDFYNDSPWLPADKNSTNECRKCECN-SHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCI-CKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY--IEKPT 1709
            C C+GHA++C          + V G C +C+HN+ G  CE+C   FY +     A + + ++C+ C C    S +C   P     S  M   +CD C        C+RC  GYY +  V   S Q C +C+  ++    P  C            G C+ C     G  C++C  G++  +      C  C C   G+  N  CD+ TG+C CK  V G  C  C    +   +A    C  C+CS  G+  +  CDK+ G+C C+  F+G RC+  ++  Y   ++PT
Sbjct:  381 CDCHGHATEC----------DDVSGNCLNCEHNSVGPRCERCLPGFYGN-----AQEGTPHDCQPCACPLGFSPTCRVGP-----SGAM---LCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPC-QCN-GNVDLSTPGACDAV--------TGECLRCVGQTSGWHCERCTTGYFG-DAIVAKNCQPCKCSSNGSQSNT-CDAVTGQCECKPNVAGRQCDHCVPNCW--WDAQQRKCQPCRCSLEGAVSS-ACDKH-GRCACRPEFSGKRCEPSQARHYGMSQQPT 630          

HSP 6 Score: 84.3445 bits (207), Expect = 1.444e-16
Identity = 81/259 (31.27%), Postives = 109/259 (42.08%), Query Frame = 3
Query:  936 VCDCQHNTKGQHCEKCKDFY---NDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCY-CKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE-IKSEWY 1694
            +C C     G  CE C   +   N S +          C  C+C+ H++ C  D V          G C NC+HN+    CERC  G+Y N      +   C  C C  LG  F   C   P   +  +     C     G +CD+C  G++   G     C  C C     L   G CD+ TG+C  C    +G  C  C  GYF  +    N C  CKCS  GS+ N TCD  +G+C CK   AG +CD  + + W+
Sbjct:  347 LCQCPPGYSGTSCEACVRGHRRVNGSLY-------GGACEPCDCHGHATEC--DDV---------SGNCLNCEHNSVGPRCERCLPGFYGN--AQEGTPHDCQPCAC-PLG--FSPTCRVGPSGAMLCDR----CAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKN-CQPCKCSSNGSQSN-TCDAVTGQCECKPNVAGRQCDHCVPNCWW 576          

HSP 7 Score: 82.0333 bits (201), Expect = 7.115e-16
Identity = 58/185 (31.35%), Postives = 85/185 (45.95%), Query Frame = 3
Query: 1050 CECNSHSSSCHFDPVVYQQSRKM-------SGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKC 1583
            C C+  +  C++DP V +++  +        GGVC NC  NT   NCE C   Y+R           C  C+C+ +G+    +CI         N+  C CK    G +C++C  G+  F       C+KC C   G++    C      C CKS V G  C +CK G++NL  +N  GC+ C C
Sbjct:    1 CNCHGKAGECYYDPDVARRNLSLNTAGKFVGGGVCLNCSQNTAGVNCEICVDEYFRP------PKNPCRPCNCNPVGS-LSKVCIN--------NSRSCRCKPGYGGERCNRCAFGYKGF-----PKCVKCKCSTEGSINKDPCKE---PCICKSNVQGKHCDSCKPGHYNLQESNALGCTECFC 162          

HSP 8 Score: 82.0333 bits (201), Expect = 7.490e-16
Identity = 77/251 (30.68%), Postives = 111/251 (44.22%), Query Frame = 3
Query:  936 VCD-CQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSH---SSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE 1676
            +CD C     G  C++C D Y  SP +P        C+ C+CN +   S+    D V          G C  C   T   +CERC +GY+ +  VA N    C  C C S G+       Q    D     G C CK NV G QCD C    W     ++  C  C C + G + +  CD   G+C C+   +G  C   +  ++ +S     GC+ C C+ +G+  +  CD+ SG+C C+ G  G +CD 
Sbjct:  450 LCDRCAPGYAGARCDRCADGYYGSPGVPG-----GSCQPCQCNGNVDLSTPGACDAVT---------GECLRCVGQTSGWHCERCTTGYFGDAIVAKN----CQPCKCSSNGS-------QSNTCDA--VTGQCECKPNVAGRQCDHCVPNCWW--DAQQRKCQPCRCSLEGAVSS-ACDKH-GRCACRPEFSGKRCEPSQARHYGMSQ-QPTGCAPCNCNSFGAF-SFDCDE-SGQCHCQPGVVGRQCDR 666          

HSP 9 Score: 75.0998 bits (183), Expect = 1.011e-13
Identity = 53/171 (30.99%), Postives = 85/171 (49.71%), Query Frame = 3
Query: 2061 VLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDA--RGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP----FCHSCKCN---QMSTTCDSKTGKCLNCKGNSFGYNCQNC 2546
            V GECL      S   C+        + +   +   CKC+  GS++N C+ + GQC+C PNV+G+ C+ C    + +DA  R C+ C+C L G+++S C +  G+C CR    G+ C+  +  ++        C  C CN     S  CD ++G+C +C+    G  C  C
Sbjct:  501 VTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKCSSNGSQSNTCDAVTGQCECKPNVAGRQCDHCVPNCW-WDAQQRKCQPCRCSLEGAVSSAC-DKHGRCACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNSFGAFSFDCD-ESGQC-HCQPGVVGRQCDRC 667          

HSP 10 Score: 65.855 bits (159), Expect = 7.575e-11
Identity = 45/137 (32.85%), Postives = 67/137 (48.91%), Query Frame = 3
Query: 2217 GGQC-QCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYG-DTSRGILCKKCQCPGLSSL 2621
            GG C  C  N +G  CE C  E +      C+ C C+  GSL+  C N++  C C+ G  G+ C+ C  GY  FP C  CKC+   +       +   CK N  G +C +C+ G+Y    S  + C +C C G++ +
Sbjct:   32 GGVCLNCSQNTAGVNCEICVDEYFRPPKNPCRPCNCNPVGSLSKVCINNSRSCRCKPGYGGERCNRCAFGYKGFPKCVKCKCSTEGSINKDPCKEPCICKSNVQGKHCDSCKPGHYNLQESNALGCTECFCFGVTRM 168          

HSP 11 Score: 64.6994 bits (156), Expect = 1.675e-10
Identity = 49/145 (33.79%), Postives = 66/145 (45.52%), Query Frame = 3
Query: 2067 GECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP-----FCHSCKCNQMSTTCDS 2486
            G CLN +   +   C+    E          P  C CN  GS +  C      C+C P   G+ C RCA    GF    C KCKC   GS+N     +   C+C+  V+G+HCD+CKPG++N        C  C C  ++  CDS
Sbjct:   33 GVCLNCSQNTAGVNCEICVDEYFRPPKNPCRP--CNCNPVGSLSKVCINNSRSCRCKPGYGGERCNRCAFGYKGFPK--CVKCKCSTEGSINKDPCKE--PCICKSNVQGKHCDSCKPGHYNLQESNALGCTECFCFGVTRMCDS 171          

HSP 12 Score: 60.8474 bits (146), Expect = 2.435e-9
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 3
Query: 2997 CLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKG 3344
            C  N  G+ C+ C D++F       C PCNC+ P+G+L+  C   +  C C+ G  G+ CN C  G+ G P     C KC C+ +GS+ K   +    C CK  + G++CD C  G
Sbjct:   38 CSQNTAGVNCEICVDEYFRPPKNP-CRPCNCN-PVGSLSKVCINNSRSCRCKPGYGGERCNRCAFGYKGFPK----CVKCKCSTEGSINKDPCKE--PCICKSNVQGKHCDSCKPG 145          

HSP 13 Score: 55.8398 bits (133), Expect = 7.541e-8
Identity = 57/179 (31.84%), Postives = 70/179 (39.11%), Query Frame = 3
Query:  933 GVC-DCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDS 1466
            GVC +C  NT G +CE C D Y   P         N CR C CN   S      V    SR         C+     + C RC  GY             C+KC C + G+     C +EP          CICK NV+G  CD CK G +    +   GC +C C  +     R CDS
Sbjct:   33 GVCLNCSQNTAGVNCEICVDEYFRPP--------KNPCRPCNCNPVGS---LSKVCINNSRSC------RCKPGYGGERCNRCAFGY--------KGFPKCVKCKCSTEGSINKDPC-KEP----------CICKSNVQGKHCDSCKPGHYNLQESNALGCTECFCFGV----TRMCDS 171          

HSP 14 Score: 54.299 bits (129), Expect = 2.727e-7
Identity = 47/140 (33.57%), Postives = 67/140 (47.86%), Query Frame = 3
Query: 2826 GECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWG-DPTKLNGCTKCYC 3242
            G C  C  NT+G NCE CV  YF       C  C CN +G+ SK   +C + +  C C P   G +C+RC    F       C+ C C    G++N   +     C C++   GK C++CK G +    +   GCT+C+C
Sbjct:   33 GVCLNCSQNTAGVNCEICVDEYF-RPPKNPCRPCNCNPVGSLSK---VCINNSRSCRCKPGYGGERCNRCA---FGYKGFPKCVKCKCST-EGSINK--DPCKEPCICKSNVQGKHCDSCKPGHYNLQESNALGCTECFC 162          
BLAST of Netrin-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004614.1 (pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 1.990e-33
Identity = 75/199 (37.69%), Postives = 105/199 (52.76%), Query Frame = 3
Query:  438 FQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERK--RSNINE--VLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKC-KAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPA 1019
            FQ T+  LRF T RP +  I +       W  Y ++S  C R F  +P R   R+   E   LC+ EFS I P  GG V FS     + +     +  +  +TA T++RV   RL+TFGD +V  +P +   YYYA+S+  + GRC C+GHAS+C +  +G++        VC CQHNT G  CE+C   +N  PW  A
Sbjct:    1 FQITYVRLRFHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTF-GLPSRGFLRAGDEERTALCSDEFSDISPLTGGNVAFSTLEGLFHSTGPLSSATQEWVTA-TDVRVSLRRLNTFGD-EVFGDPKVLRSYYYAVSDLAVGGRCKCHGHASECGRGSDGRL--------VCRCQHNTTGDDCERCLPSHNSRPWAQA 188          
BLAST of Netrin-4 vs. Ensembl Nematostella
Match: EDO39502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X8])

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 546/1619 (33.72%), Postives = 819/1619 (50.59%), Query Frame = 3
Query:  111 EIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTT-SDSGRKSKCTICDSKNPYQ---RFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKP---TYPLEHLKEIKI--------------------------------NLPPVSKSGYYNFVITTDTKNMQFFDSFIIVL----SIYHVGKSSCQSYQD------TMQLIKDSRYIVIPNK-CLEKDL-----------PIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKV-LGECLNYANLVSSKKCDFLNA----EISTNTVTKSDPIKCKCNVTGSRNNN-----CNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKK---GYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFL-IVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEI---KKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYA-----------KAMISKNKI---RD--VTGAFNELKK--------------SLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTIT----ESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDV-TRGAIQSRRIESVNLLIKIKTYLNGSADLKDFESLIEN-INKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFV 4619
            + ++   C K  C P  GDLL+GRE+ + ASSTCGL   E YCVV+   D G    C ICDS+ PYQ   +FS    + + +   R   +   WWQS +G  NV +++  ESEF FT   +RF+T+RPA M IERS DYG+ W  Y YFS +C + FP IP+ +  +I++V+CT+++S++ PS  G V+F A  S     + Y +K +N +  ITNIR+ F +LHT GD  +D  P I+ KYYYA+ + +IRG CSCYGHA +C  + GQ     MVYG C+C HNT G++CE+C+D Y D PW PAD ++ NECRKC CN H+  C FDP VYQ S  +SGGVC +C+HNT  +NCERCK  +Y++ +   +    C+ C+CD  G      C  + +   GL AG CICK NV G +CD+CK GF+    +   GC  C C  +GT+    C+  TG+C CK +V G DC  C   Y+ LS+    GCS C C   GS DN+ CDK +G+C C+ G  G +C+ +K+  Y   P    Y  E  + + +                                ++  +  SG+Y  ++  +TK+   + + + +          G     S +D      T+ L    RY+ +P+  CLEK +           P+  T  +I +++ +   +   V I      + +  +  L +CL+Y    S  +    +       S ++V     + C C+  G++ +      C+ IGGQC+C  NV G+ C+RCA  S+GF  +GC  C CD  G++++ C   TG+C CR    G+ C  C P  W FP C  C+C   +++C+ KTG C++C+ N+ G NC+ C  G+YG  ++G    CK+CQCPG SS    S  C +  +TT  + +C K   GY+G+ C++C   ++GN +   G+C+PC C+ NID  +  +C+  TG C +CL+NT+GFNCE+C  GYFG+   R CT CVC+  GTN  +   CNH+TG+C CLP+V G QCDRC + F+NLSS  GC  C+C    G+L   CNQ+TGQC C+AG  G  C  C+D FWG P   +GC+ C CN  GSV  QC+R+ G C CK G  G  CDMC   T GKMP C  CG+C+ QW   L  + +N   ++  ++ + +         D     LE+ +K +++I   +K       +I +       RL+    N++ I       ++ T + + + A           KA   KN I   RD  + GAF  +K+              SL +I       KKI   +TL     F +      ++L        D+   I E+ +N +  NG+ C T      E     CS  CGG GC   +      + +    +  Q      + +  +  M     E     N+S  + E                K +D   R    ++R++   L+  I  +L       D   ++ N +    ++   ++I  L + IR   + L  V+ IL+K+K N  + +  K+ A  A+E    + + I+N++    M    + + K  +
Sbjct:   11 DAQASAQCAKRSCYPATGDLLVGRENKIYASSTCGLRGPEEYCVVSNLQDYG---DCHICDSR-PYQTNPQFSHVPKYMLSSFDGRKKDE---WWQSENGRENVYLQLDLESEFHFTHLIMRFRTFRPAGMVIERSWDYGKKWQIYRYFSADCDKIFPGIPKGEPKDIDDVICTNKYSTVEPSTNGEVIFRALKSQIPIKNAYSSKVQN-LLKITNIRINFTKLHTLGDDLLDPRPEIKRKYYYAVYDLVIRGSCSCYGHAEQCLPEPGQPTTPGMVYGRCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECRKCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGFFNLTTDNPDGCKACGCNPLGTIGE--CNPDTGRCTCKRYVEGEDCDRCASEYWGLSSTPA-GCSNCACDVGGSYDNQ-CDKQTGQCRCRKGITGRQCERVKTGNYYPLPDHLIYESEEARAVGVSEVARQEYPKNGAATWTGDGLLDVADGTAVVYSITNIPNSGFYTPLLRYETKDAGQWRAVVQISRPDGKPLTTGACRRPSGRDEYYRNVTIALNPSRRYVTLPDDVCLEKGVSYDIRVRFVRDPVSNTRDSIFTDSIVLLPVPGSVDIFQGSEGAKRQAQFDLYQCLDYHLAASQPRPKLSDVCKKLIFSMSSVIYDGAVACNCDPKGTQRDANGTLVCDPIGGQCKCKSNVIGQRCDRCAPGSFGFSNKGCSACDCDRIGAIDNFCNILTGQCQCRNWASGRQCSLCPPNMWGFPLCRPCRCYGHASSCNPKTGVCVDCQHNTVGKNCEACAVGFYGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGNPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGYFGDAIARNCTSCVCDKKGTNPGFHYSCNHKTGQCNCLPDVEGKQCDRCAEGFWNLSSGKGCQQCDCCIE-GSLRSMCNQITGQCQCKAGFGGPRCCECEDNFWGSPP--DGCSACNCNPAGSVHLQCDRDTGKCLCKVGHIGDKCDMCAADTSGKMPQCEICGECYYQWKATLGFLSRNVTYQIDRAANLTLKTTGGAYAYDKELKELEEKLKRVQKILDAQKTKENDTKMIEAELDAATKRLREIKENTDRIANEVNSTAVKTHQANDEIARLRKLLNDLLQKADQMKNDILSVRDTNIRGAFEGIKENQRRSREAEKRVNGSLDSIDRATKNRKKI--QMTLDGPPSFNQTHTKNQVDL-------GDLMKRIEELKRNSVELNGIVCGTPASKCGECTATNCS-VCGGPGCNGTRNLAQDAVKRAKEAEDAQRMREAKANMTLKETM-----EAEMMVNMSRTAAET------------AISKAMDAQMRAQNATKRMD--QLIKDILEFLAQPFPDIDMSRMLANKVLNMTLSVSPDQITKLAQDIREAWKSLTGVDEILEKTKQNLTRAEDLKRRAEEAREKALTVSDVIQNVTDALDMAANGQQLAKDAI 1585          
BLAST of Netrin-4 vs. Ensembl Nematostella
Match: EDO36523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF3])

HSP 1 Score: 256.914 bits (655), Expect = 6.218e-69
Identity = 168/506 (33.20%), Postives = 255/506 (50.40%), Query Frame = 3
Query:  123 DNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHN----VSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFP----SIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSA--DTSDWVNND-----VYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAK---EGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNA-GHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKC 1583
            D+  R   C P+ G+   G+     +++TCG    +++CV T     RK +C +C+S +P     +     I++  +R       WWQS + + N    V++ +     +  ++  +RF++ RP +M I +       W  Y YFS  C + +      I + +   +   LCT  FS+I P  GG V FS   D  D  N D       W      +TA+  +R+   R++TFGD +V  +PN+   YYYAI +  I GRC C GHAS+C+     +GQ +++      C CQH+T+G  CE+CK  YND PW  A   + NEC +C CN  + SC FD  +Y+Q+    GG C NC+ NT+  NCERCK  +YR  ++     + C+ C C+ +G+           + L  N+ G C CK  V G +CDKC+  ++ F+   +TGC  C C   GT   +   +  G+C CK  V G  C+ C+ GYF L  +N +GC  C C
Sbjct:   23 DSQGRAQRCMPQFGNAAFGKRVI--SNNTCG-DPPKKFCVQTGVLEVRK-ECEMCNSSDPALEHPALKITDIKDDTNRT------WWQSETLLENPDKPVTLTLDLGKSYDVSYIRIRFRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGVTTNGIVDPRNQQV--ALCTDAFSTITPLTGGNVAFSTLEDRPDAYNFDNSPALQEW------VTAVA-VRIHLRRMNTFGD-EVFGDPNVLRSYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQ------CKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQT--GHGGRCQNCKQNTDGPNCERCKENFYRKTSL-----EPCVACGCNPVGS-----------VSLQCNSEGQCRCKPGVTGIKCDKCQANYFGFS---QTGCRPCQCFGPGTDPAKTQCNEKGECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCFC 481          

HSP 2 Score: 204.142 bits (518), Expect = 9.257e-53
Identity = 147/429 (34.27%), Postives = 213/429 (49.65%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWN-------FPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCM-CKKGYSGQFCDQCETNHFGNAISKDG---TCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSG---FNCEKCVSGYFGNGA---VRTCTKCVCNHMGTNSK------WQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLH---------NSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKY 3551
            +C C +  +G +C+ CK GY         +  C  C+C   S TCD  TGKC NCK N+ G  C  C +GYYG+ ++G    CKKC C           G   I       C  C +G+ G  CD C+  ++G+ + K G   TCQ C CSGNID     SC+  TG+C KC+ NT       CE C  GY+GN        C  C C   GT S           C+ + G+C CLPNV G +CD C+ +++N++S  GC PCNCD   G+ N++C+  TGQC+C+ G +G+ C+ C    +   ++L GC  C CNL GS+   C+   GVC+C+PG+ G  CD C +        C +C  C   +D    +V     KL+         N+S   + +V F K +  +   +E+ +   +  ++Y
Sbjct:  669 QCSCPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQCYGHSDTCDPVTGKC-NCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPC---------KFGTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCD-DKGRCTCLPNVSGDKCDTCRPEYWNVASGKGCEPCNCDT-TGSWNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYAF-SEL-GCLACNCNLQGSLNVTCD-EQGVCQCRPGVLGIKCDSCQENFHNLTAGCIACPPC---YDVIQKIVGGLRRKLYDLIYIIDRFNTSSSVVVDVDFEKRLALLKEQVERLLGQSRRSQQY 1079          

HSP 3 Score: 119.013 bits (297), Expect = 1.252e-26
Identity = 112/364 (30.77%), Postives = 159/364 (43.68%), Query Frame = 3
Query: 2223 QCQCLPNVSGKTCERCA---SESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF------CHSCKCNQMSTTCDSKTGK--CLNCKGNSFGYNCQNCENGYYGDT--SRG--ILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCM--CKKGYSGQFCDQCETNHFGNAIS-KDGTCQPCRC--SGNI-----DQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCY 3239
            QC C     G  CE+C    +   G   R  +   C   G  ++ C   TGKC C+    G  CD C  GY+  P       C  C C +  T C        C +C     G  C  C++GYYGD    RG    C+KC C G  ++  N+IG           C+   + G   Q C+ C   ++GNA       C+ C C   G +     D  +   C+ K G C  CL N SG  C+ C   Y+   + + C  C C+  G+   W   C+  TG+C C P V G +CD+C    +   S++GCL CNC+   G+LN +C++  G C C+ G  G  C++C++ F         C  CY
Sbjct:  669 QCSCPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQCYGHSDT-CDPVTGKCNCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPC-KFGTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSG--NIDPNAIGSCDRLTGDCLKCIHNTRNGPISQ-CELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDK-GRC-TCLPNVSGDKCDTCRPEYWNVASGKGCEPCNCDTTGS---WNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYAF-SELGCLACNCNLQ-GSLNVTCDE-QGVCQCRPGVLGIKCDSCQENFHNLTAGCIACPPCY 1019          

HSP 4 Score: 107.842 bits (268), Expect = 2.611e-23
Identity = 98/330 (29.70%), Postives = 135/330 (40.91%), Query Frame = 3
Query:  861 CSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCEC-----------------------------------------NSHSSSCH-------FDPVVYQQSRKMSGGVCDNCQHNTES---KNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLN-AGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            C CYGH+  C          + V G C+C+HNT G  C+KC D Y  +P     + + ++C+KC C                                             ++C         DP       +++G  C  C HNT +     CE C  GYY N A      Q C  C C   GT  P     +P L    +  G C C  NV G++CD C+  +W     +  GC  CNC   G+  N  C  +TG+C+CK  VTG  C  C I ++  S     GC  C C+  GS  N TCD+  G C C+ G  GI+CD  +  ++
Sbjct:  704 CQCYGHSDTC----------DPVTGKCNCKHNTTGIRCDKCIDGYYGNP----TQGTPDDCKKCPCKFGTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGD-CLKCIHNTRNGPISQCELCAIGYYGN-ATHYPKPQ-CKACECYVQGTVSPPG--HDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEYWNVASGK--GCEPCNCDTTGSWNNT-CSVTTGQCHCKPGVTGRRCDQCSIDHYAFSEL---GCLACNCNLQGSL-NVTCDE-QGVCQCRPGVLGIKCDSCQENFH 1006          

HSP 5 Score: 107.071 bits (266), Expect = 5.218e-23
Identity = 96/334 (28.74%), Postives = 144/334 (43.11%), Query Frame = 3
Query: 2163 IKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARG----CKKCKCDLTGSLNSQCYNDTGKCLCR---EGVEGQHCDTCKPGYWNFPF--------CHSCKCN-----QMSTTCDSKTGKCLNCKGNSFG---YNCQNCENGYYGDTSR--GILCKKCQCPGLSSLKNNSIGCSLIFN-TTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQ-IGCLPC 3083
            + C+C      ++ C+ + G+C C  N +G  C++C    YG   +G    CKKC C       ++C       +C    EG  G  CD C+ GY+  P         C  C C+         +CD  TG CL C  N+       C+ C  GYYG+ +      CK C+C    ++       +L F       C C    SG  CD C   ++  A  K   C+PC C  +      ++C+  TG+C  C    +G  C++C   ++    +  C  C CN  G+      +   E G C C P V+G++CD CQ+ F NL++  I C PC
Sbjct:  702 VPCQCY---GHSDTCDPVTGKCNCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPC----KFGTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEYWNVASGKG--CEPCNC--DTTGSWNNTCSVTTGQCH-CKPGVTGRRCDQCSIDHYAFSEL-GCLACNCNLQGS----LNVTCDEQGVCQCRPGVLGIKCDSCQENFHNLTAGCIACPPC 1018          

HSP 6 Score: 97.0561 bits (240), Expect = 4.781e-20
Identity = 83/283 (29.33%), Postives = 128/283 (45.23%), Query Frame = 3
Query: 2517 NSFG---YNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNH----FGNAISKDG-TCQPCRCSGNIDQRIEDSC----NSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYP-IGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWG-DPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRN 3323
            N+FG   +   N    YY       +  +C+C G +S    +    L    T   C C+    G  C++C+  +    +  A S++   C  C C+G  +  + D          G C+ C  NT G NCE+C   ++   ++  C  C CN +G+ S     CN E G+C C P V G++CD+CQ  +F   SQ GC PC C  P        CN+  G+C C+    G  C  C+ G++G + +  +GC +C+          C  ++ VC+  PG T RN
Sbjct:  235 NTFGDEVFGDPNVLRSYYYAIIDLSIGGRCKCNGHASECEET---RLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPNCERCKENFYRKTSLEPCVACGCNPVGSVSLQ---CNSE-GQCRCKPGVTGIKCDKCQANYFGF-SQTGCRPCQCFGPGTDPAKTQCNE-KGECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCF----------CYGHSTVCKAAPGYTSRN 498          

HSP 7 Score: 86.2705 bits (212), Expect = 9.174e-17
Identity = 74/212 (34.91%), Postives = 98/212 (46.23%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTC---------DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQC--PGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGA--VRTCTKCVC 2933
            +C C+   EG  C+ CKP Y + P+          C  C CN ++ +C             G+C NCK N+ G NC+ C+  +Y  TS    C  C C   G  SL+ NS G           C CK G +G  CD+C+ N+FG   S+ G C+PC+C G      +  CN K GEC  C  +  G  C  C SGYFG  A     C +C C
Sbjct:  286 QCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPNCERCKENFYRKTSLEP-CVACGCNPVGSVSLQCNSEG----------QCRCKPGVTGIKCDKCQANYFG--FSQTG-CRPCQCFGPGTDPAKTQCNEK-GEC-TCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCFC 481          

HSP 8 Score: 83.5741 bits (205), Expect = 6.887e-16
Identity = 47/114 (41.23%), Postives = 62/114 (54.39%), Query Frame = 3
Query: 2094 VSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNF 2435
            VS  KCD    E   N  +      C C+ TGS NN C+   GQC C P V+G+ C++C+ + Y F   GC  C C+L GSLN  C ++ G C CR GV G  CD+C+  + N 
Sbjct:  897 VSGDKCDTCRPEY-WNVASGKGCEPCNCDTTGSWNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYAFSELGCLACNCNLQGSLNVTC-DEQGVCQCRPGVLGIKCDSCQENFHNL 1008          

HSP 9 Score: 80.8777 bits (198), Expect = 5.083e-15
Identity = 83/270 (30.74%), Postives = 111/270 (41.11%), Query Frame = 3
Query:  939 CDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFW---KFNGNEETGCLKCNCVMMGTLENRG---CDSSTGKCYCKSFVTGN----DCSTCKIGYF-NLSNANINGCSLCKCSEYGSRDNKTCDKY-------SGKCLCKNGFAGIRCDEIKSEWY 1694
            C C    KG +CE+CKD Y          +   +C  C+C  HS +C  DPV          G C NC+HNT    C++C  GYY N      +   C KC C     KF + CIQ     +G N     C E   GN CD C+ G++          T C KCNC   G ++      CD  TG C      T N     C  C IGY+ N ++     C  C+C   G+      D          G+C C    +G +CD  + E++
Sbjct:  670 CSCPKEYKGNNCEQCKDGYTRQ---AGSTDRYAQCVPCQCYGHSDTC--DPVT---------GKC-NCKHNTTGIRCDKCIDGYYGNPTQG--TPDDCKKCPC-----KFGTRCIQ-----IGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNC--SGNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEYW 910          

HSP 10 Score: 75.0998 bits (183), Expect = 2.608e-13
Identity = 60/198 (30.30%), Postives = 91/198 (45.96%), Query Frame = 3
Query: 2838 KCLFNTSGFNCEKCVSGYFGNGAVRT-------CTKCVCNHMGTNSKWQGICNHETG---KCP-CLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGS--VFKQCNRNNGVCRCKPGITGRNCDMCMKGTDG-KMPNCSSCGDCW 3389
            KC  +T G +CE+C   Y      R        C +C CN +  +  +      +TG   +C  C  N  G  C+RC++ F+  +S   C+ C C+ P+G+++  CN   GQC C+ G +G  C+ C+  ++G      GC  C C   G+     QCN   G C CK  + G  C +C  G  G +  N   C  C+
Sbjct:  288 KCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPNCERCKENFYRKTSLEPCVACGCN-PVGSVSLQCNS-EGQCRCKPGVTGIKCDKCQANYFG--FSQTGCRPCQCFGPGTDPAKTQCNEK-GECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCF 480          

HSP 11 Score: 74.7146 bits (182), Expect = 3.685e-13
Identity = 69/234 (29.49%), Postives = 100/234 (42.74%), Query Frame = 3
Query: 2151 KSDPIKC-KCNVTGSRNNN----CNKIGGQC-QCLPNVSG---KTCERCASESYG----FDARGCKKCKCDLTGSLNSQCYN--------DTGKCLCREGVEGQHCDTCKPGYWNFPF---CHSCKCNQMST---TCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPC 2771
            +  P  C KCN +G+ + N    C+++ G C +C+ N        CE CA   YG    +    CK C+C + G+++   ++        D G+C C   V G  CDTC+P YWN      C  C C+   +   TC   TG+C +CK    G  C  C   +Y  +  G L   C   G  ++  +  G           C C+ G  G  CD C+ N F N  +    C PC
Sbjct:  797 RGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEYWNVASGKGCEPCNCDTTGSWNNTCSVTTGQC-HCKPGVTGRRCDQCSIDHYAFSELGCLACNCNLQGSLNVTCDEQG----------VCQCRPGVLGIKCDSCQEN-FHNLTAGCIACPPC 1018          

HSP 12 Score: 72.0182 bits (175), Expect = 2.316e-12
Identity = 59/162 (36.42%), Postives = 80/162 (49.38%), Query Frame = 3
Query: 2217 GGQCQ-CLPNVSGKTCERCASESY-GFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP--FCHSCKC-----NQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYG-DTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFT 2672
            GG+CQ C  N  G  CERC    Y       C  C C+  GS++ QC N  G+C C+ GV G  CD C+  Y+ F    C  C+C     +   T C+ K G+C  CK +  G  C  C +GY+G + S    CK+C C G S++   + G +    TT FT
Sbjct:  346 GGRCQNCKQNTDGPNCERCKENFYRKTSLEPCVACGCNPVGSVSLQC-NSEGQCRCKPGVTGIKCDKCQANYFGFSQTGCRPCQCFGPGTDPAKTQCNEK-GEC-TCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCFCYGHSTVCKAAPGYTSRNITTDFT 504          

HSP 13 Score: 69.707 bits (169), Expect = 1.004e-11
Identity = 42/118 (35.59%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 2163 IKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGS--LNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF-----CHSCKCNQMSTTCDSKTG 2495
            + C CN  GS +  CN   GQC+C P V+G  C++C +  +GF   GC+ C+C   G+    +QC N+ G+C C+  V G  C  C+ GY+         C  C C   ST C +  G
Sbjct:  378 VACGCNPVGSVSLQCNS-EGQCRCKPGVTGIKCDKCQANYFGFSQTGCRPCQCFGPGTDPAKTQC-NEKGECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCFCYGHSTVCKAAPG 493          

HSP 14 Score: 58.151 bits (139), Expect = 4.220e-8
Identity = 51/156 (32.69%), Postives = 73/156 (46.79%), Query Frame = 3
Query: 2922 KCVCNHMGTNSKWQGICNHETG-KCPCLPNVVGLQCDRCQ----DKFFNLSSQIG---CLPCNCDYPIGALNHSC---------NQLTGQCY-CQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMC 3335
            +C CN   +  +   + + +T  +C C  +  G+ C+RC+    D+ +  +S      C+ CNC+     L  SC             G+C  C+    G  C  CK+ F+   T L  C  C CN  GSV  QCN + G CRCKPG+TG  CD C
Sbjct:  263 RCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCN----GLAESCVFDEALYRQTGHGGRCQNCKQNTDGPNCERCKENFY-RKTSLEPCVACGCNPVGSVSLQCN-SEGQCRCKPGVTGIKCDKC 412          
BLAST of Netrin-4 vs. Ensembl Nematostella
Match: EDO36501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF6])

HSP 1 Score: 239.58 bits (610), Expect = 1.778e-63
Identity = 166/562 (29.54%), Postives = 257/562 (45.73%), Query Frame = 3
Query:   78 VFIIFVARYILE-IESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVH----------NVSIEISFESEFQFT-FTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFP---SIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPA-DKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTL-ENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTY 1712
            +F++ V++   E  E++       C P        +   + ++STCG   SE YC V   +      C  C++ +P +R      H IE +  + P     +WQS +              V++ ISF   +  T      F++ RP+   +E+S D G+TW+   Y+S NC +DF    + P   R       CT ++SS  P + G V F  D     N   +++ +     + T++R++     T G     D   ++ +YYYA+S+  +  RC C+GHA  C                CDC HNT G  CE+C   +N+  W+PA  +   N C +CEC+SH+ SC +       S++   G CD+C HNTE   CERCK  +YRN+++++N  + C  C+C   G      C Q          G C C+ NV G QCD C   FW +       C +C CV  GT+  +  CD   G+C CK  V    C  CK GY++        C  C C +YG    + C K +G C+C+    G RC ++ + ++    +Y
Sbjct:    8 LFLLTVSKVNSECFENEKYDDVQTCVPEPRFAAKMKHRAVSSTSTCGSPPSE-YCRVKPLNG-----CFKCNASSPTER------HPIEYIADKSPGSDATFWQSETWWDWYQKNPRDDLKVNVSISFNKTYDITGHIMFTFESPRPSKAILEKSFDKGQTWDPLQYYSFNCRKDFGMENTDPTENRFGDFSAKCTEKYSSSSPQQNGKVTF--DFLRRYNKASFFDTQVQQYLSATDLRLRMEYPGTDGLEVAKDEVTLK-QYYYAVSDLEVIARCKCHGHARWC-------DFPHETGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTY-------SQQEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTCNQ--------TTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDC-DYGGSVLQICSKTTGSCMCRTNIIGTRCTDVTTGYFTPSFSY 531          

HSP 2 Score: 105.531 bits (262), Expect = 1.562e-22
Identity = 62/189 (32.80%), Postives = 94/189 (49.74%), Query Frame = 3
Query: 2799 IEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPN 3365
            +  +C+   G+C +C    +G  C+KC  G++ N     C  C C   G++     +CN  +G+CPC P V+   C RC D F+  ++  GC+ C C+   G+ +  C+ +TG C C+    G  C  C+ GF+   +   GC  C C+  GS  +QCN   G+C CK    G  C+ C  GT    PN
Sbjct:  743 LNSTCDRYGGKC-QCKPGVTGRTCDKCKPGFY-NFTSSGCAPCDCVSTGSH---HLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTGSGCVECRCNMS-GSADAQCDDVTGNCTCKNSTDGAKCAECRFGFYNFTSA--GCQACNCHEGGSQSQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPN 923          

HSP 3 Score: 100.523 bits (249), Expect = 5.081e-21
Identity = 74/232 (31.90%), Postives = 109/232 (46.98%), Query Frame = 3
Query: 2163 IKCKCNVTGS-RNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF---CHSCKCNQMSTT---CDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECR 2837
            + C C+  G+  N+ C++ GG+CQC P V+G+TC++C    Y F + GC  C C  TGS +  C   +G+C C+ GV  + C  C   ++ +     C  C+CN   +    CD  TG C  CK ++ G  C  C  G+Y  TS G  C+ C C    S    S  C+L        C CK    G+ C+ C    + +  +    C PC C G       ++C S +G  R
Sbjct:  732 MACGCDSVGTYLNSTCDRYGGKCQCKPGVTGRTCDKCKPGFYNFTSSGCAPCDCVSTGSHHLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTGSGCVECRCNMSGSADAQCDDVTGNC-TCKNSTDGAKCAECRFGFYNFTSAG--CQACNCHEGGS---QSQQCNL----QTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYCFGR-----SNTCTSASGFVR 948          

HSP 4 Score: 98.5969 bits (244), Expect = 2.025e-20
Identity = 77/244 (31.56%), Postives = 108/244 (44.26%), Query Frame = 3
Query: 2661 TAFTCMCKKGYSGQFCDQC------ETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAV-----RTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQ-IG-CLPCNCDYPIGALNHS--CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLN-GCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKG 3344
            T   C C    +G  C++C      +T     + ++   C+ C C  + D     S     G C  C  NT G  CE+C   ++ N ++       C  C C   G  +   G CN  TG+C C  NV G QCD C D F+  + + IG C  C C    G +N S  C+Q  GQC C+     + C  CK G+W  P  L+  C +C C+  GSV + C++  G C C+  I G  C     G
Sbjct:  284 TGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADS-CTYSQQEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNN--GTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLC-VGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDCDYGGSVLQICSKTTGSCMCRTNIIGTRCTDVTTG 523          

HSP 5 Score: 90.8929 bits (224), Expect = 4.496e-18
Identity = 72/197 (36.55%), Postives = 102/197 (51.78%), Query Frame = 3
Query: 2820 KTGECRKCLFNTSGFNCEKCVSGYFGNGA---------VRTCTKCVCNHMG---TNSKWQGICNHETGKCP-CLPNVVGLQCDRCQDKFF-NLSSQIG----CLPCNCDYPIGALNH-SCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNG-CTKCYCNLDGSVFKQ--CNRNNGVCRCKPGITGRNCDMCMKG 3344
            +TG+   CL NT+G +CE+C+   F N              C +C C+      T S+ +G      G C  C  N  G  C+RC+DKF+ N+S  +     C  CNC +P G  N+ +CNQ TGQC C+A  +G+ C++C D FWG   +  G CT+C C  +G+V     C++ NG C CKP +  R C  C  G
Sbjct:  283 ETGKNCDCLHNTTGDDCERCLP-LFNNKTWMPATSETEPNPCERCECHSHADSCTYSQQEGY-----GTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNC-FPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHG 472          

HSP 6 Score: 88.9669 bits (219), Expect = 1.526e-17
Identity = 61/191 (31.94%), Postives = 91/191 (47.64%), Query Frame = 3
Query: 2673 CMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDG-FWGDPTKLNGCTKCYC 3242
            C CK G +G+ CD+C+   +    S    C PC C       +   CN+ +G+C  C        C +C   ++G      C +C CN  G+       C+  TG C C  +  G +C  C+  F+N +S  GC  CNC +  G+ +  CN  TG C C++   G+ C +C+ G +  DP   +GCT CYC
Sbjct:  754 CQCKPGVTGRTCDKCKPGFYNFTSSG---CAPCDCVSTGSHHL--VCNAVSGQC-PCKPGVITRTCSRCNDSFYGYTTGSGCVECRCNMSGSADAQ---CDDVTGNCTCKNSTDGAKCAECRFGFYNFTS-AGCQACNC-HEGGSQSQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYC 933          

HSP 7 Score: 87.0409 bits (214), Expect = 5.730e-17
Identity = 58/169 (34.32%), Postives = 85/169 (50.30%), Query Frame = 3
Query: 1194 RNIAVAINSS--QTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            +NI+ ++ S      + C CDS+GT   S C +          G C CK  V G  CDKCK GF+ F     +GC  C+CV  G+  +  C++ +G+C CK  V    CS C   ++  +    +GC  C+C+  GS D + CD  +G C CKN   G +C E +  +Y
Sbjct:  717 KNISFSVMSEVFHGAMACGCDSVGTYLNSTCDRY--------GGKCQCKPGVTGRTCDKCKPGFYNFT---SSGCAPCDCVSTGS-HHLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTG--SGCVECRCNMSGSADAQ-CDDVTGNCTCKNSTDGAKCAECRFGFY 870          

HSP 8 Score: 85.8853 bits (211), Expect = 1.342e-16
Identity = 60/198 (30.30%), Postives = 92/198 (46.46%), Query Frame = 3
Query: 1122 GGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYP 1715
            GG C  C+     + C++CK G+Y        +S  C  C C S G+           L     +G C CK  V    C +C   F+ +     +GC++C C M G+ + + CD  TG C CK+   G  C+ C+ G++N ++A   GC  C C E GS+  + C+  +G C CK+   G +C+  +   Y   P  P
Sbjct:  751 GGKC-QCKPGVTGRTCDKCKPGFYNF------TSSGCAPCDCVSTGSH---------HLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTG--SGCVECRCNMSGSADAQ-CDDVTGNCTCKNSTDGAKCAECRFGFYNFTSA---GCQACNCHEGGSQSQQ-CNLQTGICTCKSNALGEKCESCRPGTYHSDPNNP 925          

HSP 9 Score: 78.1814 bits (191), Expect = 3.262e-14
Identity = 53/181 (29.28%), Postives = 84/181 (46.41%), Query Frame = 3
Query: 2169 CKCNVTGSRNN-NCNKIGGQCQCLPNVSGKTCERCASESYGFDARG---CKKCKCDLTGSLNSQ--CYNDTGKCLCREGVEGQHCDTCKPGYWNFPF-----CHSCKCN---QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAF 2669
            C C   G  NN  CN+  GQC+C  NV+G+ C+ CA   +G+       C +C C   G++N+   C    G+C C+  V  + C  CK GYW+FP      C  C C+    +   C   TG C+ C+ N  G  C +   GY+  +   +  +  +  G     +N++   + F+ T +
Sbjct:  382 CNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDCDYGGSVLQICSKTTGSCM-CRTNIIGTRCTDVTTGYFTPSFSYLTFEAEEATGDYMQASNTLDLDMFFSGTGY 561          

HSP 10 Score: 75.0998 bits (183), Expect = 2.569e-13
Identity = 42/122 (34.43%), Postives = 61/122 (50.00%), Query Frame = 3
Query: 2145 VTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYW-----NFPFCHSCKCNQMSTTCDSKTG 2495
             T S  ++C+CN++GS +  C+ + G C C  +  G  C  C    Y F + GC+ C C   GS + QC   TG C C+    G+ C++C+PG +     N   C  C C   S TC S +G
Sbjct:  824 TTGSGCVECRCNMSGSADAQCDDVTGNCTCKNSTDGAKCAECRFGFYNFTSAGCQACNCHEGGSQSQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYCFGRSNTCTSASG 945          

HSP 11 Score: 75.0998 bits (183), Expect = 2.990e-13
Identity = 67/257 (26.07%), Postives = 107/257 (41.63%), Query Frame = 3
Query: 2355 NDTGK-CLCREGVEGQHCDTCKPGYWNFPF-----------CHSCKCNQMSTTC----DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGY--FGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLS 3059
            ++TGK C C     G  C+ C P + N  +           C  C+C+  + +C        G C +C  N+ G+ C+ C++ +Y + S  +    +C  C C       N +       N T   C C+   +G+ CD C    +G  +   G C  C C GN       +C+   G+C  C  N     C++C  GY  F       C +C C++ G+  +   IC+  TG C C  N++G +C      +F  S
Sbjct:  282 HETGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTYSQQEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTC------NQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQC-SCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDCDYGGSVLQ---ICSKTTGSCMCRTNIIGTRCTDVTTGYFTPS 528          

HSP 12 Score: 71.2478 bits (173), Expect = 3.587e-12
Identity = 67/237 (28.27%), Postives = 104/237 (43.88%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCEC---NSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSG 1631
            G C C+    G+ C+KCK  FYN          +++ C  C+C    SH   C+              G C  C+    ++ C RC   +Y        +   C++C C+  G+          +       G+C CK + +G +C +C+ GF+ F      GC  CNC   G+ +++ C+  TG C CKS   G  C +C+ G ++    N +GC+ C C  +G R N TC   SG
Sbjct:  752 GKCQCKPGVTGRTCDKCKPGFYN---------FTSSGCAPCDCVSTGSHHLVCN-----------AVSGQCP-CKPGVITRTCSRCNDSFY-----GYTTGSGCVECRCNMSGSA---------DAQCDDVTGNCTCKNSTDGAKCAECRFGFYNFT---SAGCQACNCHEGGS-QSQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYC--FG-RSN-TCTSASG 945          

HSP 13 Score: 66.6254 bits (161), Expect = 1.077e-10
Identity = 36/98 (36.73%), Postives = 54/98 (55.10%), Query Frame = 3
Query: 3048 FNLSSQI--GCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMC 3335
            F++ S++  G + C CD     LN +C++  G+C C+ G +G+ C+ CK GF+   +  +GC  C C   GS    CN  +G C CKPG+  R C  C
Sbjct:  721 FSVMSEVFHGAMACGCDSVGTYLNSTCDRYGGKCQCKPGVTGRTCDKCKPGFYNFTS--SGCAPCDCVSTGSHHLVCNAVSGQCPCKPGVITRTCSRC 816          

HSP 14 Score: 61.2326 bits (147), Expect = 4.060e-9
Identity = 70/269 (26.02%), Postives = 108/269 (40.15%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERC---------ASESYGFDARGCKKCKCDLTGSLNSQCYNDT---GKC-LCREGVEGQHCDTCKPGYW-------NFP-FCHSCKCNQMST----TCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI-LCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYF 2894
            +CKC+      +  ++ G  C CL N +G  CERC            +   +   C++C+C      +S  Y+     G C  C    EG  C+ CK  ++       N P  C  C C         TC+  TG+C  C+ N  G  C +C + ++G T   I  C +C C G     N ++  S   +     C CK     + C +C+  ++    + D  C+ C C  +    +   C+  TG C  C  N  G  C    +GYF
Sbjct:  268 RCKCHGHARWCDFPHETGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECH--SHADSCTYSQQEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTCNQTTGQC-ECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVG-----NGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDC--DYGGSVLQICSKTTGSC-MCRTNIIGTRCTDVTTGYF 525          

HSP 15 Score: 60.8474 bits (146), Expect = 5.452e-9
Identity = 45/139 (32.37%), Postives = 65/139 (46.76%), Query Frame = 3
Query: 2058 KVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPI----KCKCNVTGSRNN--NCNKIGGQCQCLPNVSGKTCERCASESYGFDAR---GCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCH 2447
            +  G+C   AN V+ ++CD         T+   +PI    +C C   G+ N   NC++  GQC C PNV  +TC+ C    + F       CK+C CD  GS+   C   TG C+CR  + G  C     GY+   F +
Sbjct:  397 QTTGQCECRAN-VTGRQCDSCADTFWGYTL---EPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDCDYGGSVLQICSKTTGSCMCRTNIIGTRCTDVTTGYFTPSFSY 531          

HSP 16 Score: 57.7658 bits (138), Expect = 5.119e-8
Identity = 46/156 (29.49%), Postives = 67/156 (42.95%), Query Frame = 3
Query: 2673 CMCKKG-YSGQFCDQCETNHFGNAISKD-GTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQG-----------------ICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPC 3083
            C C+ G Y+G  C+ C      N  +     C  CRC+G    R  D C+ +TG+C+ C   + G  CE+C  G         CT+C+  + G      G                 +CN  TG+C C   + G  CDRC +  +N S + GC+ C
Sbjct: 1122 CTCESGNYTGLSCELCNQGFTRNRPNNSYSACSLCRCTG----RSLD-CDGETGQCKGCRLGSQGLYCEQCQPGV---DNTTDCTQCLPEYWGLKEGSNGCQDCDCVLPNTLYGNSTVCNATTGQCTCKEKISGRTCDRCHENAYNTSDR-GCVEC 1268          

HSP 17 Score: 56.9954 bits (136), Expect = 9.229e-8
Identity = 56/210 (26.67%), Postives = 82/210 (39.05%), Query Frame = 3
Query: 2889 YFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGK---CPCLP-NVVGLQCDRCQDKFFNL---SSQIGCLPCNCDYPIGALNHSCNQLTGQCY-CQAGRSGKMCNNCKDG-------------FWGDPTKLNGCTKCYCNLDGSVFKQ---CNRNNGVCRCKPGITGRNCDMCMKGT-DGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLH 3443
            +  NG+V      + + +  +S  QGI   + G    C C   N  GL C+ C   F      +S   C  C C       +  C+  TGQC  C+ G  G  C  C+ G             +WG     NGC  C C L  +++     CN   G C CK  I+GR CD C +   +     C  C +C+ Q    +  +++    L 
Sbjct: 1091 FMSNGSV------LLSEIKLHSASQGIVGEKAGHVENCTCESGNYTGLSCELCNQGFTRNRPNNSYSACSLCRCT----GRSLDCDGETGQCKGCRLGSQGLYCEQCQPGVDNTTDCTQCLPEYWGLKEGSNGCQDCDCVLPNTLYGNSTVCNATTGQCTCKEKISGRTCDRCHENAYNTSDRGCVECPECFRQLQEHVFKLRDGIKDLQ 1290          

HSP 18 Score: 55.4546 bits (132), Expect = 2.350e-7
Identity = 42/141 (29.79%), Postives = 59/141 (41.84%), Query Frame = 3
Query: 2370 CLCREG-VEGQHCDTCKPGYW------NFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENG-------------YYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHF 2732
            C C  G   G  C+ C  G+       ++  C  C+C   S  CD +TG+C  C+  S G  C+ C+ G             Y+G       C+ C C     L N   G S + N T   C CK+  SG+ CD+C  N +
Sbjct: 1122 CTCESGNYTGLSCELCNQGFTRNRPNNSYSACSLCRCTGRSLDCDGETGQCKGCRLGSQGLYCEQCQPGVDNTTDCTQCLPEYWGLKEGSNGCQDCDC----VLPNTLYGNSTVCNATTGQCTCKEKISGRTCDRCHENAY 1258          
BLAST of Netrin-4 vs. Ensembl Nematostella
Match: EDO40131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S854])

HSP 1 Score: 225.713 bits (574), Expect = 3.107e-59
Identity = 208/800 (26.00%), Postives = 327/800 (40.88%), Query Frame = 3
Query:   90 FVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVT-TSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMS--GVHNVSIEISFESEFQFTFTHLRFK---TYRPAAMYIERSKDYGRTWNKYAYF------SDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLF------------SADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCK--AKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWL-----PADKNSTNECRKCECNSHSSSCHFDPVVYQQ------SRKMSGG-VCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTK---FPSI----CIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGC--DSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIP-NKCLEKDLPIV--------LTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRK--VLGECLNYAN--LVSSKKCDFLNAEISTNTVTK-SDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGC 2306
             VA + L ++        + NP  G   +       A  TCGL   E+Y  V+  S S R    + CD+ +P        SH   N+V     +   WWQS +  G  N++I ++  +  QF    ++ K    YRP  M +++S + G++++ + YF         C   F    + + S  N+VLCT        S G  V +            S    +W+N              +T+IR++F+ +    D            ++YA+SE  + G C+C G  + CK  +  G  Q        C CQ  + G +C++C   YN  PW      P   ++   C+ C C+ HS  C ++  V +       SR+ SGG VC +C+HNTE  NCERC+  YYR    + N+   C  C+C   G++    P +    C+++      +  G C CK N  G +C  CK GF+    N   GC  C+C   G   +       + G+C CK  V G  C TC   Y+ LS  + +GC  C C +YG   +  C+K  G+C C     G +CD    E+Y     +        K  +   S S   +F +   T       SF +V+S     +        + +     +  + P N+   ++L +         +TV    +N+        +V     + ++   R+   +G C    N   V     D   A + T T       + C+CN  GS N  C K  GQC C P V+G+ C++C    Y     GC
Sbjct:    7 LVASFALILQQ---ISTNLANPSQGTANVAFMKQAEAQITCGLRAREKYFAVSQMSQSPRNRVESTCDAYDP------ELSHNASNLVD---NNESTWWQSTASVGTANITIRLTGPAFKQFYVDTIQIKFGEYYRPRQMALKKSINNGQSFDDWHYFVSYPDPDKQCKEKFDETLQTQPSKENDVLCTGYPDVNSQSIGQVVEWKPHFLRGQLENPSQKLLEWIN--------------VTDIRLEFITMERVFDVLA------AKWHHYAVSEVRVFGFCACNGQGTGCKFNSTVGDFQ--------CVCQPGSCGYYCDECCPAYNQYPWKKGGKGPLIVDTAAACQPCNCHDHSFVCVYNETVARMNASLDMSRQYSGGGVCQDCKHNTEGINCERCRPLYYRPENRSQNAVDACESCNCSEAGSRDHALPGVLHLDCLRDVNASETMKPGDCFCKNNTMGRRCHLCKPGFFNLTSNNPLGCQVCDCDTAGARNSSNICEGDAHGQCPCKQNVQGLRCDTCNNTYYGLSRQDTHGCRPCLC-DYGGSSSPVCNKTDGQCKCLPNIDGRQCDRPLDEYYFPDLHFIGADFSHQKSEVGQSSVSWVTSFTVVDRTNKTS--GSFSLVISYQSATRQEVTGSVTSPEGTTTQQVTLPPCNQTCHQNLSVFGEMSLTGKVTVNVTAANDDFRGVRASVVPREFYEASALGDRRDAFIGNCSVTTNSVRVGEDAEDLCKAGVFTLTTDYLGQALACECNRDGSVNLTCQKYAGQCHCKPGVTGRKCDQCQQGFYNLTTTGC 763          

HSP 2 Score: 144.05 bits (362), Expect = 2.706e-34
Identity = 100/317 (31.55%), Postives = 155/317 (48.90%), Query Frame = 3
Query: 2163 IKCKCNVTGSRNNNCNKIGGQC-QCLPNVSGKTCERCASESYGFDARG----CKKCKCDLTGSLNSQCYNDTGKCLCR--EGVEGQHCDTCKPGYWNF-----PF---CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPG---LSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFN 3053
            I C CN   +  N+C    G C  C  N +G+ CE C    YG  A G    CK+C CD      +  ++D  +   +   G+       C PG+        PF   C  C CN  +  C + TG C NCK N+ G +C+ C++G+YG+T+ G    CK+C C      +S+     G  +  N       C +GY G  C  CE+ +FG  +   G C  C+C+ N      + CN+ TG+C  C +NT+GF+CE+C +  +G+   + C  C+C+  G+   +  +C+++TG+C C PNV    C +C+  + N
Sbjct: 1553 IPCNCN---NHTNDCYADTGLCYNCKHNTAGEHCELCDDGFYGNAADGTPGDCKQCPCD--APRTTTAFSDVRRLQAKSDRGIRSGTEHRCAPGHHRVNVSGDPFYGKCIPCNCNNHTNDCYADTGLCYNCKHNTTGEHCELCDDGFYGNTTDGTPGDCKQCPCDAPRTTTSMCMEDAGRPVCLN-------CSEGYEGVTCQTCESRYFGKPLDPGGNCSLCQCNNNT-----EICNTTTGQCTNCQYNTTGFHCERCQNETYGDAKKQQCVDCLCDSTGS---YNNVCDYKTGQCECKPNVGLRNCSKCEVSWLN 1849          

HSP 3 Score: 125.176 bits (313), Expect = 1.724e-28
Identity = 106/349 (30.37%), Postives = 149/349 (42.69%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNF-----PF---CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFT------CMCKKGYSGQFCDQCETNHFGNAISKD---GTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGN---GAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCL---PNVVGLQCDRCQDKFFNLSSQIG--CLPCNCDYPIGALNHSCNQLTGQCY-CQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMC 3335
            +C C     G  C+ C PG+        PF   C  C CN  +  C + TG C NCK N+ G +C+ C++G+YG+ + G      QCP           C     TTAF+          +G       +C   H    +S D   G C PC C+ + +      C + TG C  C  NT+G +CE C  G++GN   G    C +C C+   T +    +C  + G+  CL       G+ C  C+ ++F      G  C  C C+         CN  TGQC  CQ   +G  C  C++  +GD  K   C  C C+  GS    C+   G C CKP +  RNC  C
Sbjct: 1519 QCACGPEYSGLSCERCAPGHHRVNVSGDPFYGKCIPCNCNNHTNDCYADTGLCYNCKHNTAGEHCELCDDGFYGNAADGTPGDCKQCP-----------CDAPRTTTAFSDVRRLQAKSDRGIRSGTEHRCAPGHHRVNVSGDPFYGKCIPCNCNNHTND-----CYADTGLCYNCKHNTTGEHCELCDDGFYGNTTDGTPGDCKQCPCDAPRTTT---SMCMEDAGRPVCLNCSEGYEGVTCQTCESRYFGKPLDPGGNCSLCQCNNNT----EICNTTTGQCTNCQYNTTGFHCERCQNETYGDAKKQQ-CVDCLCDSTGSYNNVCDYKTGQCECKPNVGLRNCSKC 1843          

HSP 4 Score: 100.138 bits (248), Expect = 6.061e-21
Identity = 87/283 (30.74%), Postives = 122/283 (43.11%), Query Frame = 3
Query: 2628 NSIGCSLIFNTTA--FTCMCKKGYSGQFCDQCETNHFGNAISKDG----------TCQPCRCSGN--------IDQRIEDSCN-----SKTGECRKCLFNTSGFNCEKCVSGYF-----GNGAVRTCTKCVCNHMGT-NSKWQGICN------------HETGKCPCLPNVVGLQCDRCQDKFFNLSSQ--IGCLPCNCDYPIGALNHSC---NQLTGQCYCQAGRSGKMCNNCKDGFWGDPTK-LNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCD 3329
            N  G    FN+T   F C+C+ G  G +CD+C   +      K G           CQPC C  +           R+  S +     S  G C+ C  NT G NCE+C   Y+        AV  C  C C+  G+ +    G+ +             + G C C  N +G +C  C+  FFNL+S   +GC  C+CD   GA N S        GQC C+    G  C+ C + ++G   +  +GC  C C+  GS    CN+ +G C+C P I GR CD
Sbjct:  259 NGQGTGCKFNSTVGDFQCVCQPGSCGYYCDECCPAYNQYPWKKGGKGPLIVDTAAACQPCNCHDHSFVCVYNETVARMNASLDMSRQYSGGGVCQDCKHNTEGINCERCRPLYYRPENRSQNAVDACESCNCSEAGSRDHALPGVLHLDCLRDVNASETMKPGDCFCKNNTMGRRCHLCKPGFFNLTSNNPLGCQVCDCD-TAGARNSSNICEGDAHGQCPCKQNVQGLRCDTCNNTYYGLSRQDTHGCRPCLCDYGGSSSPVCNKTDGQCKCLPNIDGRQCD 540          

HSP 5 Score: 80.8777 bits (198), Expect = 5.284e-15
Identity = 76/277 (27.44%), Postives = 110/277 (39.71%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNFPF---------------CHSCKCNQMSTTCD------------------SKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKNNSIG-----CSLIFNTTAFT----CMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKT-GECRKCLFNTSGFNCEKCVSGYFGNGAVRT--CTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFF 3050
            +C+C+ G  G +CD C P Y  +P+               C  C C+  S  C                   S  G C +CK N+ G NC+ C   YY   +R       C+ C C    S  +   G     C    N +       C CK    G+ C  C+   F    +    CQ C C     +   + C     G+C  C  N  G  C+ C + Y+G     T  C  C+C++ G++S    +CN   G+C CLPN+ G QCDR  D+++
Sbjct:  275 QCVCQPGSCGYYCDECCPAYNQYPWKKGGKGPLIVDTAAACQPCNCHDHSFVCVYNETVARMNASLDMSRQYSGGGVCQDCKHNTEGINCERCRPLYYRPENRSQNAVDACESCNCSEAGSRDHALPGVLHLDCLRDVNASETMKPGDCFCKNNTMGRRCHLCKPGFFNLTSNNPLGCQVCDCDTAGARNSSNICEGDAHGQC-PCKQNVQGLRCDTCNNTYYGLSRQDTHGCRPCLCDYGGSSSP---VCNKTDGQCKCLPNIDGRQCDRPLDEYY 547          

HSP 6 Score: 75.485 bits (184), Expect = 2.080e-13
Identity = 84/323 (26.01%), Postives = 130/323 (40.25%), Query Frame = 3
Query:  861 CSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKD-FY-NDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSG-------------------------------------------GVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCY-CKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEW 1691
            C+C  H + C A  G      + Y   +C+HNT G+HCE C D FY N +   P D      C++C C++  ++  F  V   Q++   G                                           G+C NC+HNT  ++CE C  G+Y N      +   C +C CD+  T   S+C+++    + LN     C E  EG  C  C+  ++    +    C  C C     +    C+++TG+C  C+   TG  C  C+   +   +A    C  C C   GS +N  CD  +G+C CK       C + +  W
Sbjct: 1555 CNCNNHTNDCYADTG------LCY---NCKHNTAGEHCELCDDGFYGNAADGTPGD------CKQCPCDAPRTTTAFSDVRRLQAKSDRGIRSGTEHRCAPGHHRVNVSGDPFYGKCIPCNCNNHTNDCYADTGLCYNCKHNTTGEHCELCDDGFYGNTTDG--TPGDCKQCPCDAPRTT-TSMCMEDAGRPVCLN-----CSEGYEGVTCQTCESRYFGKPLDPGGNCSLCQCNNNTEI----CNTTTGQCTNCQYNTTGFHCERCQNETY--GDAKKQQCVDCLCDSTGSYNN-VCDYKTGQCECKPNVGLRNCSKCEVSW 1847          

HSP 7 Score: 70.0922 bits (170), Expect = 8.394e-12
Identity = 93/393 (23.66%), Postives = 156/393 (39.69%), Query Frame = 3
Query:  630 SSIIPSEGGTVLFSADTSDWVNNDVYWN-----KKRNDIT----------AITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISE-WIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYN-----DSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDS--LGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFN--GNEETG-CLKCNCVMMGTLENRGCDSSTGKCY-CKSFVTGNDCSTCKIGYF-NLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKN---GFAGIRCDEIKSEWYIEKPTYP 1715
            +S++ + GG + F+   S+   N +  N     K  +++T          A+   R  F+R  ++  ++    P  R  +   +++   I    S Y    +       V  + +    C C     G  CE+C   ++       P+         +C  C CN+H++ C+ D            G+C NC+HNT  ++CE C  G+Y N   A  +   C +C CD+    T F  +   + + D G+ +G              +C  G  + N  G+   G C+ CNC          C + TG CY CK   TG  C  C  G++ N ++     C  C C +        C + +G+ +C N   G+ G+ C   +S  Y  KP  P
Sbjct: 1402 TSLVGAYGGNLSFTLHMSNQSGNTIGPNVKVIMKGLHNVTIEAAVASIPVAVPTTRSVFMREISWL-YRGSSEPVSRAHFMLVLAKPRAILVTASLYTSGGQDYFSSPPVGDRALEVEQCACGPEYSGLSCERCAPGHHRVNVSGDPFY-------GKCIPCNCNNHTNDCYADT-----------GLCYNCKHNTAGEHCELCDDGFYGN--AADGTPGDCKQCPCDAPRTTTAFSDVRRLQAKSDRGIRSG-----------TEHRCAPGHHRVNVSGDPFYGKCIPCNC----NNHTNDCYADTGLCYNCKHNTTGEHCELCDDGFYGNTTDGTPGDCKQCPC-DAPRTTTSMCMEDAGRPVCLNCSEGYEGVTCQTCESR-YFGKPLDP 1756          

HSP 8 Score: 59.3066 bits (142), Expect = 1.642e-8
Identity = 39/110 (35.45%), Postives = 55/110 (50.00%), Query Frame = 3
Query: 2145 VTKSDPIKCK---CNVTGSRN--NNCN-KIGGQCQCLPNVSGKTCERCASESYGF---DARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCH 2447
            +T ++P+ C+   C+  G+RN  N C     GQC C  NV G  C+ C +  YG    D  GC+ C CD  GS +  C    G+C C   ++G+ CD     Y+ FP  H
Sbjct:  444 LTSNNPLGCQVCDCDTAGARNSSNICEGDAHGQCPCKQNVQGLRCDTCNNTYYGLSRQDTHGCRPCLCDYGGSSSPVCNKTDGQCKCLPNIDGRQCDRPLDEYY-FPDLH 552          

HSP 9 Score: 58.9214 bits (141), Expect = 2.205e-8
Identity = 77/300 (25.67%), Postives = 116/300 (38.67%), Query Frame = 3
Query: 2169 CKCNVTGSRNNNCNKIGG-QCQCLPNVSGKTCERC--ASESYGFD-----------ARGCKKCKCD--------------LTGSLN-SQCYNDTGKCL-CREGVEGQHCDTCKPGYWN--------FPFCHSCKCNQ-------------------MSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL-CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYF 2894
            C CN  G+     + +G  QC C P   G  C+ C  A   Y +            A  C+ C C               +  SL+ S+ Y+  G C  C+   EG +C+ C+P Y+            C SC C++                   ++ +   K G C  CK N+ G  C  C+ G++  TS   L C+ C C   +  +N+S  C          C CK+   G  CD C   ++G +      C+PC C  +        CN   G+C KCL N  G  C++ +  Y+
Sbjct:  256 CACNGQGTGCKFNSTVGDFQCVCQPGSCGYYCDECCPAYNQYPWKKGGKGPLIVDTAAACQPCNCHDHSFVCVYNETVARMNASLDMSRQYSGGGVCQDCKHNTEGINCERCRPLYYRPENRSQNAVDACESCNCSEAGSRDHALPGVLHLDCLRDVNASETMKPGDCF-CKNNTMGRRCHLCKPGFFNLTSNNPLGCQVCDC-DTAGARNSSNICE---GDAHGQCPCKQNVQGLRCDTCNNTYYGLSRQDTHGCRPCLC--DYGGSSSPVCNKTDGQC-KCLPNIDGRQCDRPLDEYY 547          
BLAST of Netrin-4 vs. Ensembl Nematostella
Match: EDO36500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF5])

HSP 1 Score: 218.394 bits (555), Expect = 4.973e-57
Identity = 169/590 (28.64%), Postives = 267/590 (45.25%), Query Frame = 3
Query:  135 RKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPF-----RWWQS----------MSGVHN---VSIEISFESEFQFTFTHLR--FKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNIN--EVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTL-ENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYG-------SRD---NKTCDKY-------------SGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKS 1766
            R T C P    + + R   +  S+TCG T + +YC +   +      C  CD+ +     +S   H + N+V      PF      WWQS          +S + N   V+I +SF   +Q +  H++  F + RP AM  ++S D+G TW     ++  C R +   P+      N  ++ CT E+S   P + G V F A     + +  Y+N +  D  ++T++R++     + G   +  +    NK YYAIS   + GRCSC GHA  C    G +  +      C+C+HNT G  CE C+  +N+ PW+ A++   NEC++C CN+H++SC     VY ++  +  G+C  CQHNT+  +C+ C + +YR+++  IN    CL        T   S   Q  + +     G C CK NV G +CD+C  G W F    +  C  CNC + GT      CD  TG+C+CK  + G  C  C+ G+         GC+ C+C   G       S D    + C +Y             +G C C+ G  G  C +     +     Y L   +   I+   ++ +
Sbjct:   39 RATPCMPFTSFMSLTRN--VTTSNTCGTTRA-KYCELPGPE-----PCYYCDANSS----NSNEQHPVTNLVDNELVLPFYAQKYTWWQSQTWWETNQLGLSSIENPPKVNITLSFGKRYQLS-GHIKATFYSKRPKAMCFDKSNDFGHTWETLLCYAWRCDRFYNMEPQSNPDPANPFKLYCTEEYSGHEPRKLGIVEFIASKRYEICD--YFNPEVQDYLSVTDVRLRLEYPASDGMELLYQDEQTLNKLYYAISNVEVTGRCSCNGHAMGCS---GPIMSRR-----CECEHNTMGTDCEMCEPLFNNRPWMRANQTHGNECQECNCNNHATSC-----VYNET--LGYGLCKGCQHNTQGDHCQNCTAKHYRDLSKPINHVNACLGI------TNNGSCLTQATDTE---QIGQCSCKPNVYGRRCDQCIPGHWGFTLPPQGECKACNCNISGTRNATINCDQLTGQCFCKPSIQGVYCDGCRDGFHTFPTQGDGGCAPCQCDLGGGFSICDKSSDGICTQKCVEYTLPTYIHISIASNAGSCTCRKGVEGFSCKQALYGTFYPALDYLLHEAETTGISATTITPA 589          

HSP 2 Score: 84.7297 bits (208), Expect = 3.175e-16
Identity = 86/316 (27.22%), Postives = 129/316 (40.82%), Query Frame = 3
Query: 2514 GNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAI------SKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSK--WQGICNHETGKCPCLPNVVGLQCDRCQDKF--FNLSSQIGCLPCNCDYPIGALNHS--CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLN-GCTKCYCNLDGSVFKQCNR-------------------------NNGVCRCKPGITGRNCDMCMKGT 3347
            G    Y  +   N  Y   S   +  +C C G      +++GCS      +  C C+    G  C+ CE   F N        +    CQ C C+ +    + +      G C+ C  NT G +C+ C + ++ + +        C  +  N     Q     + G+C C PNV G +CD+C      F L  Q  C  CNC+   G  N +  C+QLTGQC+C+    G  C+ C+DGF   PT+ + GC  C C+L G  F  C++                         N G C C+ G+ G +C   + GT
Sbjct:  261 GMELLYQDEQTLNKLYYAISNVEVTGRCSCNG------HAMGCSGPI--MSRRCECEHNTMGTDCEMCEP-LFNNRPWMRANQTHGNECQECNCNNHATSCVYNE-TLGYGLCKGCQHNTQGDHCQNCTAKHYRDLSKPINHVNACLGITNNGSCLTQATDTEQIGQCSCKPNVYGRRCDQCIPGHWGFTLPPQGECKACNCNIS-GTRNATINCDQLTGQCFCKPSIQGVYCDGCRDGFHTFPTQGDGGCAPCQCDLGGG-FSICDKSSDGICTQKCVEYTLPTYIHISIASNAGSCTCRKGVEGFSCKQALYGT 564          

HSP 3 Score: 79.337 bits (194), Expect = 1.316e-14
Identity = 49/158 (31.01%), Postives = 68/158 (43.04%), Query Frame = 3
Query: 2169 CKCNVTGSRN-NNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIG 2639
            C+C+  GS N   C   GGQC C P V+G  C  C    Y   + GCKKC+C ++GS+   C N  GKC C+  VEG  CD CK G ++                      C +C G    +NC +       + +   +    Q P L  L +  +G
Sbjct:  763 CECDPEGSTNPTQCVAYGGQCPCKPGVAGLKCNHCLPGYYALSSSGCKKCECSMSGSITPVCDNADGKCQCKANVEGAKCDACKYGTFHLD--------------SGNPHGCQHCFGYGHAHNCTSASGFIATNITSNFITASMQRPFLKILFDFPLG 906          

HSP 4 Score: 72.0182 bits (175), Expect = 2.283e-12
Identity = 47/131 (35.88%), Postives = 64/131 (48.85%), Query Frame = 3
Query: 1239 CHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSG 1631
            C CD  G+  P+ C+           G C CK  V G +C+ C  G++  +    +GC KC C M G++    CD++ GKC CK+ V G  C  CK G F+L + N +GC    C  YG   N  C   SG
Sbjct:  763 CECDPEGSTNPTQCVAY--------GGQCPCKPGVAGLKCNHCLPGYYALS---SSGCKKCECSMSGSI-TPVCDNADGKCQCKANVEGAKCDACKYGTFHLDSGNPHGCQ--HCFGYGHAHN--CTSASG 877          

HSP 5 Score: 68.5514 bits (166), Expect = 2.649e-11
Identity = 60/210 (28.57%), Postives = 90/210 (42.86%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTCDSKT----GKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAF-TCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGY--FGNGAVRTCTKCVCNHMG 2945
            +C C     G  C+ C+P + N P+          C  C CN  +T+C        G C  C+ N+ G +CQNC   +Y D S+ I      C G++   NN    +   +T     C CK    G+ CDQC   H+G  +   G C+ C C+ +  +    +C+  TG+C  C  +  G  C+ C  G+  F       C  C C+  G
Sbjct:  305 RCECEHNTMGTDCEMCEPLFNNRPWMRANQTHGNECQECNCNNHATSCVYNETLGYGLCKGCQHNTQGDHCQNCTAKHYRDLSKPINHVNA-CLGIT---NNGSCLTQATDTEQIGQCSCKPNVYGRRCDQCIPGHWGFTLPPQGECKACNCNISGTRNATINCDQLTGQC-FCKPSIQGVYCDGCRDGFHTFPTQGDGGCAPCQCDLGG 509          

HSP 6 Score: 66.6254 bits (161), Expect = 1.091e-10
Identity = 39/109 (35.78%), Postives = 61/109 (55.96%), Query Frame = 3
Query: 3030 RCQDKFFNLSSQI--GCLPCNCDYPIGALNHS-CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGT 3347
            +C+   F+ S+++  G   C CD P G+ N + C    GQC C+ G +G  CN+C  G++   +  +GC KC C++ GS+   C+  +G C+CK  + G  CD C  GT
Sbjct:  744 QCRALVFSASTELYNGTKVCECD-PEGSTNPTQCVAYGGQCPCKPGVAGLKCNHCLPGYYALSS--SGCKKCECSMSGSITPVCDNADGKCQCKANVEGAKCDACKYGT 849          

HSP 7 Score: 60.077 bits (144), Expect = 9.872e-9
Identity = 71/274 (25.91%), Postives = 107/274 (39.05%), Query Frame = 3
Query: 2223 QCQCLPNVSGKTCERC-----------ASESYGFDARGCKKCKCDLTGSLNSQCYNDT---GKCL-CREGVEGQHCDTCKPGYW---NFPFCHSCKCNQMS--------TTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRC----------------------SGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYF 2894
            +C+C  N  G  CE C           A++++G +   C++C C+      S  YN+T   G C  C+   +G HC  C   ++   + P  H   C  ++         T   + G+C +CK N +G  C  C  G++G T   +G  CK C C  +S  +N +I C  +       C CK    G +CD C           DG C PC+C                         +   I  S  S  G C  C     GF+C++ + G F
Sbjct:  305 RCECEHNTMGTDCEMCEPLFNNRPWMRANQTHGNE---CQECNCN--NHATSCVYNETLGYGLCKGCQHNTQGDHCQNCTAKHYRDLSKPINHVNACLGITNNGSCLTQATDTEQIGQC-SCKPNVYGRRCDQCIPGHWGFTLPPQG-ECKACNC-NISGTRNATINCDQLTG----QCFCKPSIQGVYCDGCRDGFHTFPTQGDGGCAPCQCDLGGGFSICDKSSDGICTQKCVEYTLPTYIHISIASNAGSC-TCRKGVEGFSCKQALYGTF 565          

HSP 8 Score: 58.9214 bits (141), Expect = 2.179e-8
Identity = 56/205 (27.32%), Postives = 80/205 (39.02%), Query Frame = 3
Query: 2232 CLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDT------GKCLCREGVEGQHCDTCKPGYWNFPF-----CHSCKCNQMST-----TCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI-LCKKCQCP---GLSSLKNNSIG--------------CSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAI 2744
            C  N  G  C+ C ++ Y   ++        L  + N  C          G+C C+  V G+ CD C PG+W F       C +C CN   T      CD  TG+C  CK +  G  C  C +G++   ++G   C  CQC    G S    +S G                +   + A +C C+KG  G  C Q     F  A+
Sbjct:  366 CQHNTQGDHCQNCTAKHYRDLSKPINHVNACLGITNNGSCLTQATDTEQIGQCSCKPNVYGRRCDQCIPGHWGFTLPPQGECKACNCNISGTRNATINCDQLTGQCF-CKPSIQGVYCDGCRDGFHTFPTQGDGGCAPCQCDLGGGFSICDKSSDGICTQKCVEYTLPTYIHISIASNAGSCTCRKGVEGFSCKQALYGTFYPAL 569          

HSP 9 Score: 58.151 bits (139), Expect = 3.928e-8
Identity = 49/158 (31.01%), Postives = 68/158 (43.04%), Query Frame = 3
Query: 2829 ECRKCLFNTSGFNCEKCVSGY----FGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCP-------------CLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGAL---NHSCNQLTGQCYCQAGR--SGKMCNNCKDGFWGDPTKLNGCTKC 3236
            E  +C  N +G +CE C  GY     G      C  C CN           C+ ETG C              C  NV G +C RC+ +++ LS   GC  C+C+ P G L      C+Q TGQC C A     G++C+ C++  +     L  C +C
Sbjct: 1072 ERAECHRNYTGLSCEVCAEGYTRQPMGGTPFDRCVLCSCNDRSR------FCHPETGVCTDCKIGTHGYRCELCTNNVQGPECVRCKPQYWGLSKD-GCKACDCNLP-GTLYSNTSVCDQTTGQCSCNATLHIGGQLCDRCEENAYNKSDSLFDCHEC 1221          

HSP 10 Score: 53.5286 bits (127), Expect = 9.391e-7
Identity = 43/140 (30.71%), Postives = 56/140 (40.00%), Query Frame = 3
Query: 2376 CREGVEGQHCDTCKPGYWNFPF-------CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENG------------YYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGY--SGQFCDQCETNHF 2732
            C     G  C+ C  GY   P        C  C CN  S  C  +TG C +CK  + GY C+ C N             Y+G +  G  CK C C    +L +N+  C    + T   C C       GQ CD+CE N +
Sbjct: 1076 CHRNYTGLSCEVCAEGYTRQPMGGTPFDRCVLCSCNDRSRFCHPETGVCTDCKIGTHGYRCELCTNNVQGPECVRCKPQYWGLSKDG--CKACDCNLPGTLYSNTSVC----DQTTGQCSCNATLHIGGQLCDRCEENAY 1209          

HSP 11 Score: 53.1434 bits (126), Expect = 1.209e-6
Identity = 42/127 (33.07%), Postives = 57/127 (44.88%), Query Frame = 3
Query: 1308 LNAGHCICKENVEGNQCDKCKIGFWKFNGNEET--GCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIK 1682
            +N+   + + N E  QC         F+ + E   G   C C   G+     C +  G+C CK  V G  C+ C  GY+ LS++   GC  C+CS  GS     CD   GKC CK    G +CD  K
Sbjct:  729 VNSRIAMSRINTENPQCRA-----LVFSASTELYNGTKVCECDPEGSTNPTQCVAYGGQCPCKPGVAGLKCNHCLPGYYALSSS---GCKKCECSMSGS-ITPVCDNADGKCQCKANVEGAKCDACK 846          

HSP 12 Score: 50.447 bits (119), Expect = 9.273e-6
Identity = 73/318 (22.96%), Postives = 114/318 (35.85%), Query Frame = 3
Query:  618 TSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPW--LPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG--CDSSTGKCYCKS--FVTGNDCSTCKIGYFNLSNA 1553
             S+ ++I+ S    V   AD +      V  ++      ++T  + Q +  +  G W       IR   Y+   +  +R +    G A   KA+ G  +V   V    +C  N  G  CE C + Y   P    P D+     C  C CN  S  CH +            GVC +C+  T    CE                                                   +C  NV+G +C +CK  +W   G  + GC  C+C + GTL +    CD +TG+C C +   + G  C  C+   +N S++
Sbjct:  983 ASKMTAILLSGNRNVTLQADVT---TGHVTLDETHMVTPSLTPYQFQSLLTNLSGLW-------IR-ALYHPHPDGSVRFQGVSLGSA---KARGGG-EVAGFVERA-ECHRNYTGLSCEVCAEGYTRQPMGGTPFDR-----CVLCSCNDRSRFCHPET-----------GVCTDCKIGTHGYRCE---------------------------------------------------LCTNNVQGPECVRCKPQYW---GLSKDGCKACDCNLPGTLYSNTSVCDQTTGQCSCNATLHIGGQLCDRCEENAYNKSDS 1214          
BLAST of Netrin-4 vs. Ensembl Medaka
Match: lamb2 (laminin subunit beta 2 [Source:NCBI gene;Acc:101158524])

HSP 1 Score: 857.44 bits (2214), Expect = 0.000e+0
Identity = 551/1799 (30.63%), Postives = 871/1799 (48.42%), Query Frame = 3
Query:   66 TLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTYPLE-------------------HLKEIKINLPPVSKSGYYNFVITTDTKNMQF-----FDSFI------IVLSIYHVGK----SSC-QSYQDTMQLI----KDSRYIVIPNK-CLEKDLPIVLTV-FT---------IESNNKXXXXXXXXXXXXXXXXN-------STKTRKVLGE---CLNYANLVSSKKCDFLNAEI--STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT----SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTN-SKWQG----ICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFL----IVVKNTFDKLH--NSSGVFMSNVKFPKEIDD--------------VCTSLEQNMKSLKEIKKYFPIGYD----------IIISNFSEKLSRLKYYVYNSNIIDFNTQQ--NSIITIENST---DYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQF----NISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYLNG-SADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFL--KLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNL--KIDTKVVVNKSNYFKLKSASNSK-ISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKI 5090
            +L  +  +  A    E +  + C    C P  GDLL+GRE  L+ASSTCG+   E YC+V+      + KC  CDS+ PY    +T +HRIENV++   P     WWQS +G  +V I++  E+EF FT   + FKT+RPAAM IERS D+GRTW  Y YFS +C   FP +      NIN+V+C S +S I PS  G V++          D Y    +N +  ITN+RV F +LHT GD  +D    I+ KYYYAI E ++RG C CYGHAS+C   +G +  ++ MV+G C C HNTKG +CE+C DFYND PW PA+  +TN C+KC CN HS+ CHFD  VY  +  +SGGVCD CQHNT  +NCE C+  YY++    I     C  C CD  G++   +C    +L LG+  G C CK NVEG +CDKCK GF+  + +   GC  C C   GT+     CD  +G C+CK  VTG  C  C   ++ LS+ ++NGC  C C   G+ DN  C   SG+C C+    G +C +++S ++   ++   Y  E                   H     +    V + G   F I+    +M++     ++S +      + +S+   G     S C  +  D  +L+      +R++V P   CLE+D+   L   FT         I  +N I       ++     ++       ++  RK   E   C   A  V   +     A++  S + +     + C C+  GS ++ C+  GGQC+C PNV G+ C++CA  +YGF   GC  C C L GS+   C   +G+C CR G  GQ CD C+ G+W FP C  C+CN  +  CD +TG C+NC+ N+ G  C  C +GYYG      + G  C+ C CP G +S ++ +  C          C C +GY+G  C++C   ++GN     G CQPC+C+ NID    D+C+ +TGECRKCL+NT G NC  C SGY G+ A R C KC CN +GT  S+  G    +C   +G+C CLPNVVGL CD C    +NL++ +GC PCNCD P  ++  SCN+ TGQC C+ G  G+ C +C++ FWGDP  +  C  C C+  G    QC+R  G C C+ G++G  CD C +G  G+ P+C  C  C+  WD  +    +  +   ++ H   ++G+     KF K++++                 ++   M+ +++++       D          ++  + SE    L      +  ++  ++Q  + +  ++NS     Y     S N+ RD     NE   +  + ++ ++++++  + +   K   F R        L  +  K +D+D         +   N   C + +  +P  C E  CGG GC+ D   RH      C G +       A   L +   +   KE N+       +     E K    + +S+    +     T+  ++    +  +L+ +I+ +L    AD    E++   + +  I    ++I  L  +I++R+R L+NV  IL +++ + ++ +     A RA+     + ++ + ++      Q  +   ++ +      +   +  L  +   E+E    + +++   +R+  L  ++ I+K     +N       +         N   +I    + +K N  + +  + +K + E  +         ND +K +  KL    K + + EL  +   + ++ K  +L  L+ K+
Sbjct:    4 SLFTLVSVLAAAVGQEPDHAHGCAHGSCYPATGDLLVGREKDLKASSTCGMRRKEPYCIVSHLQD--EKKCFECDSRRPYNPVYNTINHRIENVIATFKPHRKNSWWQSENGKSDVFIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSADFGRTWQVYRYFSHDCDASFPGVSHGPLRNINDVICESRYSDIEPSTEGEVIYRVLDPSIRIEDPYSPAIQNQLK-ITNLRVNFTKLHTLGDNLLDPRAEIKEKYYYAIYELVVRGNCFCYGHASECAPIKGVRADIEGMVHGRCVCNHNTKGLNCEQCDDFYNDRPWRPAEGRNTNACKKCNCNDHSNLCHFDMAVYLATGNVSGGVCDECQHNTMGRNCEMCQLFYYKDPLKDIRDPHVCKPCDCDPDGSENGGMCDSHTDLALGMMGGQCRCKANVEGPRCDKCKTGFFGLSADSAHGCQPCRCDRRGTVTGSSQCDPVSGDCFCKRLVTGRSCDQCLPEHWGLSH-DLNGCRGCDCDVGGALDN-LCSMESGQCRCRGHMTGRQCTQVESGYFFMALDHFLYEAEFAKMGQGCTLETREHQSGRHASWTDVGFARVPEGGTLEFTISNIPYSMEYDLLIRYESQMPRDWEEVQISVIRPGPIPTSSPCGNTIPDDDRLLVSLPAGARFVVPPQPVCLERDVIYTLRFEFTRYQDANSILIGGSNAILLMDSIALMPRHSSLDMFTAGDPASAVRKQTYERYHCHEGAKSVIRPQMSDTCAKLISSMSAIINDGALACNCDPQGSMSSVCDVRGGQCRCRPNVIGQRCDKCAPGTYGFGPSGCIPCGCSLEGSVTRLCDKFSGQCQCRPGAFGQRCDGCQAGHWGFPSCRPCQCNGHADQCDQRTGACINCRDNTGGDKCDRCADGYYGSPVLGGASGAQCRPCPCPEGPNSGRHFAASCYQDNRNLQIICNCNQGYTGARCEECAPGYYGNPSQPGGRCQPCQCNNNIDMSDMDACDRRTGECRKCLYNTEGPNCNICRSGYHGDAARRNCRKCTCNFLGTERSQCTGREDCVCQRASGQCQCLPNVVGLTCDHCAPNHWNLANGMGCAPCNCD-PNNSVTSSCNEFTGQCQCRDGFGGQTCRDCQENFWGDPRTI--CRACDCDWRGIETSQCHRATGHCVCQQGVSGVRCDQCARGFSGQFPDCQPCHQCFGDWDRIVQDLAVRTRALAERAHEIQTTGLIGPYEKFFKDLEEKLARAQGIVNERNATAAAVSALMELIEDLRAQIGETTDTLNRLEGDLTLVQDSNSEASKELSALEREAKELNLTSEQLHHQLDVLKNSNFLGAYDSIRSSHNRSRDAERRANESTTTRPSTVSQSADTRRRTERLIAAKKDDFNRKNAANKRGLGDLNAKVQDLD---------MTRLNEKVCGS-SSHDP--CGESPCGGAGCRDDDGNRH------CGGLNCDGAVAAADDALQKAKHA--EKELNKALEETQGLFTKVAEAKSKAEEAKSKAQAALDKATATKNKVERSNNDLRDLIKQIRNFLTQEGADPDSIEAVANQVLRLSIPASPSQIRELADEIKARVRSLSNVEAILQQTQEDVRKAEQLLLDAKRARHQAEGVKSTAEAVTQALLDAQTAQTSAEKAIAKAKTDIGEARNRLTQI---ESETSDNEKDLNDAMDRLGTLGREINILKTKCAENNMAAARAEETATMARDKANEAKQILDGQLTDKYNEVQQRVDTKAKAVQEAKEKAETFREEANDLLKDAQDKL----KRLAELELSYEENQRKLEGKARQLDGLEGKM 1767          
BLAST of Netrin-4 vs. Ensembl Medaka
Match: lamb2 (laminin subunit beta 2 [Source:NCBI gene;Acc:101158524])

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 551/1811 (30.43%), Postives = 871/1811 (48.09%), Query Frame = 3
Query:   66 TLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRL-PQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEG-QVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTYPLE-------------------HLKEIKINLPPVSKSGYYNFVITTDTKNMQF-----FDSFI------IVLSIYHVGK----SSC-QSYQDTMQLI----KDSRYIVIPNK-CLEKDLPIVLTV-FT---------IESNNKXXXXXXXXXXXXXXXXN-------STKTRKVLGE---CLNYANLVSSKKCDFLNAEI--STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT----SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSG------------QFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTN-SKWQG----ICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFL----IVVKNTFDKLH--NSSGVFMSNVKFPKEIDD--------------VCTSLEQNMKSLKEIKKYFPIGYD----------IIISNFSEKLSRLKYYVYNSNIIDFNTQQ--NSIITIENST---DYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEF-CGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQF----NISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYLNG-SADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFL--KLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNL--KIDTKVVVNKSNYFKLKSASNSK-ISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKI 5090
            +L  +  +  A    E +  + C    C P  GDLL+GRE  L+ASSTCG+   E YC+V+      + KC  CDS+ PY    +T +HRIENV++   P     WWQS +G  +V I++  E+EF FT   + FKT+RPAAM IERS D+GRTW  Y YFS +C   FP +      NIN+V+C S +S I PS  G V++          D Y    +N +  ITN+RV F +LHT GD  +D    I+ KYYYAI E ++RG C CYGHAS+C   +G +  ++ MV+G C C HNTKG +CE+C DFYND PW PA+  +TN C+KC CN HS+ CHFD  VY  +  +SGGVCD CQHNT  +NCE C+  YY++    I     C  C CD  G++   +C    +L LG+  G C CK NVEG +CDKCK GF+  + +   GC  C C   GT+     CD  +G C+CK  VTG  C  C   ++ LS+ ++NGC  C C   G+ DN  C   SG+C C+    G +C +++S ++   ++   Y  E                   H     +    V + G   F I+    +M++     ++S +      + +S+   G     S C  +  D  +L+      +R++V P   CLE+D+   L   FT         I  +N I       ++     ++       ++  RK   E   C   A  V   +     A++  S + +     + C C+  GS ++ C+  GGQC+C PNV G+ C++CA  +YGF   GC  C C L GS+   C   +G+C CR G  GQ CD C+ G+W FP C  C+CN  +  CD +TG C+NC+ N+ G  C  C +GYYG      + G  C+ C CP G +S ++ +  C          C C +GY+G              C++C   ++GN     G CQPC+C+ NID    D+C+ +TGECRKCL+NT G NC  C SGY G+ A R C KC CN +GT  S+  G    +C   +G+C CLPNVVGL CD C    +NL++ +GC PCNCD P  ++  SCN+ TGQC C+ G  G+ C +C++ FWGDP  +  C  C C+  G    QC+R  G C C+ G++G  CD C +G  G+ P+C  C  C+  WD  +    +  +   ++ H   ++G+     KF K++++                 ++   M+ +++++       D          ++  + SE    L      +  ++  ++Q  + +  ++NS     Y     S N+ RD     NE   +  + ++ ++++++  + +   K   F R        L  +  K +D+D         +   N   C + +  +P  C E  CGG GC+ D   RH      C G +       A   L +   +   KE N+       +     E K    + +S+    +     T+  ++    +  +L+ +I+ +L    AD    E++   + +  I    ++I  L  +I++R+R L+NV  IL +++ + ++ +     A RA+     + ++ + ++      Q  +   ++ +      +   +  L  +   E+E    + +++   +R+  L  ++ I+K     +N       +         N   +I    + +K N  + +  + +K + E  +         ND +K +  KL    K + + EL  +   + ++ K  +L  L+ K+
Sbjct:    4 SLFTLVSVLAAAVGQEPDHAHGCAHGSCYPATGDLLVGREKDLKASSTCGMRRKEPYCIVSHLQD--EKKCFECDSRRPYNPVYNTINHRIENVIATFKPHRKNSWWQSENGKSDVFIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSADFGRTWQVYRYFSHDCDASFPGVSHGPLRNINDVICESRYSDIEPSTEGEVIYRVLDPSIRIEDPYSPAIQNQLK-ITNLRVNFTKLHTLGDNLLDPRAEIKEKYYYAIYELVVRGNCFCYGHASECAPIKGVRADIEGMVHGRCVCNHNTKGLNCEQCDDFYNDRPWRPAEGRNTNACKKCNCNDHSNLCHFDMAVYLATGNVSGGVCDECQHNTMGRNCEMCQLFYYKDPLKDIRDPHVCKPCDCDPDGSENGGMCDSHTDLALGMMGGQCRCKANVEGPRCDKCKTGFFGLSADSAHGCQPCRCDRRGTVTGSSQCDPVSGDCFCKRLVTGRSCDQCLPEHWGLSH-DLNGCRGCDCDVGGALDN-LCSMESGQCRCRGHMTGRQCTQVESGYFFMALDHFLYEAEFAKMGQGCTLETREHQSGRHASWTDVGFARVPEGGTLEFTISNIPYSMEYDLLIRYESQMPRDWEEVQISVIRPGPIPTSSPCGNTIPDDDRLLVSLPAGARFVVPPQPVCLERDVIYTLRFEFTRYQDANSILIGGSNAILLMDSIALMPRHSSLDMFTAGDPASAVRKQTYERYHCHEGAKSVIRPQMSDTCAKLISSMSAIINDGALACNCDPQGSMSSVCDVRGGQCRCRPNVIGQRCDKCAPGTYGFGPSGCIPCGCSLEGSVTRLCDKFSGQCQCRPGAFGQRCDGCQAGHWGFPSCRPCQCNGHADQCDQRTGACINCRDNTGGDKCDRCADGYYGSPVLGGASGAQCRPCPCPEGPNSGRHFAASCYQDNRNLQIICNCNQGYTGIVKRSGATIFKRARCEECAPGYYGNPSQPGGRCQPCQCNNNIDMSDMDACDRRTGECRKCLYNTEGPNCNICRSGYHGDAARRNCRKCTCNFLGTERSQCTGREDCVCQRASGQCQCLPNVVGLTCDHCAPNHWNLANGMGCAPCNCD-PNNSVTSSCNEFTGQCQCRDGFGGQTCRDCQENFWGDPRTI--CRACDCDWRGIETSQCHRATGHCVCQQGVSGVRCDQCARGFSGQFPDCQPCHQCFGDWDRIVQDLAVRTRALAERAHEIQTTGLIGPYEKFFKDLEEKLARAQGIVNERNATAAAVSALMELIEDLRAQIGETTDTLNRLEGDLTLVQDSNSEASKELSALEREAKELNLTSEQLHHQLDVLKNSNFLGAYDSIRSSHNRSRDAERRANESTTTRPSTVSQSADTRRRTERLIAAKKDDFNRKNAANKRGLGDLNAKVQDLD---------MTRLNEKVCGS-SSHDP--CGESPCGGAGCRDDDGNRH------CGGLNCDGAVAAADDALQKAKHA--EKELNKALEETQGLFTKVAEAKSKAEEAKSKAQAALDKATATKNKVERSNNDLRDLIKQIRNFLTQEGADPDSIEAVANQVLRLSIPASPSQIRELADEIKARVRSLSNVEAILQQTQEDVRKAEQLLLDAKRARHQAEGVKSTAEAVTQALLDAQTAQTSAEKAIAKAKTDIGEARNRLTQI---ESETSDNEKDLNDAMDRLGTLGREINILKTKCAENNMAAARAEETATMARDKANEAKQILDGQLTDKYNEVQQRVDTKAKAVQEAKEKAETFREEANDLLKDAQDKL----KRLAELELSYEENQRKLEGKARQLDGLEGKM 1779          
BLAST of Netrin-4 vs. Ensembl Medaka
Match: lamb1b (laminin subunit beta-1 [Source:NCBI gene;Acc:101165682])

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 450/1311 (34.32%), Postives = 686/1311 (52.33%), Query Frame = 3
Query:   78 VFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE-MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRG-CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTYPLEHLKE--------------------------------IKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLS--IY-------HVGKSSCQSYQDTMQLIKDSRYIVIPNK-CLEKDL----PIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGE----------CLNYA-NLVSSKKCDFLNAEI-STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYG--DTSRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTN----SKWQG-ICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEI--KKYFPIGYDIIISNFSEKLSRLKYY--VYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNG 3782
             + ++   +  E E  +VC +  C P  GDLLIGR   L ASSTCG++   R+C+V   +   + KC +CDS+  Y   ++  SH IENVV+    +  + WWQS +GV NV+I++  E+EF FT   + FKT+RPAAM IERS D+G++W  Y YF+ +C   FP I       +++++C + +S I PS+ G V+F      +   D Y  + +N +  ITN+RV+F++LHT GD  +D    +  KYYYA+ + ++RG C CYGHAS+C   +G+    E MV+G C C HNT+G +CE+C+DFY D PW PA   +T+ C++C+CN H++SCHFD  V+  +  +SGGVCDNCQHNT  + CE+C   +Y++    +     C  C CD  G+     C    ++  GL +G C CK NVEG +CD C+ G++   G    GCL C C  +GT+     CDS TGKC CK  V G++C  C   ++ LSN +++GC  C C   G+  N  CD  SG+C+C+    G RCD+++S +Y   ++  TY  E  K                                 ++ N+  + +S  Y+ +I  + +  Q ++  ++ +   ++       H   S     + ++ L   SR++++    C EK L     + L +++  S+ + P ++ID +V+              GE          CL  + N++ S   D     I S + +     + C+C+  GS ++ C   GGQC+C PNV G+ C+ CA  ++ F   GC+ C CD  GS+ + C+  TG+C C  G  G+ C  C PG+W FP C  C+CN  S  C   TG+C  C+  + G++C+ C NGY+G  +   G  C+ C CP G  S +  S  C L+ ++    C+C  GY G  CD+C   ++GN +   G C  C+C+ NID     SC+S+TG C KCL++T G  C+ C  GY+GN A ++CTKC+C+  GT     S  +G  C+  +G+CPC PNVVG  CD C    + +SS  GC  C+CD P+ ++  SC+++TGQC C+ G  G+ C  CK+ FWGDP     C  C C+  G    QC+R  G C C    +G  CD C +G  G+ P C  C  C+  WD  +  + N   +L  +    +  ++      D+ +SLE N K+++EI   K      + I  +  + +  + Y   V NS        Q      E + D   A   +     +     EL++ + NI N 
Sbjct:   10 AWALWCPVWTQEPEFADVCTEGSCYPATGDLLIGRAHKLSASSTCGVSQPTRFCIVGHLEE--EKKCFLCDSRQMYDEETNNISHTIENVVTTFAPNRLKTWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMMIERSMDFGKSWQIYRYFAYDCETSFPGISTGPMVRVDDIICDTRYSDIEPSKEGEVIFRVLDPAYDIEDPYSLRIQN-MLKITNLRVKFIKLHTLGDNLLDSRDEVTEKYYYALYDMVVRGNCFCYGHASECAPMDGEPSGAEGMVHGRCMCNHNTEGLNCERCQDFYQDLPWRPAQGKNTHACKRCDCNHHATSCHFDLAVFMMTGNVSGGVCDNCQHNTMGRQCEQCARFFYQHPNRHLRDPNICEPCDCDPDGSVEGGNCDPRTDVAAGLISGQCRCKANVEGERCDNCRRGYYGL-GKHPEGCLPCTCNQLGTMPGGAHCDSETGKCICKRLVDGHNCDQCLPEHWGLSN-DMDGCRPCDCDHGGAVHN-NCDPDSGQCVCREHMFGRRCDQVESGFYFIDLDHYTYEAEDAKHGPGVAVVPRPYPLNRSPTWTGMGFVNVPEGAYLEFNVNNIPESMDYDILIRYEPQLPQQWEQLVLRVERPVFNPPNRSGHCTNSIQSGDEQSISLSPGSRHVLLVRPVCFEKGLNYTIRLTLPLYSTNSHVQNPYTLIDSLVLMPRVRELEMFHGTKGEAEWDTFQRYRCLESSRNVIKSPMTDICKDYIFSVSALLHKGAMACQCDPQGSLSSVCESSGGQCRCRPNVVGRNCDHCAPGTFLFSPAGCRPCNCDPLGSVRAFCHELTGQCECVRGATGRQCSQCLPGFWGFPQCRMCQCNGHSDYCHPNTGECQGCRDFTTGHHCERCMNGYHGNPELGSGEHCRPCMCPDGPRSGRQFSDSCYLLADSDHLVCVCSSGYKGSRCDECAPGYYGNPLVPGGRCMACQCNNNIDMHDPKSCDSRTGACLKCLYHTEGHACQHCKPGYYGNAATQSCTKCMCSPFGTEQEACSSAEGCQCDRRSGQCPCQPNVVGQNCDHCAPDTWGISSGKGCQRCDCD-PVHSVGSSCDEVTGQCVCKPGFGGRTCRECKELFWGDPKV--KCHACDCDPRGISSGQCHRATGHCACLESASGPRCDTCARGHWGEFPACEPCHRCFPVWDTVVSELANQTRRLQ-AQVTELHAIRVTAPYKDLISSLESNAKAVREILENKTASAKMEKIAEDSHQIIGLMSYLSGVMNSTEETLTFLQGDANMTEANLDALTAEADQ-----LDANVQELRRLVHNIKNA 1305          
BLAST of Netrin-4 vs. Ensembl Medaka
Match: lamb1a (laminin subunit beta 1 [Source:NCBI gene;Acc:101167953])

HSP 1 Score: 463.766 bits (1192), Expect = 6.247e-135
Identity = 236/545 (43.30%), Postives = 336/545 (61.65%), Query Frame = 3
Query:  117 ESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQ-RFSSTHSHRIENVVSRLPQDPFR-WWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE-MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY---IEKPTYPLEHLK 1730
            E  +VC +  C P  GDLLIGR   L A+STCG+T  E +C+V  S    + KC +CDS  P++ R + T+SHR+ENVV+    +  + WWQS +G+ NV+I+++ E+EF FT   + FKT+RPAAM IERS D+G+TW  Y YF+ +C   FPS+P+     +++V+C S +S I PS  G V++      +  +D Y  + +N +  ITN+RV+F +LHT GD  +D    I+ KYYYA+ + ++RG C CYGHAS+C    G  Q  E MV+G C C HNTKG +CE+C+DFY+D PW PA+  +TN C++C CN HS +CHFD  V+  S  +SGGVCDNCQHNT    CE+CK  +Y++          C  C+CD LG+    +C    ++  GL AG C CK NVEG +CD+C+   +  + +E  GC  C C  +GT      CDS +G C+CK   TG DC  C   ++ LSN +++GC  C C   G+  N+ CD+ SG+C+C++   G RCD+I+S +Y   ++  TY  E  K
Sbjct:   52 EFSDVCTEGSCYPATGDLLIGRAHQLFATSTCGVTRPEPFCIV--SHLQEEKKCFLCDSTVPFEERANHTNSHRVENVVTTFGPNRLKTWWQSENGLENVTIQLNLEAEFHFTHLIMTFKTFRPAAMVIERSADFGKTWQVYRYFAYDCESAFPSVPQGPMQKVDDVICDSRYSDIEPSTEGEVIYRVLDPAFRIDDPYSPRIQN-LLKITNLRVKFTKLHTLGDNLLDSRIEIKEKYYYAVYDMVVRGNCFCYGHASECAPVLGAGQTMEGMVHGHCMCNHNTKGLNCEQCQDFYHDLPWRPAEGRNTNACKRCNCNQHSDACHFDMAVFVASGGVSGGVCDNCQHNTAGHKCEQCKPFFYQHPERDARDPNICQPCNCDPLGSVNGGLCDGMTDIRAGLIAGQCRCKVNVEGERCDRCRPAHYGLS-DEPEGCKACTCSPLGTAPGGNPCDSQSGNCFCKRLTTGQDCDQCVPEHWGLSN-DVDGCRPCDCDLGGAIHNQ-CDQMSGQCVCRDHMFGRRCDQIESGFYFSTLDHYTYEAEDAK 590          

HSP 2 Score: 399.438 bits (1025), Expect = 3.003e-113
Identity = 290/1028 (28.21%), Postives = 486/1028 (47.28%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCP-GLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGI-----CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHN------SSGVFMSNVKF----PKEIDDVCTSLEQNMKS-LKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILN----GASESKKIY-----------QNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISIN-----SKEIKDAYVKP-ESEYNTTIKLIDVTRGAIQSRRI--ESVNLLIKIKTYL-NGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNN----ISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNK-SNYFKLKSASNSKISERFQSLLNKSHNL----NDKIKA----------SHYKLKLNKKLIVDKELKLQSLSKDIDEKLS 5063
            +C+C+  GS +  C+  GGQC+C PNV G++C+RCA  ++ F   GC  C+C+  GS +  C   TG+C C  G  G+ CD C PG+W FP C  C CN  + TCD  TG CL+C+ ++ G++C+ C +GYYGD     G  C+ C CP G  SL+  +  C    ++    C+C  GY G  CD+C    +G+     G C PCRC+ NID    +SC+ ++GEC +CL+ + G  C+ C  GY+GN  ++ C KCVCN +GT+           CN  +G+CPCLPNV G  CDRC    +N++S +GC  C+CD P  +   SCNQ++GQC C  G  G+ CN CK+ FWGDP     C  C C+  G   +QCN+ NG C C  G++G  CD C +G  G  P+C  C  C+ +WD  +  + N   +L N      +SGV   + KF     K   ++   L+QN+ S      +        ++ + S+ L+R +        ++    QNS+   E       +++S  +  D T    EL+  ++ I N    GAS+S   Y              T+        + EL  + L  + Q  ++  +   E ++N+    G    T+  S   +  + CGG     D C R +     C GK           +    N+ + ++E  ++   ++      SK + +A ++  E++ +    L +  R  ++  R   E  +L+  I+ +L   +AD    E +   +   ++     ++  L ++IR ++ +L NV +IL++S  N ++ +   + A  A+E+ + + +S + +  +    QK +  +   +   A  + + K  L  +      A  K NN    +  + E +  LK     + +  + T Q   I Q       + L+   K  V+        K+   ++  +R +SL  ++  L     DK++           + + L++  + +V+ E  ++ L +DI  K+S
Sbjct:  794 ECQCDPQGSLSTVCDPNGGQCRCRPNVVGRSCDRCAPATFQFGPSGCIACECNPLGSQSPFCDQLTGQCGCVVGAYGRQCDRCLPGHWGFPACRPCSCNGHAETCDPDTGSCLHCRDHTAGHSCERCLDGYYGDPVLGSGDHCRPCMCPDGPESLRQFAGSCFRSDDSQQAVCVCSTGYRGPRCDECSPGFYGSPSEVGGQCVPCRCNNNIDMLDPESCDRQSGECLRCLYYSEGTACQDCKLGYYGNALLQDCRKCVCNKLGTSPSSCSSSGDCHCNRSSGQCPCLPNVTGQYCDRCAPDTWNMASGLGCQSCDCD-PKHSYGTSCNQISGQCSCHPGFGGRTCNECKELFWGDPEV--KCYACDCDPRGISEQQCNKANGRCVCVEGVSGPRCDTCARGFSGVFPDCQRCHQCFAEWDDVIGQLTNQTHRLVNKVNALRTSGVSGPHKKFFDSMQKSAAEIQVVLDQNLASQPLTELQQLLQQASDLMGSLSQTLNRTE-----QTFVELE-DQNSVTKTE-----VDSLMSDTQKLDET--VQELQLQVQFIKNSNIRGASDSITKYFLKSQAAEARANASTVDSGSPTELSAELHRLTLDTLNQTQEEFMSRHTEHAQNLDQLAG-ELQTLDLS--WINQKMCGGPSNAQDSC-RSSCGGLGCEGKGGCGGEGCDGAVTTANNVLMRVEESEREIASALEEVDQLSKMVLEAKLQADEAKLSAQNVLNNANRTKLKVDRSNEELRSLIRHIRDFLTQDAADPDSIEHVANEVLALQMPTTPAQLQNLTEEIRLKVGELGNVESILEQSAENIQRAEALLEQARHAREEAAGVKDSAEKVKHVLEEVQKAQTSVGSAIQQAAAEIQNTKELLSSVEIETASAELKVNNATVRLQRLDEDVMLLKSKNWNVSRSANMTSQDAAIIQSMADEVKQELQSGLKQKVSTVEQLIDQKAVGVAQAKDRAESLQKEAKELLLQAADKLQLLKDLEKSYEDNQHILEVKAEQLVELEAAVKELLQDISHKVS 1801          

HSP 3 Score: 97.0561 bits (240), Expect = 1.454e-19
Identity = 74/251 (29.48%), Postives = 115/251 (45.82%), Query Frame = 3
Query: 2673 CMCKKGYSGQFCDQCET-NHFGNAISKDG----TCQPCRCSGNIDQRIED------SCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGA-----VRTCTKCVCNHMGTNSKWQGICNHET--------GKCPCLPNVVGLQCDRCQDKFFNLSSQI-GCLPCNCDYPIGAL--NHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKG 3344
            CMC     G  C+QC+   H       +G     C+ C C+ + D    D      S     G C  C  NT+G  CE+C   ++ +          C  C C+ +G+ +   G+C+  T        G+C C  NV G +CDRC+   + LS +  GC  C C  P+G     + C+  +G C+C+   +G+ C+ C    WG    ++GC  C C+L G++  QC++ +G C C+  + GR CD    G
Sbjct:  326 CMCNHNTKGLNCEQCQDFYHDLPWRPAEGRNTNACKRCNCNQHSDACHFDMAVFVASGGVSGGVCDNCQHNTAGHKCEQCKPFFYQHPERDARDPNICQPCNCDPLGSVNG--GLCDGMTDIRAGLIAGQCRCKVNVEGERCDRCRPAHYGLSDEPEGCKACTCS-PLGTAPGGNPCDSQSGNCFCKRLTTGQDCDQCVPEHWGLSNDVDGCRPCDCDLGGAIHNQCDQMSGQCVCRDHMFGRRCDQIESG 573          

HSP 4 Score: 95.1301 bits (235), Expect = 5.994e-19
Identity = 75/266 (28.20%), Postives = 118/266 (44.36%), Query Frame = 3
Query: 2493 GKCLNCKGNSFGYNCQNCENGYYGDTSRGI------LCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISK---------------DGTCQPCRC-------SGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFG-NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQI-GCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFW 3200
            G C+ C  N+ G NC+ C++ Y+    R         CK+C C        +S  C   F+   F  +   G SG  CD C+ N  G+   +                  CQPC C        G  D   +       G+CR C  N  G  C++C   ++G +     C  C C+ +GT +     C+ ++G C C     G  CD+C  + + LS+ + GC PC+CD   GA+++ C+Q++GQC C+    G+ C+  + GF+
Sbjct:  324 GHCM-CNHNTKGLNCEQCQDFYHDLPWRPAEGRNTNACKRCNC------NQHSDACH--FDMAVF--VASGGVSGGVCDNCQHNTAGHKCEQCKPFFYQHPERDARDPNICQPCNCDPLGSVNGGLCDGMTDIRAGLIAGQCR-CKVNVEGERCDRCRPAHYGLSDEPEGCKACTCSPLGT-APGGNPCDSQSGNCFCKRLTTGQDCDQCVPEHWGLSNDVDGCRPCDCDLG-GAIHNQCDQMSGQCVCRDHMFGRRCDQIESGFY 575          

HSP 5 Score: 91.6633 bits (226), Expect = 7.391e-18
Identity = 72/261 (27.59%), Postives = 115/261 (44.06%), Query Frame = 3
Query: 2364 GKCLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTCD-----------SKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKNN------SIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFG-NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFF 3050
            G C+C    +G +C+ C+  Y + P+          C  C CNQ S  C               G C NC+ N+ G+ C+ C+  +Y    R      +C+ C C  L S+          I   LI    A  C CK    G+ CD+C   H+G +   +G C+ C CS        + C+S++G C  C   T+G +C++CV  ++G +  V  C  C C+  G        C+  +G+C C  ++ G +CD+ +  F+
Sbjct:  324 GHCMCNHNTKGLNCEQCQDFYHDLPWRPAEGRNTNACKRCNCNQHSDACHFDMAVFVASGGVSGGVCDNCQHNTAGHKCEQCKPFFYQHPERDARDPNICQPCNCDPLGSVNGGLCDGMTDIRAGLI----AGQCRCKVNVEGERCDRCRPAHYGLSDEPEG-CKACTCSPLGTAPGGNPCDSQSGNCF-CKRLTTGQDCDQCVPEHWGLSNDVDGCRPCDCDLGGA---IHNQCDQMSGQCVCRDHMFGRRCDQIESGFY 575          

HSP 6 Score: 91.2781 bits (225), Expect = 9.125e-18
Identity = 76/279 (27.24%), Postives = 116/279 (41.58%), Query Frame = 3
Query:  879 ASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPW-LPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHC----DSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNC-VMMGTLENRGCDSSTGKCY-CKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKT-------CDKYSGKCLCKNGFAGIRCD 1673
            A +C     Q    + + G C C     G+ C++C   +    W  PA       CR C CN H+ +C  D            G C +C+ +T   +CERC  GYY +    + S   C  C C    +SL  +F   C +  +    +    C+C     G +CD+C  GF+         C+ C C   +  L+   CD  +G+C  C  +  G  C  CK+GY+   NA +  C  C C++ G+  +         C++ SG+C C     G  CD
Sbjct:  842 ACECNPLGSQSPFCDQLTGQCGCVVGAYGRQCDRCLPGH----WGFPA-------CRPCSCNGHAETCDPD-----------TGSCLHCRDHTAGHSCERCLDGYYGD--PVLGSGDHCRPCMCPDGPESL-RQFAGSCFRSDDSQQAV----CVCSTGYRGPRCDECSPGFYGSPSEVGGQCVPCRCNNNIDMLDPESCDRQSGECLRCLYYSEGTACQDCKLGYYG--NALLQDCRKCVCNKLGTSPSSCSSSGDCHCNRSSGQCPCLPNVTGQYCD 1089          

HSP 7 Score: 87.0409 bits (214), Expect = 1.602e-16
Identity = 72/247 (29.15%), Postives = 104/247 (42.11%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCD 1673
             VC C    +G  C++C   +  SP          +C  C CN++      DP    +S     G C  C + +E   C+ CK GYY N  +     Q C KC C+ LGT   S      +     ++G C C  NV G  CD+C    W  N     GC  C+C    +     C+  +G+C C     G  C+ CK  ++         C  C C   G  + + C+K +G+C+C  G +G RCD
Sbjct:  964 AVCVCSTGYRGPRCDECSPGFYGSP-----SEVGGQCVPCRCNNNID--MLDP----ESCDRQSGECLRCLYYSEGTACQDCKLGYYGNALL-----QDCRKCVCNKLGTSPSSC-SSSGDCHCNRSSGQCPCLPNVTGQYCDRCAPDTW--NMASGLGCQSCDCDPKHSY-GTSCNQISGQCSCHPGFGGRTCNECKELFWGDPEVK---CYACDCDPRGISEQQ-CNKANGRCVCVEGVSGPRCD 1186          

HSP 8 Score: 84.3445 bits (207), Expect = 1.023e-15
Identity = 83/290 (28.62%), Postives = 120/290 (41.38%), Query Frame = 3
Query:  861 CSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCI-CKENVEGNQCDKCKIGFWKFNGNEE-TGCLKCNCVMMGTLENRG-------CDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSE---YGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            CSC GHA  C    G             C+ +T G  CE+C D Y   P L     S + CR C C     S         +S      VC  C        C+ C  G+Y + +        C+ C C++      +I + +PE      +G C+ C    EG  C  CK+G++   GN     C KC C  +GT  +         C+ S+G+C C   VTG  C  C    +N+++    GC  C C     YG+    +C++ SG+C C  GF G  C+E K  ++
Sbjct:  889 CSCNGHAETCDPDTG---------SCLHCRDHTAGHSCERCLDGYYGDPVL----GSGDHCRPCMCPDGPESLRQFAGSCFRSDDSQQAVC-VCSTGYRGPRCDECSPGFYGSPS---EVGGQCVPCRCNN------NIDMLDPE-SCDRQSGECLRCLYYSEGTACQDCKLGYY---GNALLQDCRKCVCNKLGTSPSSCSSSGDCHCNRSSGQCPCLPNVTGQYCDRCAPDTWNMASGL--GCQSCDCDPKHSYGT----SCNQISGQCSCHPGFGGRTCNECKELFW 1145          

HSP 9 Score: 82.8037 bits (203), Expect = 3.165e-15
Identity = 74/278 (26.62%), Postives = 114/278 (41.01%), Query Frame = 3
Query: 2181 VTGSRNNNCNKIGGQCQCLPNVSGKTCERCAS--------ESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEG------QH------CDTCKPGYWNFP--------FCHSCKCNQMSTT----CDSKT--------GKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYF 2894
            V G+       + G C C  N  G  CE+C           + G +   CK+C C+     +  C+ D    +   GV G      QH      C+ CKP ++  P         C  C C+ + +     CD  T        G+C  CK N  G  C  C   +YG +     CK C C  L +    +       ++ +  C CK+  +GQ CDQC   H+G +   DG C+PC C  ++   I + C+  +G+C  C  +  G  C++  SG++
Sbjct:  311 VLGAGQTMEGMVHGHCMCNHNTKGLNCEQCQDFYHDLPWRPAEGRNTNACKRCNCN---QHSDACHFDMAVFVASGGVSGGVCDNCQHNTAGHKCEQCKPFFYQHPERDARDPNICQPCNCDPLGSVNGGLCDGMTDIRAGLIAGQC-RCKVNVEGERCDRCRPAHYGLSDEPEGCKACTCSPLGTAPGGN-----PCDSQSGNCFCKRLTTGQDCDQCVPEHWGLSNDVDG-CRPCDC--DLGGAIHNQCDQMSGQC-VCRDHMFGRRCDQIESGFY 575          

HSP 10 Score: 81.6481 bits (200), Expect = 7.864e-15
Identity = 50/154 (32.47%), Postives = 70/154 (45.45%), Query Frame = 3
Query: 2169 CKCNVTGSRNNN---------CNKIGGQCQCLPNVSGKTCERCASESYGF--DARGCKKCKCDLTGSL--NSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP----FCHSCKCN---QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT 2570
            C C+  GS N              I GQC+C  NV G+ C+RC    YG   +  GCK C C   G+    + C + +G C C+    GQ CD C P +W        C  C C+    +   CD  +G+C+ C+ + FG  C   E+G+Y  T
Sbjct:  426 CNCDPLGSVNGGLCDGMTDIRAGLIAGQCRCKVNVEGERCDRCRPAHYGLSDEPEGCKACTCSPLGTAPGGNPCDSQSGNCFCKRLTTGQDCDQCVPEHWGLSNDVDGCRPCDCDLGGAIHNQCDQMSGQCV-CRDHMFGRRCDQIESGFYFST 578          

HSP 11 Score: 71.2478 bits (173), Expect = 1.140e-11
Identity = 62/227 (27.31%), Postives = 93/227 (40.97%), Query Frame = 3
Query: 1044 RKCECNSHSS-SCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKC-YCKSFVTGNDCSTCKIGYF-NLSNANINGCSLCKCS-------EYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            ++C+C+   S S   DP         +GG C  C+ N   ++C+RC    ++           C+ C C+ LG++ P  C Q          G C C     G QCD+C  G W F       C  C+C   G  E   CD  TG C +C+    G+ C  C  GY+ +    + + C  C C        ++     ++ D     C+C  G+ G RCDE    +Y
Sbjct:  793 KECQCDPQGSLSTVCDP---------NGGQC-RCRPNVVGRSCDRCAPATFQF------GPSGCIACECNPLGSQSP-FCDQL--------TGQCGCVVGAYGRQCDRCLPGHWGF-----PACRPCSC--NGHAET--CDPDTGSCLHCRDHTAGHSCERCLDGYYGDPVLGSGDHCRPCMCPDGPESLRQFAGSCFRSDDSQQAVCVCSTGYRGPRCDECSPGFY 985          

HSP 12 Score: 70.4774 bits (171), Expect = 1.708e-11
Identity = 62/222 (27.93%), Postives = 94/222 (42.34%), Query Frame = 3
Query: 2841 CLFNTSGFNCEKCVSGYF------GNGA-VRTCTKCVCNH------------MGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIG-----CLPCNCDYPIGALNHS-CNQLT--------GQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVF--KQCNRNNGVCRCKPGITGRNCDMCMK---GTDGKMPNCSSCGDCWL 3392
            C  NT G NCE+C   Y         G     C +C CN             + +     G+C++      C  N  G +C++C+  F+    +       C PCNCD P+G++N   C+ +T        GQC C+    G+ C+ C+   +G   +  GC  C C+  G+      C+  +G C CK   TG++CD C+    G    +  C  C DC L
Sbjct:  328 CNHNTKGLNCEQCQDFYHDLPWRPAEGRNTNACKRCNCNQHSDACHFDMAVFVASGGVSGGVCDN------CQHNTAGHKCEQCKPFFYQHPERDARDPNICQPCNCD-PLGSVNGGLCDGMTDIRAGLIAGQCRCKVNVEGERCDRCRPAHYGLSDEPEGCKACTCSPLGTAPGGNPCDSQSGNCFCKRLTTGQDCDQCVPEHWGLSNDVDGCRPC-DCDL 541          

HSP 13 Score: 67.3958 bits (163), Expect = 1.806e-10
Identity = 52/188 (27.66%), Postives = 86/188 (45.74%), Query Frame = 3
Query: 1134 DNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCL-CKNGFAGIRCDEIKSEWY 1694
            +N Q   ++   + C++  +R  A+     Q   +C CD  G+   ++C  +P      N G C C+ NV G  CD+C    ++F     +GC+ C C  +G+ ++  CD  TG+C C     G  C  C  G++         C  C C+ +     +TCD  +G CL C++  AG  C+     +Y
Sbjct:  763 ENSQSVVKTPMTDICRNFIFRISALL---HQGAKECQCDPQGS-LSTVC--DP------NGGQCRCRPNVVGRSCDRCAPATFQFG---PSGCIACECNPLGS-QSPFCDQLTGQCGCVVGAYGRQCDRCLPGHWGFP-----ACRPCSCNGHA----ETCDPDTGSCLHCRDHTAGHSCERCLDGYY 925          
BLAST of Netrin-4 vs. Ensembl Medaka
Match: lamb2l (laminin subunit beta-2 [Source:NCBI gene;Acc:101158765])

HSP 1 Score: 449.899 bits (1156), Expect = 4.986e-130
Identity = 233/559 (41.68%), Postives = 325/559 (58.14%), Query Frame = 3
Query:   66 TLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQD-PFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKE--MVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLE-NRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLK 1730
            TL+ +     A       S + C +  C P  G+LLIGR   L A+STCGL   E+YC+V  S      KC  CDS+ PY      +SHRIENV+    +     WWQS SG  +VS+ ++ E+EF FT   ++FKT+RPAAM IERS D+GRTW  Y YF+ NC R FP +P +   +IN+V+C   +S I PS  G V+F          D Y + +  ++  ITN+R+ F +L+T GD  +D   ++  KYYYAI E ++RG C CYGHAS+C    G V  +E  M++G C C+HNT+G +CE+CKDF+ D PW PA+  + + C++C CN HS+ CHFD  VY  +  +SGGVCDNC HNT  +NCE C+  YY++    +   Q CL C CD +G+    +C    +LD+G+ AG C CK NV+G +CD CK+G++  + N+  GC  CNC   G +     CD  +G C CK +VTG  C  C   Y+ LSN    GC  C C ++G   N  C   SG+C C+    G +C E++S ++      PL++ K
Sbjct:    7 TLSLLIFALNAAGQELPSSPHGCTEGSCYPATGNLLIGRAVNLTATSTCGLNGPEQYCIV--SHLQELDKCFECDSQRPYHPLRHRNSHRIENVIYLSDRSGELTWWQSASGKEDVSLRLNLEAEFHFTHLIMKFKTFRPAAMIIERSADFGRTWRPYRYFASNCTRTFPGVPAKGLHHINDVICEERYSDIEPSTNGEVIFKVLDPSIPVKDPY-SLEIQELLRITNLRINFTKLNTLGDDLLDRRTDVLQKYYYAIYELVVRGSCFCYGHASECAPVPG-VFTRESGMIHGRCVCKHNTEGLNCERCKDFHKDLPWRPAEAENPHTCKECNCNGHSNQCHFDMAVYLATGNVSGGVCDNCLHNTVGRNCEMCQPFYYQDPNRDVRDPQVCLLCDCDPVGSFDGGVCDSHTDLDMGMIAGQCRCKANVKGIRCDDCKVGYYGLSQNDPQGCQPCNCDPRGIIRMGDPCDQISGDCSCKRYVTGRYCDQCLPEYWGLSNDQF-GCRPCDC-DFGGALNNRCMMESGQCDCRRHLIGRQCSEVQSGYFCA----PLDYYK 555          

HSP 2 Score: 407.912 bits (1047), Expect = 5.419e-116
Identity = 277/1058 (26.18%), Postives = 477/1058 (45.09%), Query Frame = 3
Query: 2133 STNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDT--SRGILCKKCQCPG-LSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGT--NSKWQGI--CNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEI----------------------------KKYFPIGYDI------------IISNFSEKLSRLKYYVYNSNI----IDFNTQQNSIITIENSTDYAKAMISKNKI-RDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKS-NQFFNLYASLLLDRTNMSIILKEFNQQF-NISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYLNG-SADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAK---EDTSYLLNSIKN-ISTLNRMTQKFEIIMKQFVMNF---ANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYSKSEFHAQC 5120
            S +++     + C+C+  GS ++ CN++GGQC+C PNV G+ C++CA  +YGF   GC  C C   GS + QC   TG+C CR+G  G+ C  C+PG W FP C  C+CN  +  CD +TG+C +C+ N+ G+ C+ C+NG+YG+     G  C+ C CPG   S   N   C   ++     C C +GY+G  CDQC   ++GN     G C PC+C+ NID    +SC+ +TG C +CL++T G  C +C  GY GN   + C +C C   GT  ++   G+  C+ E+G CPC  NV G  CD+C    +N   + GC PC+CD P  +L   CN  TGQC+C+ G  GK C  C+  +WGDP     C +C C++ GS  + C+R  G C C+ G  G+ CD C +G  G  PNC  C  C+  WD  +  +K   D +H ++   + +   P   D     LE+ +K +K++                             +   I  +I             +S   ++L  L Y V N  +    + F  Q   +       DY K++ ++ K    V+G F+ +++S K        +++I + +       F +  E  N +L  ++Q++  +   + ++S+ V    G +  ++  S P      CGG GC+ D+       +  C G+  N       + L    N    L   N++  NIS   +EI       +++   T++     +   +       + +  IK +L G  AD +  E +   +    + F    +  +  +IR  +  L NV  IL+++     +       A  AK   E      NS K  +    +  +K    +K+   N     NA   ++  L  + + + +   +  N+S   E ++       ++            ++    +  L + +   + ++ K +    +S S   IS++ + + + + +L +K K    +L+       D E ++Q    ++++       ++D++  K +  + C
Sbjct:  808 SISSIIHDGALACQCDPQGSLSSECNQVGGQCRCKPNVMGRRCDQCAPGTYGFGVSGCTACNCHPDGSSSHQCDPLTGQCPCRQGAIGRQCSDCQPGQWGFPSCRRCQCNGHADLCDPQTGECRDCRDNAAGHQCERCKNGFYGNPVLGSGEHCQPCPCPGNPGSNHFNGHSCQSDYSANQIICNCNQGYTGSRCDQCAPGYYGNPEQPGGQCLPCQCNNNIDPNDPESCDPRTGRCLRCLYHTHGQFCSECEPGYHGNAIAQECRRCTCVTAGTLQSACHDGLCHCDPESGACPCRENVRGRVCDQCAPNHWNFGEERGCEPCDCD-PQNSLGTHCNMFTGQCHCRPGFGGKTCTECEQFYWGDPQV--ECRECNCHVHGSNLRVCDRTTGQCDCQEGKAGQKCDECARGFTGAFPNCVRCHQCFQLWDDIICQIKRDLDHIHFTAQRILESGVMPGVGDARIRELEEKLKQVKDLIGSGRNESIHQLIGQAIDDIRAEIAVTDGRLMAISQEINTTAGEERFLQRTLSIMEDELRDLNYTVANMQLYHLPVGFADQFEKL-----KKDYQKSLQAEEKCNASVSGPFSPVEQSNK--------TRRITEELLEATKDEFLKAVEANNQSLNELQQEALKLGETVQDLSQKVC--GGHSSVSVNGSCP---DSQCGGAGCRDDR------GDLICGGEGCNGTVGSARAALNQSVNTIQSLMAANEELQNISRKLQEIASLTQDVKNQTMKTLEKAQEKKKHFEDNNKNLKDFIKMIKDFLTGEGADPESIEKVALQVLSITLPFNRTTLDKITTEIRDSLSNLTNVEAILNQTADTVNKAKELLSKAKDAKAQAEGVKDAANSTKQALEASEKAIEKATTALKEAQSNLNNTQNATAEVESQLLLLERKQMDIVMRLQNLSAEAEALRNKTEMNRRMADDALALANNATLRASSLEQSLNDTEEQYQELLRKVDSLGGESGSLDTISQKVRMMKSDAEDLFNKAKDGIKELEELTNTFKDNEDRMQKQLVELEDLKQNATDVRDELRRKMQTFSSC 1838          

HSP 3 Score: 112.079 bits (279), Expect = 4.694e-24
Identity = 92/330 (27.88%), Postives = 134/330 (40.61%), Query Frame = 3
Query:  858 RCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFD------------------------------PVVYQQSRKMSG-----------------------GVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTK----FPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDE 1676
            RC C GHA  C  + G+ +         DC+ N  G  CE+CK+ +  +P L     S   C+ C C  +  S HF+                              P  Y    +  G                       G C  C ++T  + C  C+ GY+ N A+A    Q C +C C + GT        +C  +PE      +G C C+ENV G  CD+C    W F   EE GC  C+C    +L    C+  TG+C+C+    G  C+ C+  Y+         C  C C  +GS + + CD+ +G+C C+ G AG +CDE
Sbjct:  913 RCQCNGHADLCDPQTGECR---------DCRDNAAGHQCERCKNGFYGNPVL----GSGEHCQPCPCPGNPGSNHFNGHSCQSDYSANQIICNCNQGYTGSRCDQCAPGYYGNPEQPGGQCLPCQCNNNIDPNDPESCDPRTGRCLRCLYHTHGQFCSECEPGYHGN-AIA----QECRRCTCVTAGTLQSACHDGLCHCDPE------SGACPCRENVRGRVCDQCAPNHWNF--GEERGCEPCDCDPQNSLGTH-CNMFTGQCHCRPGFGGKTCTECEQFYWGDPQVE---CRECNCHVHGS-NLRVCDRTTGQCDCQEGKAGQKCDE 1211          

HSP 4 Score: 107.071 bits (266), Expect = 1.453e-22
Identity = 80/252 (31.75%), Postives = 117/252 (46.43%), Query Frame = 3
Query: 2673 CMCKKGYSGQFCDQCETNH-----FGNAISKDGTCQPCRCSGNIDQRIED------SCNSKTGECRKCLFNTSGFNCEKCVSGYF--GNGAVR---TCTKCVCNHMGTNSKWQGICNHET--------GKCPCLPNVVGLQCDRCQDKFFNLSS--QIGCLPCNCDYPIGA--LNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKG 3344
            C+CK    G  C++C+  H              TC+ C C+G+ +Q   D      + N   G C  CL NT G NCE C   Y+   N  VR    C  C C+ +G+     G+C+  T        G+C C  NV G++CD C+  ++ LS     GC PCNCD P G   +   C+Q++G C C+   +G+ C+ C   +WG      GC  C C+  G++  +C   +G C C+  + GR C     G
Sbjct:  297 CVCKHNTEGLNCERCKDFHKDLPWRPAEAENPHTCKECNCNGHSNQCHFDMAVYLATGNVSGGVCDNCLHNTVGRNCEMCQPFYYQDPNRDVRDPQVCLLCDCDPVGSFDG--GVCDSHTDLDMGMIAGQCRCKANVKGIRCDDCKVGYYGLSQNDPQGCQPCNCD-PRGIIRMGDPCDQISGDCSCKRYVTGRYCDQCLPEYWGLSNDQFGCRPCDCDFGGALNNRCMMESGQCDCRRHLIGRQCSEVQSG 545          

HSP 5 Score: 97.4413 bits (241), Expect = 1.079e-19
Identity = 72/257 (28.02%), Postives = 110/257 (42.80%), Query Frame = 3
Query: 2364 GKCLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTC-----------DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKNN--SIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFG-NGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFF 3050
            G+C+C+   EG +C+ CK  + + P+          C  C CN  S  C           +   G C NC  N+ G NC+ C+  YY D +R +    +C  C C  + S           L     A  C CK    G  CD C+  ++G + +    CQPC C      R+ D C+  +G+C  C    +G  C++C+  Y+G +     C  C C+  G        C  E+G+C C  +++G QC   Q  +F
Sbjct:  295 GRCVCKHNTEGLNCERCKDFHKDLPWRPAEAENPHTCKECNCNGHSNQCHFDMAVYLATGNVSGGVCDNCLHNTVGRNCEMCQPFYYQDPNRDVRDPQVCLLCDCDPVGSFDGGVCDSHTDLDMGMIAGQCRCKANVKGIRCDDCKVGYYGLSQNDPQGCQPCNCDPRGIIRMGDPCDQISGDC-SCKRYVTGRYCDQCLPEYWGLSNDQFGCRPCDCDFGGA---LNNRCMMESGQCDCRRHLIGRQCSEVQSGYF 547          

HSP 6 Score: 86.2705 bits (212), Expect = 3.351e-16
Identity = 74/260 (28.46%), Postives = 102/260 (39.23%), Query Frame = 3
Query:  927 VYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHC--DSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNC-VMMGTLENRGCDSSTGKCY-CKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNK------TCDKYSGKCLCKNGFAGIRCDE 1676
            + G C C+    G+ C  C+      P           CR+C+CN H+  C  DP           G C +C+ N     CERCK+G+Y N    + S + C  C C  +     F     Q    D   N   C C +   G++CD+C  G++         CL C C   +   +   CD  TG+C  C     G  CS C+ GY    NA    C  C C   G+  +        CD  SG C C+    G  CD+
Sbjct:  883 LTGQCPCRQGAIGRQCSDCQPGQWGFP----------SCRRCQCNGHADLC--DPQT---------GECRDCRDNAAGHQCERCKNGFYGN--PVLGSGEHCQPCPCPGNPGSNHFNGHSCQS---DYSANQIICNCNQGYTGSRCDQCAPGYYGNPEQPGGQCLPCQCNNNIDPNDPESCDPRTGRCLRCLYHTHGQFCSECEPGYH--GNAIAQECRRCTCVTAGTLQSACHDGLCHCDPESGACPCRENVRGRVCDQ 1114          

HSP 7 Score: 71.2478 bits (173), Expect = 9.914e-12
Identity = 42/134 (31.34%), Postives = 73/134 (54.48%), Query Frame = 3
Query: 2061 VLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCK---CNVTG--SRNNNCNKIGGQCQCLPNVSGKTCERCASESYGF--DARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPF 2441
            + G+C   AN V   +CD  + ++    ++++DP  C+   C+  G     + C++I G C C   V+G+ C++C  E +G   D  GC+ C CD  G+LN++C  ++G+C CR  + G+ C   + GY+  P 
Sbjct:  421 IAGQCRCKAN-VKGIRCD--DCKVGYYGLSQNDPQGCQPCNCDPRGIIRMGDPCDQISGDCSCKRYVTGRYCDQCLPEYWGLSNDQFGCRPCDCDFGGALNNRCMMESGQCDCRRHLIGRQCSEVQSGYFCAPL 551          

HSP 8 Score: 71.2478 bits (173), Expect = 1.088e-11
Identity = 50/155 (32.26%), Postives = 74/155 (47.74%), Query Frame = 3
Query: 1233 LKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCL-CKNGFAGIRCDEIKSEWY 1694
            L C CD  G+   S C Q          G C CK NV G +CD+C  G + F     +GC  CNC   G+  ++ CD  TG+C C+    G  CS C+ G +   +     C  C+C+ +       CD  +G+C  C++  AG +C+  K+ +Y
Sbjct:  818 LACQCDPQGS-LSSECNQV--------GGQCRCKPNVMGRRCDQCAPGTYGFG---VSGCTACNCHPDGSSSHQ-CDPLTGQCPCRQGAIGRQCSDCQPGQWGFPS-----CRRCQCNGHAD----LCDPQTGECRDCRDNAAGHQCERCKNGFY 950          
BLAST of Netrin-4 vs. Planmine SMEST
Match: SMESG000062589.1 (SMESG000062589.1)

HSP 1 Score: 3346.21 bits (8675), Expect = 0.000e+0
Identity = 1673/1689 (99.05%), Postives = 1680/1689 (99.47%), Query Frame = 3
Query:   63 MTLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKX-XXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLSRLLVLQDKIYSKSEFHAQCLP 5126
            MTLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYG+TWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCK+FYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKI PPSIIDIVVIPLLDVNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCL+NTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLE+NMKSLKEIKKYFPI YDIIISNFSEKLSRLKYYVYN NIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNI LIKDKLFYRNEELRNINLKFI QKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVT GAIQSRR+ESVNLLIKIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQI SRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNIST NRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTFQQIKIKQEFQKAKLRNLKIDTKVVVNKSNYFKLKSASN+KISERFQSLLNKSHNLNDKIKASHYKLKLNKKLI+DKELKLQ LSKDIDEKLSRLLVLQDKIYSKSEFHAQCLP
Sbjct:    1 MTLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGKTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKEFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKIPPPSIIDIVVIPLLDVNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLYNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEKNMKSLKEIKKYFPIAYDIIISNFSEKLSRLKYYVYN-NIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNIILIKDKLFYRNEELRNINLKFISQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTSGAIQSRRLESVNLLIKIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQIISRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTFNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTFQQIKIKQEFQKAKLRNLKIDTKVVVNKSNYFKLKSASNAKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLILDKELKLQFLSKDIDEKLSRLLVLQDKIYSKSEFHAQCLP 1688          
BLAST of Netrin-4 vs. Planmine SMEST
Match: SMESG000019909.1 (SMESG000019909.1)

HSP 1 Score: 382.489 bits (981), Expect = 2.397e-108
Identity = 434/1688 (25.71%), Postives = 716/1688 (42.42%), Query Frame = 3
Query:  123 DNVCRKTICNPRAGDLL-IGRESFLRASSTCGLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLPQDPFRWWQSMSGVHN--------VSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDFPSIPERKRSNI---NEVLCTSEFSSIIPSEGGTVLFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGT--LENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCK--NGFAGIRCDEIKSEWYIEKPTYPLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFD---------------------SFIIVLSIYHVGKSSCQSYQDTMQLIKDSRYIVIP-----NKCLEKDLPIVLTVFTIESNNKXXXXXXXXXXXXXXXXNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARG-----CKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP------FCHSCKCNQMSTTCD--SKTGK----CLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISK-DGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFP----KEIDDVCTSL------EQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIIT--------IENSTDYAKAMI------SKNKIRDVTGAFNELKKSLKNILNGASE--SKKIYQNITLIKDKLFYRNEELRNINLKF------IRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPD-KCYRHAPMNKYCM-----GKSNQFFNLYASLLLDRTNMSIILKEFN------QQFNISIN-SKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYLNGSADLKDF-----ESLI--ENINKFEINFKENEIIALDKQIRSRIRKLNNVNNILD---------KSKFNRKQCDVFKKSAVRAKEDTSY------LLNSIKNISTLNRMTQKF-EIIMKQF---VMNFANALFSLKGNLFHMFKNENEAFQK-----QNNISYVTERIKFLKL---YIMKIHK 4769
            D+  +  IC P   +    GR+    A++TCG+   ++YC+  +S   R S+C  CD  N  +R S               Q+P  WWQS +   N        +++ I    +F  TF HL+FK+ RP+AM + +  D    W  + YF+ +C  +F +IP  K   +   +EVLCT +FSS+     G V+F+       +++ + N+K  D    + IR++  ++HTFG+   +D   +   Y+YAI    I GRC C GH ++C+   G+  ++  +Y VC   H+T GQ CEKC +FY D PW  A  ++ N C++C CN +S SC F+  +Y +S  +SGG+C NC+ NT+  +CE C  G+Y+N     +    C+ C+CD +G   P    Q          G C C+  +EG++C +CK  ++ F  N   GC  CNC + G    E   C+ STG CYCK  V G  C  C  G+F L+ ++  GC  C C  +     K C    G  L +  + F G   D  K       PT+    + +I  + P ++      F+   D ++  FF                      SF I   I  +  S   S  + +QLI D+  + +P     N     D   VL  F +   + +    +D      +  N    +  L     Y  L           +++  T   S  +K   N++     +  K    C C P  +G +CE CA   +   ++G     C KC C+   + +  C   TG C C+    G +CD C  GY+  P       C  C C    T C+    +GK    C +C  N  GY C  C + ++G+    I CK C+C G     ++   C  I   T     C    +G  C+ C+  +F  +  +    C+ C C+ +        C+  TG C  C     G  C+ C  GYF       C  C C  +G+    +  C+  TG+C C P V GL+CDRC+ + FNLSS  GC  C CD P G+ N  C+  TG C C+    G  CN C +      T+  GC KC         +       + R    +   N       +D    N +   +     +     +   F + ++    F   +K      KE++   T+       E+   SL +I+        ++  +F   L  LK Y+ +       ++ N II+         E ST+  K++I      S+  + +   +F +L    +N +N +S+   K++      I+D+ F    E+  +N  F      I   SK  +N+I E+++ +++F     NT+++    +  +F   V   PD K       NK  M         +   +   L   + N++  +K  N      + FN  +N SK   + ++K     NTT++ I +    +     +++N LI ++         KD+     ES+I  +NI KF      N+++ L K+ +  +  L+ +  + D         + K N     + +  ++  K D S       L++ I  I+++   T+   E  +K F   + N +N + +   N F++     E   +     QN   +  + I  L+L   ++++I+K
Sbjct:   37 DSSGQPQICYPPFQNFASAGRKVI--ATNTCGIRGRQKYCIGLSSAEMR-SRCAYCDKNNVNERHSPDF---------LTDQNPNNWWQSETWADNRELFNRESINLTIDLGKQFHVTFLHLQFKSPRPSAMVLYKKYDNNSPWQPWQYFASDC-LNFFNIPYVKGYIVKRHDEVLCTEDFSSLNEFYNGIVMFATIYGRPGSDNFFANQKLMDWATASQIRIELRKMHTFGEQ--NDEEELLMTYFYAIKNLQIAGRCWCNGHGNECRKSTGE-GLEPQLYCVCHPSHHTVGQSCEKCDNFYQDRPWKAASTSNANTCQRCNCNGNSESCIFNDELYIKSGNISGGLCLNCKGNTKGPHCEECTEGFYKN----PDQPNRCIPCNCDPIGRVSPQCNSQ----------GVCTCQPGIEGDKCTRCKRDYFNFGSN---GCQPCNCHLPGVNITERLHCNPSTGTCYCKKNVQGEKCDGCVAGFFGLTESDPLGCRPCFCFAH----TKDCTMAKGFLLTRIESDFIGT-VDSWKYGIGSLAPTF--NPMLDITTSPPSITW-----FIGRDDWRDDYFFSAPKKFLGNRRLSYNLNLKLTLSFGIRPDISTLN-SKWMSMINDVQLISDTLAVSVPFDIGSNTVPNVDKNTVLYTFRLNEESGLWRDKMDYFRFNSILSNLEAIKIRLTNPSGYVRL----------HKVALETALDSQLVK-SLNLSLPAAESVEK----CLCPPQYTGLSCENCAPGYHREYSKGSEFIKCIKCSCN---NQSDTCDVQTGVCHCKYNSIGDNCDKCAIGYYGDPTSNLRNVCKPCGC-PGGTACELIRISGKDRIVCTDCPNNLGGYRCDRCRDNFFGNPKLNITCKPCECNGNVDYFSS---CDTI---TGKCPKCIYNSAGDNCETCKPGYFLLSNERAPNRCKRCICNPHGSLTGGVLCDINTGNCF-CKKLVIGQKCDSCKPGYFNLTVNEQCQPCNCLPIGS---IKENCHQTTGQCKCKPGVTGLRCDRCEFEHFNLSS-TGCQKCMCD-PYGSSNLQCHWKTGMCSCKTNVLGNKCNQCMENHHNLTTE--GCQKCPPCYGLIQKRISTLKADIARLSDSVYSVNM------SDSTFGNMTESLNIARNHNETFAKLFQNFIQNYDKIEKFAIELKIVENSLKELETNLTNFKNDKMNERVQASLNDIQNMENAIKGLLNKDFQRYLDLLKDYIKSK------SENNQIISKVAEEAKEYEISTNQQKSIINNIYTESEKHLANSLTSFVDLIGRYRNYVNESSQFDIKELSALSKKIQDESFKNLMEISVLNKSFEKFENSINNASKIHENIIKEINEVILSFLDAE-NTVSQ----LDWKFRQLVINLPDLKLLEEQIKNKTYMISLKTRNVTEAQEIMMKLKEAQNNLTDAIKMANKTLFKLEDFNEVVNKSKFEAEEHIKILPYLNTTLQEIILEIQHLNDSVSDTINSLISVQ---------KDYQVIYNESMIKDKNIKKF-----NNQVLQLLKENKENMNVLDKIKTLSDEKLNHHLIVQDKLNELMRSLNETKSLSEKHDDSVTGLNASLVDIINRINSIQNETESMDERTLKFFSERIDNLSNVIENYYQNEFNIISKSMEDMDREWQELQNESEFTNKEINRLQLIDDHMVQINK 1614          

HSP 2 Score: 222.246 bits (565), Expect = 6.961e-58
Identity = 241/921 (26.17%), Postives = 399/921 (43.32%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYW-------NFPFCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI--LCKKCQCPGLSSLKNNSIGCSLI--FNTTAFTCM-CKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYF---GNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDG-KMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSS-GVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNSIITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAIQSRRIESVNLLIKIKTYLNGSADLKDFESLIENINKFEINF--KENEIIALDKQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKNISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNISYVTERIKFLKLYIMKIHKVFSNTXXXXXXXXXXXXXXLRNLKIDTKVVVNKSNYFKLKSASNSKISERFQSLLNKSH---NLNDKIKASHYKLKLNKKLIVDKELKLQSLSKDIDEKLS 5063
            KCLC     G  C+ C PGY         F  C  C CN  S TCD +TG C +CK NS G NC  C  GYYGD +  +  +CK C CPG          C LI         C  C     G  CD+C  N FGN    + TC+PC C+GN+D     SC++ TG+C KC++N++G NCE C  GYF      A   C +C+CN  G+ +    +C+  TG C C   V+G +CD C+  +FNL+    C PCNC  PIG++  +C+Q TGQC C+ G +G  C+ C+  F        GC KC C+  GS   QC+   G+C CK  + G  C+ CM+         C  C  C+      +  +K    +L +S   V MS+  F             NM     I +     +  +  NF +   +++ +      I+    +NS+  +E +    K      +++        ++ ++K +LN     K   + + L+KD +  ++E   N  +  + +++K+ +   N+  K++I       N  TES   + +     V                 +G+   + N   S   D   +S +             SK+I+D   K          L+++   ++ ++  E      K +  +N ++  K  E++I+ IN+  ++F   EN +  LD + R  +  L ++  + ++ K       +  ++   A+E    L  +  N++   +M  K               LF L+     + K++ EA +    + Y+   ++ + L I  ++   S+T              L +++ D +V+ N+S    +K  +  K + +   LL ++    N+ DKIK    + KLN  LIV    KL  L + ++E  S
Sbjct:  718 KCLCPPQYTGLSCENCAPGYHREYSKGSEFIKCIKCSCNNQSDTCDVQTGVC-HCKYNSIGDNCDKCAIGYYGDPTSNLRNVCKPCGCPG-------GTACELIRISGKDRIVCTDCPNNLGGYRCDRCRDNFFGNP-KLNITCKPCECNGNVDYF--SSCDTITGKCPKCIYNSAGDNCETCKPGYFLLSNERAPNRCKRCICNPHGSLTGGV-LCDINTGNCFCKKLVIGQKCDSCKPGYFNLTVNEQCQPCNC-LPIGSIKENCHQTTGQCKCKPGVTGLRCDRCE--FEHFNLSSTGCQKCMCDPYGSSNLQCHWKTGMCSCKTNVLGNKCNQCMENHHNLTTEGCQKCPPCYGLIQKRISTLKADIARLSDSVYSVNMSDSTF------------GNMTESLNIARNHNETFAKLFQNFIQNYDKIEKFA-----IELKIVENSLKELETNLTNFKNDKMNERVQASLNDIQNMENAIKGLLN-----KDFQRYLDLLKDYIKSKSE--NNQIISKVAEEAKEYEISTNQ-QKSIIN------NIYTESEKHLANSLTSFVD---------------LIGRYRNYVN--ESSQFDIKELSAL-------------SKKIQDESFK---------NLMEI---SVLNKSFE------KFENSINNAS--KIHENIIKEINEVILSFLDAENTVSQLDWKFRQLVINLPDLKLLEEQIKNKTYMISLKTRNVTEAQEIMMKLKEAQNNLTDAIKMANK--------------TLFKLEDFNEVVNKSKFEAEEHIKILPYLNTTLQEIILEIQHLNDSVSDT-----------INSLISVQKDYQVIYNES---MIKDKNIKKFNNQVLQLLKENKENMNVLDKIKTLSDE-KLNHHLIVQD--KLNELMRSLNETKS 1511          
BLAST of Netrin-4 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 177.563 bits (449), Expect = 1.276e-45
Identity = 129/432 (29.86%), Postives = 210/432 (48.61%), Query Frame = 3
Query:  198 ASSTCGLTNSERYCV----VTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSR-LPQDPFRWW----QSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKDYGRTWNKYAYFSDNCPRDF--PSIPERKR----SNINEVLCTS-----------------EFSSIIPSEGGTVLFSADTSDWVN-NDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNIRNK-----YYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGF 1379
             +STCG    E+ C      TT+++  +  C+ICD+K+         S+   ++  R +P++   W+    Q   G + V+I +S +  F+  +  L+     P ++ I +S D+G +W  + +FS +C R F  P+  E+      +NI+EVLC                    FS+I     G   +S D  +W+   D+  +  R      T  R++ +  HT  +      PN+ N       ++ +S+  + GRC C GHA++C   +   ++K      CDC HNT+GQ CE+CK  Y D PW  A + + N C+ C+C +HS  C F   +Y+Q+R   GGVC  C+HNTE   C+ C + +YR+I   +   Q C  C C ++G+      I++ E D     G C C++ V G  CD+CK G+
Sbjct:   54 TTSTCGTNGPEQICRNWYDKTTAEA--RQYCSICDAKH--------RSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTLPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPTTNEQNSQITPANIHEVLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPP-WSQDLVEWMTMTDLRISLMRFTPEKSTPYRLKELYYHT--ESLPQAPPNLVNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDDND-EIK------CDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGS------IKQNECD--KKTGQCYCRDGVTGQTCDRCKDGY 457          

HSP 2 Score: 60.8474 bits (146), Expect = 7.737e-9
Identity = 52/188 (27.66%), Postives = 77/188 (40.96%), Query Frame = 3
Query: 2355 NDTGKCLCREGVEGQHCDTCKPGYWNFPF----------CHSCKCNQMSTTC-----------DSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGI----LCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKC 2843
            ND  KC C    EGQ C+ CK  Y + P+          C  C+C   S  C               G CL CK N+ G+ C  C   +Y D ++ +     C  C+C  + S+K N        +     C C+ G +GQ CD+C+  +       + T +PC  S      + D  N+ +  C+KC
Sbjct:  314 NDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGSIKQNEC------DKKTGQCYCRDGVTGQTCDRCKDGY----KQSNSTVRPCIPSSG----MADMANT-SPVCKKC 486          

HSP 3 Score: 55.4546 bits (132), Expect = 3.722e-7
Identity = 55/181 (30.39%), Postives = 77/181 (42.54%), Query Frame = 3
Query: 2727 HFGNAISKDGTCQPCRCSGN-----IDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVR-------TCTKCVC-NH----MGTNSKWQGICNHETGKC-PCLPNVVGLQCDRC-----QDKFFNLSSQIGCLPCNCDYPIGALNH-SCNQLTGQCYCQAGRSGKMCNNCKDGF 3197
            HFG  +S       C+C+G+     ID   E  C+        C  NT G  CE+C S Y      R        C  C C NH    M +   ++       G C  C  N  G  CD C     +D    ++    C  C C + IG++    C++ TGQCYC+ G +G+ C+ CKDG+
Sbjct:  288 HFG--LSDLAVGGRCKCNGHANRCLIDDNDEIKCD--------CHHNTEGQECERCKSNYLDRPWQRATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKC-HTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGY 457          

HSP 4 Score: 55.0694 bits (131), Expect = 5.648e-7
Identity = 32/78 (41.03%), Postives = 41/78 (52.56%), Query Frame = 3
Query: 2217 GGQC-QCLPNVSGKTCERCASESYG------FDARGCKKCKCDLTGSL-NSQCYNDTGKCLCREGVEGQHCDTCKPGY 2426
            GG C +C  N  G  C+ CA+  Y          + C  CKC   GS+  ++C   TG+C CR+GV GQ CD CK GY
Sbjct:  380 GGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGY 457          

HSP 5 Score: 54.6842 bits (130), Expect = 6.927e-7
Identity = 46/172 (26.74%), Postives = 72/172 (41.86%), Query Frame = 3
Query: 2889 YFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIG-------CLPCNC-------DYPIGALNHSCNQLTGQCY-CQAGRSGKMCNNCKDGFWGDPTKL----NGCTKCYCNLDGSVFK-QCNRNNGVCRCKPGITGRNCDMCMKG 3344
            +FG   +    +C CN          I +++  KC C  N  G +C+RC+  + +   Q         C  C C        + +G    +  Q  G C  C+    G  C+ C    + D TK       CT C C+  GS+ + +C++  G C C+ G+TG+ CD C  G
Sbjct:  288 HFGLSDLAVGGRCKCNGHANRCL---IDDNDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDG 456          
BLAST of Netrin-4 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 180.644 bits (457), Expect = 5.275e-45
Identity = 150/458 (32.75%), Postives = 205/458 (44.76%), Query Frame = 3
Query: 2193 RNNNCNKIGGQCQ-CLPNVSGKTCERCASESYGFDARG-----CKKCKC--------DLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP----FCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRI--EDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWG-------------------------------------------DPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSC 3377
             +N C+ + G+CQ C  N +G  CE CAS  YG DA+      CKKC C        +L  S +S+ Y    KCL      G HCD C  GY+  P     C  CKCN    +CD  TG+C  C  N+ G  CQ C++G+YGD      CKKC C  L S   N        +     C C+  +  + CD C +  +     KD  C PC C   I  RI  E  CN+ +G+C  CL + +G  CEKCV GYF       C KC+C+    ++     C+   GKC C  NV+   CD+C++  +  +++  C+PCNC    G+LN  C+  TG C C    + + C+ C  G++G                                           D  +  GC KC C ++GS    CN+ +G+C CK    G  CD C +G  G  PNC  C
Sbjct:  397 HSNTCDSLNGECQNCTHNTAGAHCEDCASGYYG-DAKSKNLNFCKKCPCPRLDYQMTELCSSYSSENY-VCHKCL--HNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS-CKKCDCDSLGSTSENC-------DKLTGECDCRTNFVNRQCDSCTSGLY----LKDKKCIPCNCE--IQGRISSEKFCNTTSGQCF-CLESVNGDRCEKCVEGYFN---YPNCKKCLCSPHALSAD----CDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR--GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYG-FPNCQPC 823          

HSP 2 Score: 176.407 bits (446), Expect = 9.056e-44
Identity = 118/334 (35.33%), Postives = 174/334 (52.10%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYW---NFPF---CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCM-CKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHS--CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMC 3335
            KC C  G  G  C++C+ GY    N  +   C +C C   S TCDS  G+C NC  N+ G +C++C +GYYGD     L  CKKC CP L         CS  +++  + C  C    SG  CD+C   ++GN   K  +C+ C+C+ N     ++SC+  TGECR C +NT G  C+ C  G++G+   ++C KC C+ +G+ S+    C+  TG+C C  N V  QCD C    +    +  C+PCNC+   G ++    CN  +GQC+C    +G  C  C +G++  P     C KC C+   ++   C+ NNG C+C   +  R CD C
Sbjct:  358 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPRLDYQMTEL--CS-SYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP-KKKISCKRCKCNNN-----QESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSEN---CDKLTGECDCRTNFVNRQCDSCTSGLYLKDKK--CIPCNCEIQ-GRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYP----NCKKCLCS-PHALSADCDLNNGKCKCGSNVINRICDKC 670          

HSP 3 Score: 166.392 bits (420), Expect = 9.601e-41
Identity = 134/406 (33.00%), Postives = 199/406 (49.01%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDA--RGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPG-YWNFPFCHSCKCN---QMSTT--CDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCS-GNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGS---VFKQCNRNNGVCRCKPGITGRNCDMCMKGT 3347
            +CKCN   +   +C+ + G+C+C  N  G  C+ C    YG DA  + CKKC CD  GS +  C   TG+C CR     + CD+C  G Y     C  C C    ++S+   C++ +G+C  C  +  G  C+ C  GY+   +    CKKC C    S    S  C L        C C      + CD+CE  H+ N  +    C PC C  G+++ +    C+ +TG C KC  N +  +C KC  GYFG   V  C KC   + G       +CN+E G C C PN +G  C++C +  ++ +  IGC  CNC Y  G+ ++ CN+++G C C+    G  C+ C +G++G P     C  C C  +G+      +C++  G C+CK  + G  C +C KGT
Sbjct:  496 RCKCN---NNQESCDPVTGECRCSYNTMGTECQLCKHGFYG-DALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLESVNGDRCEKCVEGYFNYPN----CKKCLC----SPHALSADCDL----NNGKCKCGSNVINRICDKCENLHYWNNRTD---CVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFG-LDVTGCKKCPPCYNGQ------VCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNC-YINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGT 863          

HSP 4 Score: 146.747 bits (369), Expect = 8.963e-35
Identity = 117/366 (31.97%), Postives = 168/366 (45.90%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQ--CYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKC--NQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNH--SCNQLTGQCYCQAGRSGKMCNNCKDG-FWGDPTKLNGCTKCYC 3242
            KC C+  GS + NC+K+ G+C C  N   + C+ C S  Y  D + C  C C++ G ++S+  C   +G+C C E V G  C+ C  GY+N+P C  C C  + +S  CD   GKC  C  N     C  CEN +Y +      C  C C G  SL   +  C +        C C +  + + C +C+  +FG  ++    C PC  +G +       CN++ G C  C  NT G  C KC    +       C KC C     N  +  ICN  +G C C     G +CDRC + ++   +   C PC+C       N    C+++TGQC C+    G  C  C+ G F  D T   GC  C+C
Sbjct:  542 KCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKK-CIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWNNRTD--CVPCNC-GRGSL---NPKCDM----ETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY-NGQV-------CNNE-GICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCY---INGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN---CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 879          

HSP 5 Score: 98.9821 bits (245), Expect = 2.887e-20
Identity = 88/322 (27.33%), Postives = 130/322 (40.37%), Query Frame = 3
Query:  861 CSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAIN------------------------------------------SSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLEN-RGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            C+CY H++ C +  G+ Q         +C HNT G HCE C   +Y D     A   + N C+KC C        +       S      VC  C HNT   +C+RC  GYY N    I+                                           +++C KC CDSLG+   + C +          G C C+ N    QCD C  G +     ++  C+ CNC + G + + + C++++G+C+C   V G+ C  C  GYFN  N     C  C CS +    +  CD  +GKC C +      CD+ ++  Y
Sbjct:  392 CACYNHSNTCDSLNGECQ---------NCTHNTAGAHCEDCASGYYGD-----AKSKNLNFCKKCPC----PRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSEN-CDKL--------TGECDCRTNFVNRQCDSCTSGLYL----KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPN-----CKKCLCSPHALSAD--CDLNNGKCKCGSNVINRICDKCENLHY 675          

HSP 6 Score: 97.0561 bits (240), Expect = 1.358e-19
Identity = 139/593 (23.44%), Postives = 242/593 (40.81%), Query Frame = 3
Query: 2820 KTGECRKCLFN--TSGFNCEKCVSGYFG----------NGAVRTCTKCVCNHMGTN-SKWQGICNHETGKCP-CLPNVVGLQCDRCQDKFF-NLSSQIGCLPCNCDYPIGALNHSCN------QLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSC-----GDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYN--SNIIDFNTQQNSIITIENST---------DYAKAMISKNKIRDVTGAFNELK---KSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNI---NLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTIT------ESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI--DVTRGAIQSRRIESVNLLIKIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLN 4445
            +     KC+ N  T G +C+  +SGY+           +G++RT  + + N    N + +  +C+  TG C  C+ N  G +C  C++ F+ N  +   C PC C  P    N + N       L  +C C+ G SGK C NC+ GF+G+P K   C  C CN  GS    CN   G+C+C PG+ G  CD C      +   C SC      D  ++ D     V N   K   S+            ++ +  S++ + + L  I K++ +  +  I NFS +  ++K         I    T+ N I+    ST          + +  IS   I++ T     +K   K + NI   AS  K + + +  +   + Y    +++    NLK ++ K+         M+  + T N    NT++      E   ++ +E    +     K +R     +  + K  Q  +  +    D  ++            ISIN +EI+D      S +  +  LI  D  +  ++ +  +S NL+ K+    N   + +  +    NI +        +I+A+D  I    ++L+
Sbjct: 1095 RVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPST--------LDLRLNKINISIQMSSELLNSINKFYKLKNE--IKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKILEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTI--------MADEINTNNKEYLNTMSTKKKEHELYIILINERMKDL----QKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDL------------ISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITR--------DILAVDYAINQTKKELD 1642          

HSP 7 Score: 91.2781 bits (225), Expect = 6.290e-18
Identity = 73/248 (29.44%), Postives = 106/248 (42.74%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKT--CDKYSGKCLCKNGFAGIRC 1670
            G C C  N   + C+KC++ +    W     N+  +C  C C   S +   D         M  G C  C  N   ++C +C  GY+    + +   + C  C+   +                  N G C+C  N  GN C+KC    W FN  E  GC KCNC + G+  N  C+  +G C CK+   G+ C  C  GY+   N     C  C C+E G++ N+   CDK +G+C CK    G +C
Sbjct:  654 GKCKCGSNVINRICDKCENLHY---W-----NNRTDCVPCNCGRGSLNPKCD---------METGNC-KCAQNVARRDCSKCDVGYF---GLDVTGCKKCPPCYNGQVCN----------------NEGICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCYINGSYSNI-CNKISGICACKTAFFGSKCDRCNEGYYGFPN-----CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKC 856          

HSP 8 Score: 90.8929 bits (224), Expect = 9.823e-18
Identity = 76/268 (28.36%), Postives = 113/268 (42.16%), Query Frame = 3
Query:  900 EGQVQVKEMVY-GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIE 1700
            E  + + EM +   C+C     G  CE C+  Y        +     +C  C C +HS++C  D +          G C NC HNT   +CE C SGYY +      +   C KC C  L  +   +C      +   +     C  N  G  CD+C  G++  N  ++  C +C C          CD  TG+C C     G +C  CK G++   +A    C  C C   GS  ++ CDK +G+C C+  F   +CD   S  Y++
Sbjct:  345 EVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRV----NNVLYQGQCEACACYNHSNTC--DSL---------NGECQNCTHNTAGAHCEDCASGYYGD--AKSKNLNFCKKCPCPRLDYQMTELCSSYSSENYVCHK----CLHNTSGVHCDRCIEGYYG-NPKKKISCKRCKC----NNNQESCDPVTGECRCSYNTMGTECQLCKHGFY--GDALTKSCKKCDCDSLGST-SENCDKLTGECDCRTNFVNRQCDSCTSGLYLK 583          

HSP 9 Score: 86.2705 bits (212), Expect = 2.081e-16
Identity = 66/207 (31.88%), Postives = 90/207 (43.48%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNFPF--------------------CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKC 2927
            KC+C     G HC     GY+   F                       C CN  S  CDS TG C NC GN  G  CQ C  G+Y +      C+ CQCP  S+  N +  C+ I ++    C C+ GYSG+ C+ C+   +GN I K   C+ C C+    Q +  +CN + G C+ C     G  C++C   Y      +TC  C
Sbjct: 1101 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCP--SAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPI-KGIPCKSCDCNQQGSQSL--NCN-EFGICQ-CSPGVLGIKCDQCAPNYVVEK--KTCQSC 1298          

HSP 10 Score: 85.5001 bits (210), Expect = 4.473e-16
Identity = 52/140 (37.14%), Postives = 69/140 (49.29%), Query Frame = 3
Query: 2220 GQCQCLPNVSGKTCERCASESYGF-DARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMS------TTCDSKTGKCLNCKGNSFGYNCQNCENGYY-GDTSRGILCKKCQCPGLS 2615
            G C C PN  G  C +C+ +S+ F +  GCKKC C + GS ++ C   +G C C+    G  CD C  GY+ FP C  C C +        T CD  TG+C  CK N  G  C+ C  G +  D +    C  C C G+S
Sbjct:  745 GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQC-QCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVS 883          

HSP 11 Score: 84.3445 bits (207), Expect = 8.620e-16
Identity = 68/217 (31.34%), Postives = 90/217 (41.47%), Query Frame = 3
Query: 2151 KSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCK-CN-----QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSG 2783
            ++D + C C   GS N  C+   G C+C  NV+ + C +C    +G D  GCKKC        N Q  N+ G C+C     G  C+ C    W+F     CK CN       S  C+  +G C  CK   FG  C  C  GYYG  +    C+ C C    +  N    C  I       C CK+   G  C  C    F +  + +G C  C C G
Sbjct:  679 RTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC----PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICA-CKTAFFGSKCDRCNEGYYGFPN----CQPCSCAENGTKSNELTKCDKI----TGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFG 881          

HSP 12 Score: 83.1889 bits (204), Expect = 2.138e-15
Identity = 96/340 (28.24%), Postives = 129/340 (37.94%), Query Frame = 3
Query:  927 VYGVCDCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGT---------------------------------KFPS--ICIQEPEL---DLGLNAGHCICKENVEGNQCDKCK-IGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLC---------------------------KCSEYGSRDNKT-----------------CDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            V G C C +NT G  C+ CK  FY D+         T  C+KC+C+S  S+        +   K++G  CD C+ N  ++ C+ C SG Y          + C+ C+C+  G                                   +P+   C+  P     D  LN G C C  NV    CDKC+ + +W    N  T C+ CNC   G+L N  CD  TG C C   V   DCS C +GYF L   ++ GC  C                           KCSE     N+T                 C+K SG C CK  F G +CD     +Y
Sbjct:  509 VTGECRCSYNTMGTECQLCKHGFYGDA--------LTKSCKKCDCDSLGSTS-------ENCDKLTGE-CD-CRTNFVNRQCDSCTSGLYL-------KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYW----NNRTDCVPCNC-GRGSL-NPKCDMETGNCKCAQNVARRDCSKCDVGYFGL---DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY 815          

HSP 13 Score: 73.9442 bits (180), Expect = 1.192e-12
Identity = 53/139 (38.13%), Postives = 66/139 (47.48%), Query Frame = 3
Query: 1173 RCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLG-LNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGND-CSTCKIGYFNLSNANINGCSLCKC 1583
            +C  G+YR   V       C  C C  LGT     C+   E D+G    G CICK+  EG  CD C IG+ ++   E   CL C C + G++           C CK  V  +D C TCK GYFNL +AN  GC  C C
Sbjct:   28 KCIKGFYRPWNVLATELYPCTPCQCHGLGT--IGSCVSNGE-DIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGE---CLPCPCSIDGSVRT-SFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 159          

HSP 14 Score: 58.5362 bits (140), Expect = 6.213e-8
Identity = 65/228 (28.51%), Postives = 88/228 (38.60%), Query Frame = 3
Query:  921 EMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDN-----CQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENR--GCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKC 1583
            +M  G C C  N   + C KC     D  +   D      C+KC            P  Y      +G VC+N     C  NT    C +C    +       N +  C KC+C   G+ + +IC +         +G C CK    G++CD+C  G++ F       C  C+C   GT  N    CD  TG+C CK  V G  C  C+ G F        GC  C C
Sbjct:  697 DMETGNCKCAQNVARRDCSKC-----DVGYFGLD---VTGCKKC------------PPCY------NGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGS-YSNICNKI--------SGICACKTAFFGSKCDRCNEGYYGF-----PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 879          

HSP 15 Score: 55.8398 bits (133), Expect = 3.599e-7
Identity = 65/230 (28.26%), Postives = 89/230 (38.70%), Query Frame = 3
Query:  891 KAKEGQVQVKEMVYGV--CDCQHNTKGQHCE-KCKDFYNDSPWLPADKNSTN---------ECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQ-EPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETG--CLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGY 1535
            K  E    + + V  V  C C   T G HC+     +Y +   LP    S +           +KC CN +S  C  D V          G C NC  N E   C+ C+ G+Y+N      +   C  C C S    F   C + E  L+L      C C+    G  C+ C+ GF+   GN   G  C  C+C   G+ ++  C+   G C C   V G  C  C   Y
Sbjct: 1084 KVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC--DSVT---------GDCQNCMGNREGNKCQLCREGFYKNDK----NYDQCEPCQCPSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFY---GNPIKGIPCKSCDCNQQGS-QSLNCN-EFGICQCSPGVLGIKCDQCAPNY 1288          

HSP 16 Score: 54.6842 bits (130), Expect = 9.622e-7
Identity = 34/81 (41.98%), Postives = 41/81 (50.62%), Query Frame = 3
Query: 2202 NCNKIGG----QCQCLPNVSGKTCERCASESYGFDARG--CKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGY 2426
            NC +I      +CQC    SGK+CE C    YG   +G  CK C C+  GS +  C N+ G C C  GV G  CD C P Y
Sbjct: 1209 NCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNC-NEFGICQCSPGVLGIKCDQCAPNY 1288          

HSP 17 Score: 53.1434 bits (126), Expect = 2.798e-6
Identity = 41/131 (31.30%), Postives = 63/131 (48.09%), Query Frame = 3
Query: 1329 CKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGC----DSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPT 1709
            C  N EGN+C  C+ GF+K + N +  C  C C        + C     S   KC C+   +G  C  C+ G++      I  C  C C++ GS+ +  C+++ G C C  G  GI+CD+    + +EK T
Sbjct: 1168 CMGNREGNKCQLCREGFYKNDKNYDQ-CEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGI-PCKSCDCNQQGSQ-SLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKT 1294          
BLAST of Netrin-4 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 180.259 bits (456), Expect = 6.219e-45
Identity = 150/458 (32.75%), Postives = 205/458 (44.76%), Query Frame = 3
Query: 2193 RNNNCNKIGGQCQ-CLPNVSGKTCERCASESYGFDARG-----CKKCKC--------DLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFP----FCHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRI--EDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWG-------------------------------------------DPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSC 3377
             +N C+ + G+CQ C  N +G  CE CAS  YG DA+      CKKC C        +L  S +S+ Y    KCL      G HCD C  GY+  P     C  CKCN    +CD  TG+C  C  N+ G  CQ C++G+YGD      CKKC C  L S   N        +     C C+  +  + CD C +  +     KD  C PC C   I  RI  E  CN+ +G+C  CL + +G  CEKCV GYF       C KC+C+    ++     C+   GKC C  NV+   CD+C++  +  +++  C+PCNC    G+LN  C+  TG C C    + + C+ C  G++G                                           D  +  GC KC C ++GS    CN+ +G+C CK    G  CD C +G  G  PNC  C
Sbjct:  379 HSNTCDSLNGECQNCTHNTAGAHCEDCASGYYG-DAKSKNLNFCKKCPCPRLDYQMTELCSSYSSENY-VCHKCL--HNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS-CKKCDCDSLGSTSENC-------DKLTGECDCRTNFVNRQCDSCTSGLY----LKDKKCIPCNCE--IQGRISSEKFCNTTSGQCF-CLESVNGDRCEKCVEGYFN---YPNCKKCLCSPHALSAD----CDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR--GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYG-FPNCQPC 805          

HSP 2 Score: 176.407 bits (446), Expect = 9.897e-44
Identity = 118/334 (35.33%), Postives = 174/334 (52.10%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYW---NFPF---CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGIL--CKKCQCPGLSSLKNNSIGCSLIFNTTAFTCM-CKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHS--CNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMC 3335
            KC C  G  G  C++C+ GY    N  +   C +C C   S TCDS  G+C NC  N+ G +C++C +GYYGD     L  CKKC CP L         CS  +++  + C  C    SG  CD+C   ++GN   K  +C+ C+C+ N     ++SC+  TGECR C +NT G  C+ C  G++G+   ++C KC C+ +G+ S+    C+  TG+C C  N V  QCD C    +    +  C+PCNC+   G ++    CN  +GQC+C    +G  C  C +G++  P     C KC C+   ++   C+ NNG C+C   +  R CD C
Sbjct:  340 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPRLDYQMTEL--CS-SYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP-KKKISCKRCKCNNN-----QESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSEN---CDKLTGECDCRTNFVNRQCDSCTSGLYLKDKK--CIPCNCEIQ-GRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYP----NCKKCLCS-PHALSADCDLNNGKCKCGSNVINRICDKC 652          

HSP 3 Score: 166.392 bits (420), Expect = 1.171e-40
Identity = 134/406 (33.00%), Postives = 199/406 (49.01%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDA--RGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPG-YWNFPFCHSCKCN---QMSTT--CDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCS-GNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGS---VFKQCNRNNGVCRCKPGITGRNCDMCMKGT 3347
            +CKCN   +   +C+ + G+C+C  N  G  C+ C    YG DA  + CKKC CD  GS +  C   TG+C CR     + CD+C  G Y     C  C C    ++S+   C++ +G+C  C  +  G  C+ C  GY+   +    CKKC C    S    S  C L        C C      + CD+CE  H+ N  +    C PC C  G+++ +    C+ +TG C KC  N +  +C KC  GYFG   V  C KC   + G       +CN+E G C C PN +G  C++C +  ++ +  IGC  CNC Y  G+ ++ CN+++G C C+    G  C+ C +G++G P     C  C C  +G+      +C++  G C+CK  + G  C +C KGT
Sbjct:  478 RCKCN---NNQESCDPVTGECRCSYNTMGTECQLCKHGFYG-DALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLESVNGDRCEKCVEGYFNYPN----CKKCLC----SPHALSADCDL----NNGKCKCGSNVINRICDKCENLHYWNNRTD---CVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFG-LDVTGCKKCPPCYNGQ------VCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNC-YINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGT 845          

HSP 4 Score: 146.747 bits (369), Expect = 9.640e-35
Identity = 117/366 (31.97%), Postives = 168/366 (45.90%), Query Frame = 3
Query: 2166 KCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQ--CYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKC--NQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSSQIGCLPCNCDYPIGALNH--SCNQLTGQCYCQAGRSGKMCNNCKDG-FWGDPTKLNGCTKCYC 3242
            KC C+  GS + NC+K+ G+C C  N   + C+ C S  Y  D + C  C C++ G ++S+  C   +G+C C E V G  C+ C  GY+N+P C  C C  + +S  CD   GKC  C  N     C  CEN +Y +      C  C C G  SL   +  C +        C C +  + + C +C+  +FG  ++    C PC  +G +       CN++ G C  C  NT G  C KC    +       C KC C     N  +  ICN  +G C C     G +CDRC + ++   +   C PC+C       N    C+++TGQC C+    G  C  C+ G F  D T   GC  C+C
Sbjct:  524 KCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKK-CIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWNNRTD--CVPCNC-GRGSL---NPKCDM----ETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY-NGQV-------CNNE-GICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCY---INGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN---CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 861          

HSP 5 Score: 99.3673 bits (246), Expect = 2.834e-20
Identity = 88/322 (27.33%), Postives = 130/322 (40.37%), Query Frame = 3
Query:  861 CSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAIN------------------------------------------SSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLEN-RGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            C+CY H++ C +  G+ Q         +C HNT G HCE C   +Y D     A   + N C+KC C        +       S      VC  C HNT   +C+RC  GYY N    I+                                           +++C KC CDSLG+   + C +          G C C+ N    QCD C  G +     ++  C+ CNC + G + + + C++++G+C+C   V G+ C  C  GYFN  N     C  C CS +    +  CD  +GKC C +      CD+ ++  Y
Sbjct:  374 CACYNHSNTCDSLNGECQ---------NCTHNTAGAHCEDCASGYYGD-----AKSKNLNFCKKCPC----PRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSEN-CDKL--------TGECDCRTNFVNRQCDSCTSGLYL----KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPN-----CKKCLCSPHALSAD--CDLNNGKCKCGSNVINRICDKCENLHY 657          

HSP 6 Score: 97.0561 bits (240), Expect = 1.299e-19
Identity = 139/592 (23.48%), Postives = 243/592 (41.05%), Query Frame = 3
Query: 2820 KTGECRKCLFN--TSGFNCEKCVSGYFG----------NGAVRTCTKCVCNHMGTN-SKWQGICNHETGKCP-CLPNVVGLQCDRCQDKFF-NLSSQIGCLPCNCDYPIGALNHSCN------QLTGQCYCQAGRSGKMCNNCKDGFWGDPTKLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMPNCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEID----DVCTSLEQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYN--SNIIDFNTQQNSIITIENST---------DYAKAMISKNKIRDVTGAFNELK---KSLKNILNGASESKKIYQNITLIKDKLFYRNEELRNI---NLKFIRQKSKDMDNLINEMSKNVITFNGVTCNTIT------ESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLLDRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLI--DVTRGAIQSRRIESVNLLIKIKTYLNGSADLKDFESLIENINKFEINFKENEIIALDKQIRSRIRKLN 4445
            +     KC+ N  T G +C+  +SGY+           +G++RT  + + N    N + +  +C+  TG C  C+ N  G +C  C++ F+ N  +   C PC C  P    N + N       L  +C C+ G SGK C NC+ GF+G+P K   C  C CN  GS    CN   G+C+C PG+ G  CD C      +   C S   C+      L+V  +T     N + +       P  +D     +  S++ + + L  I K++ +  +  I NFS +  ++K         I    T+ N I+    ST          + +  IS   I++ T     +K   K + NI   AS  K + + +  +   + Y    +++    NLK ++ K+         M+  + T N    NT++      E   ++ +E    +     K +R     +  + K  Q  +  +    D  ++            ISIN +EI+D      S +  +  LI  D  +  ++ +  +S NL+ K+    N   + +  +    NI +        +I+A+D  I    ++L+
Sbjct: 1077 RVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQS---CYSGCTKDLLVRIDTL----NETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNE--IKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKILEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTI--------MADEINTNNKEYLNTMSTKKKEHELYIILINERMKDL----QKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDL------------ISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITR--------DILAVDYAINQTKKELD 1624          

HSP 7 Score: 91.2781 bits (225), Expect = 6.495e-18
Identity = 73/248 (29.44%), Postives = 106/248 (42.74%), Query Frame = 3
Query:  933 GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKT--CDKYSGKCLCKNGFAGIRC 1670
            G C C  N   + C+KC++ +    W     N+  +C  C C   S +   D         M  G C  C  N   ++C +C  GY+    + +   + C  C+   +                  N G C+C  N  GN C+KC    W FN  E  GC KCNC + G+  N  C+  +G C CK+   G+ C  C  GY+   N     C  C C+E G++ N+   CDK +G+C CK    G +C
Sbjct:  636 GKCKCGSNVINRICDKCENLHY---W-----NNRTDCVPCNCGRGSLNPKCD---------METGNC-KCAQNVARRDCSKCDVGYF---GLDVTGCKKCPPCYNGQVCN----------------NEGICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCYINGSYSNI-CNKISGICACKTAFFGSKCDRCNEGYYGFPN-----CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKC 838          

HSP 8 Score: 90.8929 bits (224), Expect = 9.483e-18
Identity = 76/268 (28.36%), Postives = 113/268 (42.16%), Query Frame = 3
Query:  900 EGQVQVKEMVY-GVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIE 1700
            E  + + EM +   C+C     G  CE C+  Y     +        +C  C C +HS++C  D +          G C NC HNT   +CE C SGYY +      +   C KC C  L  +   +C      +   +     C  N  G  CD+C  G++  N  ++  C +C C          CD  TG+C C     G +C  CK G++   +A    C  C C   GS  ++ CDK +G+C C+  F   +CD   S  Y++
Sbjct:  327 EVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQ----GQCEACACYNHSNTC--DSL---------NGECQNCTHNTAGAHCEDCASGYYGD--AKSKNLNFCKKCPCPRLDYQMTELCSSYSSENYVCHK----CLHNTSGVHCDRCIEGYYG-NPKKKISCKRCKC----NNNQESCDPVTGECRCSYNTMGTECQLCKHGFY--GDALTKSCKKCDCDSLGST-SENCDKLTGECDCRTNFVNRQCDSCTSGLYLK 565          

HSP 9 Score: 86.2705 bits (212), Expect = 2.131e-16
Identity = 66/207 (31.88%), Postives = 90/207 (43.48%), Query Frame = 3
Query: 2367 KCLCREGVEGQHCDTCKPGYWNFPF--------------------CHSCKCNQMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVRTCTKC 2927
            KC+C     G HC     GY+   F                       C CN  S  CDS TG C NC GN  G  CQ C  G+Y +      C+ CQCP  S+  N +  C+ I ++    C C+ GYSG+ C+ C+   +GN I K   C+ C C+    Q +  +CN + G C+ C     G  C++C   Y      +TC  C
Sbjct: 1083 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCP--SAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPI-KGIPCKSCDCNQQGSQSL--NCN-EFGICQ-CSPGVLGIKCDQCAPNYVVEK--KTCQSC 1280          

HSP 10 Score: 85.1149 bits (209), Expect = 4.777e-16
Identity = 52/140 (37.14%), Postives = 69/140 (49.29%), Query Frame = 3
Query: 2220 GQCQCLPNVSGKTCERCASESYGF-DARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCNQMS------TTCDSKTGKCLNCKGNSFGYNCQNCENGYY-GDTSRGILCKKCQCPGLS 2615
            G C C PN  G  C +C+ +S+ F +  GCKKC C + GS ++ C   +G C C+    G  CD C  GY+ FP C  C C +        T CD  TG+C  CK N  G  C+ C  G +  D +    C  C C G+S
Sbjct:  727 GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQC-QCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVS 865          

HSP 11 Score: 84.3445 bits (207), Expect = 8.977e-16
Identity = 68/217 (31.34%), Postives = 90/217 (41.47%), Query Frame = 3
Query: 2151 KSDPIKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCK-CN-----QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGLSSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTCQPCRCSG 2783
            ++D + C C   GS N  C+   G C+C  NV+ + C +C    +G D  GCKKC        N Q  N+ G C+C     G  C+ C    W+F     CK CN       S  C+  +G C  CK   FG  C  C  GYYG  +    C+ C C    +  N    C  I       C CK+   G  C  C    F +  + +G C  C C G
Sbjct:  661 RTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC----PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICA-CKTAFFGSKCDRCNEGYYGFPN----CQPCSCAENGTKSNELTKCDKI----TGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFG 863          

HSP 12 Score: 83.1889 bits (204), Expect = 2.153e-15
Identity = 96/340 (28.24%), Postives = 129/340 (37.94%), Query Frame = 3
Query:  927 VYGVCDCQHNTKGQHCEKCKD-FYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGT---------------------------------KFPS--ICIQEPEL---DLGLNAGHCICKENVEGNQCDKCK-IGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLC---------------------------KCSEYGSRDNKT-----------------CDKYSGKCLCKNGFAGIRCDEIKSEWY 1694
            V G C C +NT G  C+ CK  FY D+         T  C+KC+C+S  S+        +   K++G  CD C+ N  ++ C+ C SG Y          + C+ C+C+  G                                   +P+   C+  P     D  LN G C C  NV    CDKC+ + +W    N  T C+ CNC   G+L N  CD  TG C C   V   DCS C +GYF L   ++ GC  C                           KCSE     N+T                 C+K SG C CK  F G +CD     +Y
Sbjct:  491 VTGECRCSYNTMGTECQLCKHGFYGDA--------LTKSCKKCDCDSLGSTS-------ENCDKLTGE-CD-CRTNFVNRQCDSCTSGLYL-------KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYW----NNRTDCVPCNC-GRGSL-NPKCDMETGNCKCAQNVARRDCSKCDVGYFGL---DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY 797          

HSP 13 Score: 73.9442 bits (180), Expect = 1.180e-12
Identity = 53/139 (38.13%), Postives = 66/139 (47.48%), Query Frame = 3
Query: 1173 RCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLG-LNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGND-CSTCKIGYFNLSNANINGCSLCKC 1583
            +C  G+YR   V       C  C C  LGT     C+   E D+G    G CICK+  EG  CD C IG+ ++   E   CL C C + G++           C CK  V  +D C TCK GYFNL +AN  GC  C C
Sbjct:   10 KCIKGFYRPWNVLATELYPCTPCQCHGLGT--IGSCVSNGE-DIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGE---CLPCPCSIDGSVRT-SFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 141          

HSP 14 Score: 58.5362 bits (140), Expect = 6.104e-8
Identity = 65/228 (28.51%), Postives = 88/228 (38.60%), Query Frame = 3
Query:  921 EMVYGVCDCQHNTKGQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDN-----CQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENR--GCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKC 1583
            +M  G C C  N   + C KC     D  +   D      C+KC            P  Y      +G VC+N     C  NT    C +C    +       N +  C KC+C   G+ + +IC +         +G C CK    G++CD+C  G++ F       C  C+C   GT  N    CD  TG+C CK  V G  C  C+ G F        GC  C C
Sbjct:  679 DMETGNCKCAQNVARRDCSKC-----DVGYFGLD---VTGCKKC------------PPCY------NGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGS-YSNICNKI--------SGICACKTAFFGSKCDRCNEGYYGF-----PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 861          

HSP 15 Score: 55.8398 bits (133), Expect = 3.596e-7
Identity = 65/230 (28.26%), Postives = 89/230 (38.70%), Query Frame = 3
Query:  891 KAKEGQVQVKEMVYGV--CDCQHNTKGQHCE-KCKDFYNDSPWLPADKNSTN---------ECRKCECNSHSSSCHFDPVVYQQSRKMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGTKFPSICIQ-EPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETG--CLKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGY 1535
            K  E    + + V  V  C C   T G HC+     +Y +   LP    S +           +KC CN +S  C  D V          G C NC  N E   C+ C+ G+Y+N      +   C  C C S    F   C + E  L+L      C C+    G  C+ C+ GF+   GN   G  C  C+C   G+ ++  C+   G C C   V G  C  C   Y
Sbjct: 1066 KVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC--DSVT---------GDCQNCMGNREGNKCQLCREGFYKNDK----NYDQCEPCQCPSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFY---GNPIKGIPCKSCDCNQQGS-QSLNCN-EFGICQCSPGVLGIKCDQCAPNY 1270          

HSP 16 Score: 54.6842 bits (130), Expect = 9.859e-7
Identity = 34/81 (41.98%), Postives = 41/81 (50.62%), Query Frame = 3
Query: 2202 NCNKIGG----QCQCLPNVSGKTCERCASESYGFDARG--CKKCKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGY 2426
            NC +I      +CQC    SGK+CE C    YG   +G  CK C C+  GS +  C N+ G C C  GV G  CD C P Y
Sbjct: 1191 NCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNC-NEFGICQCSPGVLGIKCDQCAPNY 1270          

HSP 17 Score: 53.1434 bits (126), Expect = 2.636e-6
Identity = 41/131 (31.30%), Postives = 63/131 (48.09%), Query Frame = 3
Query: 1329 CKENVEGNQCDKCKIGFWKFNGNEETGCLKCNCVMMGTLENRGC----DSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANINGCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPT 1709
            C  N EGN+C  C+ GF+K + N +  C  C C        + C     S   KC C+   +G  C  C+ G++      I  C  C C++ GS+ +  C+++ G C C  G  GI+CD+    + +EK T
Sbjct: 1150 CMGNREGNKCQLCREGFYKNDKNYDQ-CEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGI-PCKSCDCNQQGSQ-SLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKT 1276          
The following BLAST results are available for this feature:
BLAST of Netrin-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LAMB10.000e+031.13laminin subunit beta 1 [Source:HGNC Symbol;Acc:HGN... [more]
LAMB10.000e+031.13laminin subunit beta 1 [Source:HGNC Symbol;Acc:HGN... [more]
LAMB40.000e+030.34laminin subunit beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
LAMB40.000e+030.34laminin subunit beta 4 [Source:HGNC Symbol;Acc:HGN... [more]
LAMB20.000e+033.12laminin subunit beta 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lam-10.000e+032.93LAMinin related. See also lmb [Source:UniProtKB/T... [more]
lam-25.902e-6630.81Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
unc-65.043e-5630.37Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
unc-65.043e-5630.37Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
lam-31.958e-5430.99LAMinin related. See also lmb; Laminin alpha chain... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LanB14.585e-12642.12gene:FBgn0261800 transcript:FBtr0079490[more]
LanB14.585e-12642.12gene:FBgn0261800 transcript:FBtr0079491[more]
LanB28.460e-9725.95gene:FBgn0267348 transcript:FBtr0345031[more]
LanB28.460e-9725.95gene:FBgn0267348 transcript:FBtr0076382[more]
wb9.658e-7125.04gene:FBgn0261563 transcript:FBtr0302731[more]
back to top
BLAST of Netrin-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lamb20.000e+030.42laminin, beta 2 (laminin S) [Source:ZFIN;Acc:ZDB-G... [more]
lamb1a0.000e+030.94laminin, beta 1a [Source:ZFIN;Acc:ZDB-GENE-021226-... [more]
lamb1b0.000e+032.64laminin, beta 1b [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
lamb2l0.000e+034.18laminin, beta 2-like [Source:ZFIN;Acc:ZDB-GENE-030... [more]
lamb1b0.000e+035.06laminin, beta 1b [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LAMB10.000e+031.76laminin subunit beta 1 [Source:NCBI gene;Acc:10049... [more]
LAMB10.000e+031.67laminin subunit beta 1 [Source:NCBI gene;Acc:10049... [more]
LAMB10.000e+031.70laminin subunit beta 1 [Source:NCBI gene;Acc:10049... [more]
LAMB10.000e+031.78laminin subunit beta 1 [Source:NCBI gene;Acc:10049... [more]
LAMB10.000e+031.85laminin subunit beta 1 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lamb10.000e+030.90laminin B1 [Source:MGI Symbol;Acc:MGI:96743][more]
Lamb10.000e+030.90laminin B1 [Source:MGI Symbol;Acc:MGI:96743][more]
Lamb20.000e+036.87laminin, beta 2 [Source:MGI Symbol;Acc:MGI:99916][more]
Lama24.218e-10327.97laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912][more]
Lamb38.132e-10136.06laminin, beta 3 [Source:MGI Symbol;Acc:MGI:99915][more]
back to top
BLAST of Netrin-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P07942|LAMB1_HUMAN0.000e+031.13Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=... [more]
sp|P02469|LAMB1_MOUSE0.000e+030.90Laminin subunit beta-1 OS=Mus musculus OX=10090 GN... [more]
sp|A4D0S4|LAMB4_HUMAN0.000e+030.34Laminin subunit beta-4 OS=Homo sapiens OX=9606 GN=... [more]
sp|P55268|LAMB2_HUMAN0.000e+033.12Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=... [more]
sp|P15800|LAMB2_RAT0.000e+036.71Laminin subunit beta-2 OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of Netrin-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PV220.000e+039.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4S2L4E20.000e+040.23Uncharacterized protein OS=Opisthorchis felineus O... [more]
G4LWP40.000e+033.96Laminin beta chain-related OS=Schistosoma mansoni ... [more]
A0A4Z2DB140.000e+035.71Laminin subunit beta-2 OS=Schistosoma japonicum OX... [more]
A0A0R3T2Q60.000e+035.77Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lamb1a0.000e+030.41laminin subunit beta-1 [Source:NCBI gene;Acc:10302... [more]
lamb1b0.000e+034.62laminin subunit beta-1-like [Source:NCBI gene;Acc:... [more]
lamb20.000e+034.28laminin, beta 2 (laminin S) [Source:ZFIN;Acc:ZDB-G... [more]
lamb1b0.000e+034.71laminin subunit beta-1-like [Source:NCBI gene;Acc:... [more]
lamb21.446e-1433.05laminin, beta 2 (laminin S) [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008925.16.298e-7925.55pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 ... [more]
ENSPMAT00000009682.11.297e-6237.53pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 ge... [more]
ENSPMAT00000006618.12.374e-5427.47pep scaffold:Pmarinus_7.0:GL481588:182:19210:1 gen... [more]
ENSPMAT00000008872.11.448e-5035.07pep scaffold:Pmarinus_7.0:GL476733:325925:343343:-... [more]
ENSPMAT00000004614.11.990e-3337.69pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 g... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Netrin-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395020.000e+033.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365236.218e-6933.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365011.778e-6329.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401313.107e-5926.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365004.973e-5728.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Netrin-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lamb20.000e+030.63laminin subunit beta 2 [Source:NCBI gene;Acc:10115... [more]
lamb20.000e+030.43laminin subunit beta 2 [Source:NCBI gene;Acc:10115... [more]
lamb1b0.000e+034.32laminin subunit beta-1 [Source:NCBI gene;Acc:10116... [more]
lamb1a6.247e-13543.30laminin subunit beta 1 [Source:NCBI gene;Acc:10116... [more]
lamb2l4.986e-13041.68laminin subunit beta-2 [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Netrin-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062589.10.000e+099.05SMESG000062589.1[more]
SMESG000019909.12.397e-10825.71SMESG000019909.1[more]
SMESG000050895.11.276e-4529.86SMESG000050895.1[more]
SMESG000056013.15.275e-4532.75SMESG000056013.1[more]
SMESG000056013.16.219e-4532.75SMESG000056013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009281 ID=SMED30009281|Name=Netrin-4|organism=Schmidtea mediterranea sexual|type=transcript|length=5223bp
ACGTTTGGGAAATGTTCAAATTTTATTTGAATTTTTTGTATTAATCTAGA
GAGTTAATATAAATGACATTAAACTACGTTTTCATTATATTTGTGGCTAG
ATATATTTTGGAAATTGAATCTGATAATGTATGTCGTAAAACTATTTGCA
ACCCCCGAGCTGGTGACCTCCTGATTGGACGAGAAAGTTTTCTTCGGGCT
TCTTCAACTTGTGGTTTAACTAATTCTGAAAGGTATTGTGTGGTTACTAC
AAGTGATAGTGGAAGAAAGTCAAAATGCACTATATGCGATTCAAAAAACC
CTTACCAAAGGTTTTCAAGTACCCATAGTCACAGAATTGAAAATGTTGTT
TCAAGATTACCTCAAGATCCTTTCAGATGGTGGCAATCTATGAGTGGAGT
TCATAATGTATCTATTGAAATTAGTTTTGAAAGCGAATTTCAATTTACAT
TTACACATTTGAGATTTAAAACTTATCGTCCCGCTGCAATGTATATTGAA
AGAAGCAAAGACTATGGAAGAACTTGGAATAAATATGCATATTTTAGTGA
TAATTGTCCTCGTGATTTTCCATCTATTCCTGAAAGAAAACGAAGTAATA
TAAACGAAGTTCTATGTACATCTGAATTTAGTTCAATTATTCCATCTGAA
GGTGGAACGGTATTATTTTCTGCTGATACTAGTGATTGGGTTAACAATGA
TGTTTACTGGAATAAAAAACGAAATGATATAACTGCTATAACCAATATCA
GAGTTCAATTTGTGAGACTACATACATTTGGTGATTGGAAAGTTGATGAC
AATCCAAATATCCGTAACAAGTATTATTATGCTATCTCAGAATGGATAAT
TAGAGGACGTTGTTCCTGTTATGGCCATGCTTCAAAATGTAAAGCAAAAG
AGGGACAAGTACAAGTTAAAGAAATGGTATATGGTGTTTGTGATTGCCAA
CACAATACAAAAGGACAGCACTGTGAAAAGTGCAAGGACTTTTATAACGA
TAGTCCATGGCTACCTGCTGATAAAAATTCTACCAACGAATGTCGAAAGT
GTGAATGCAATTCTCATTCTTCTAGTTGTCACTTTGACCCAGTGGTATAT
CAACAATCTAGAAAAATGAGTGGCGGAGTATGCGATAATTGCCAACATAA
CACTGAAAGTAAAAATTGCGAAAGATGTAAAAGTGGATATTATCGTAATA
TAGCAGTAGCAATAAATTCTTCACAGACATGTCTTAAGTGTCATTGTGAT
TCACTAGGAACAAAATTCCCGAGTATTTGTATACAGGAGCCTGAACTTGA
TCTAGGTTTAAATGCGGGACATTGTATTTGTAAAGAAAATGTTGAAGGTA
ATCAGTGTGACAAGTGCAAAATTGGATTTTGGAAATTTAATGGGAATGAA
GAAACCGGTTGTTTAAAATGCAATTGTGTAATGATGGGCACACTTGAGAA
CCGAGGATGCGACTCCTCAACTGGAAAATGCTATTGCAAATCTTTTGTAA
CTGGCAATGATTGCTCTACTTGCAAAATTGGATATTTTAATCTATCAAAT
GCAAACATTAATGGATGTTCATTGTGTAAATGCAGTGAATATGGTTCACG
AGATAATAAAACATGTGATAAATACAGTGGAAAATGTCTTTGTAAAAATG
GTTTCGCTGGTATAAGATGTGACGAAATAAAATCAGAATGGTATATAGAG
AAACCAACATATCCATTAGAACATTTAAAAGAAATTAAAATAAATTTACC
ACCAGTCTCTAAATCAGGATATTATAACTTTGTAATCACTACGGATACTA
AAAATATGCAATTTTTCGATAGTTTTATAATAGTTTTATCAATATATCAT
GTGGGTAAATCATCATGTCAAAGTTATCAAGACACAATGCAATTAATTAA
AGATTCTAGATATATTGTAATTCCAAACAAGTGCTTAGAAAAAGATTTAC
CAATCGTTCTAACAGTATTTACTATCGAATCGAATAACAAAATCCCTCCA
TCAATTATTGACATAGTTGTCATACCTCTATTAGACGTTAACAGTACAAA
AACAAGAAAAGTATTGGGAGAATGCCTAAATTACGCAAATTTAGTATCTT
CAAAGAAATGTGATTTTTTAAATGCAGAAATAAGTACCAATACTGTCACA
AAAAGTGATCCTATAAAATGCAAGTGTAATGTAACTGGATCTCGTAATAA
TAATTGTAACAAAATTGGCGGACAATGCCAATGTTTGCCTAATGTTTCTG
GAAAAACCTGTGAACGATGTGCCTCAGAATCCTATGGATTTGACGCAAGA
GGATGCAAAAAATGTAAATGCGATCTTACTGGTTCACTTAATTCGCAATG
TTACAATGATACAGGAAAGTGTTTGTGCCGCGAAGGAGTAGAAGGGCAAC
ATTGTGATACATGCAAACCTGGTTACTGGAATTTCCCGTTTTGCCACTCT
TGTAAATGTAATCAAATGAGTACTACATGTGATTCGAAAACTGGTAAATG
TCTAAACTGTAAAGGAAACAGTTTTGGTTACAATTGCCAAAACTGTGAAA
ACGGTTATTATGGAGATACAAGCAGAGGAATTCTTTGTAAGAAATGTCAA
TGTCCAGGTTTATCATCTTTAAAAAACAATTCAATTGGATGCAGTTTAAT
CTTTAACACAACAGCATTTACTTGCATGTGCAAAAAAGGCTATAGTGGGC
AGTTTTGTGATCAATGTGAGACAAATCATTTTGGAAATGCGATTAGTAAA
GATGGTACATGTCAACCATGTAGATGCTCAGGAAACATAGATCAAAGGAT
AGAAGATAGTTGCAACTCAAAGACTGGAGAATGTAGAAAATGCTTATTTA
ATACCTCTGGATTTAATTGTGAAAAATGCGTATCAGGATATTTTGGAAAT
GGTGCGGTTCGAACATGTACAAAATGTGTTTGTAATCATATGGGTACTAA
TTCAAAATGGCAAGGCATATGTAATCATGAAACTGGTAAATGCCCTTGTC
TCCCAAACGTTGTGGGCTTACAGTGTGATCGATGTCAAGATAAATTTTTT
AATTTATCTTCACAAATAGGATGCTTACCCTGTAATTGTGATTATCCTAT
AGGCGCGTTAAATCATTCTTGCAACCAATTAACCGGTCAGTGTTACTGTC
AAGCTGGTCGAAGTGGTAAAATGTGTAACAATTGCAAGGATGGATTTTGG
GGTGATCCAACAAAATTAAATGGATGTACAAAATGTTACTGTAATCTTGA
TGGATCTGTATTTAAACAATGCAACAGAAATAACGGTGTATGTCGATGCA
AACCTGGAATAACTGGTCGAAATTGTGATATGTGCATGAAAGGAACTGAT
GGTAAAATGCCTAATTGTAGTTCATGTGGAGATTGTTGGTTGCAATGGGA
TCATTTCTTAATAGTTGTTAAAAATACCTTTGATAAATTGCACAATTCTA
GTGGAGTATTTATGTCTAATGTTAAATTTCCCAAAGAAATAGATGATGTT
TGCACTAGTTTAGAACAGAATATGAAATCTTTGAAAGAAATTAAAAAATA
TTTTCCTATTGGATATGATATTATTATAAGTAATTTTAGTGAAAAGCTTT
CAAGATTAAAATATTATGTTTATAACAGTAACATAATCGATTTTAATACT
CAACAAAACTCAATAATTACGATTGAAAATTCTACTGATTATGCTAAAGC
CATGATTTCTAAAAACAAGATTAGAGACGTAACTGGTGCTTTTAATGAAC
TAAAGAAATCATTGAAAAATATTTTAAATGGGGCAAGTGAATCTAAAAAG
ATATATCAAAATATAACCTTAATAAAAGATAAATTATTTTATCGTAACGA
AGAATTACGAAATATCAATCTCAAATTTATTCGTCAAAAAAGTAAAGATA
TGGATAATTTGATAAATGAAATGTCTAAAAATGTGATAACATTTAATGGA
GTGACATGTAATACAATAACAGAGAGTAACCCATTGATGTGCTCAGAATT
TTGTGGAGGCGTTGGATGTAAACCAGATAAGTGCTATAGACATGCTCCTA
TGAATAAATATTGCATGGGAAAGAGTAATCAATTTTTCAATTTATATGCA
TCTCTATTGCTAGATCGAACAAATATGTCTATAATATTGAAGGAATTCAA
TCAACAATTTAATATCAGTATAAATTCCAAGGAAATTAAAGACGCGTATG
TTAAACCGGAGTCTGAGTACAACACTACTATCAAATTGATCGATGTTACA
AGGGGAGCAATTCAGTCTCGTCGTATAGAATCTGTTAATTTATTAATTAA
AATTAAAACATATTTAAATGGTTCTGCGGATCTGAAGGATTTTGAATCAC
TAATAGAAAATATTAATAAATTTGAAATAAACTTTAAAGAAAACGAAATT
ATTGCACTGGATAAACAAATTAGATCCAGGATAAGAAAATTAAATAATGT
TAACAATATTTTAGATAAATCCAAATTTAATAGAAAACAATGCGATGTTT
TTAAGAAATCCGCTGTTCGAGCAAAAGAGGATACTAGCTATTTACTTAAT
TCAATCAAAAATATTAGTACTCTTAACCGTATGACTCAAAAATTTGAAAT
TATAATGAAACAGTTCGTAATGAATTTTGCTAATGCATTATTTTCCTTGA
AAGGAAATCTTTTCCATATGTTTAAAAATGAAAACGAAGCCTTTCAAAAA
CAAAACAACATTAGTTATGTAACTGAAAGAATAAAATTTTTAAAATTGTA
TATAATGAAAATACACAAAGTATTTTCCAACACTTTTCAACAAATAAAAA
TAAAGCAAGAATTTCAGAAAGCAAAACTTCGAAATTTAAAGATAGATACA
AAAGTCGTGGTAAACAAGAGCAATTACTTTAAATTAAAAAGCGCGTCAAA
TTCGAAAATTTCGGAACGATTTCAATCACTCCTTAACAAAAGTCATAATT
TGAATGATAAAATAAAAGCAAGCCATTATAAATTAAAACTGAATAAAAAG
CTAATAGTGGACAAAGAACTCAAACTTCAATCTTTAAGTAAAGATATAGA
TGAAAAATTAAGTCGTCTTCTCGTTCTCCAGGATAAAATATACTCAAAAT
CTGAATTTCATGCTCAATGTTTACCGTAATGAATCATAATAATGATTTTT
CAAATTTATTTAGAGTAGATTTGATTTAATTTAAGAATTTTTCTATAAAT
AAATGTTTGATTTTATAAAAAAA
back to top

protein sequence of SMED30009281-orf-1

>SMED30009281-orf-1 ID=SMED30009281-orf-1|Name=SMED30009281-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1689bp
MTLNYVFIIFVARYILEIESDNVCRKTICNPRAGDLLIGRESFLRASSTC
GLTNSERYCVVTTSDSGRKSKCTICDSKNPYQRFSSTHSHRIENVVSRLP
QDPFRWWQSMSGVHNVSIEISFESEFQFTFTHLRFKTYRPAAMYIERSKD
YGRTWNKYAYFSDNCPRDFPSIPERKRSNINEVLCTSEFSSIIPSEGGTV
LFSADTSDWVNNDVYWNKKRNDITAITNIRVQFVRLHTFGDWKVDDNPNI
RNKYYYAISEWIIRGRCSCYGHASKCKAKEGQVQVKEMVYGVCDCQHNTK
GQHCEKCKDFYNDSPWLPADKNSTNECRKCECNSHSSSCHFDPVVYQQSR
KMSGGVCDNCQHNTESKNCERCKSGYYRNIAVAINSSQTCLKCHCDSLGT
KFPSICIQEPELDLGLNAGHCICKENVEGNQCDKCKIGFWKFNGNEETGC
LKCNCVMMGTLENRGCDSSTGKCYCKSFVTGNDCSTCKIGYFNLSNANIN
GCSLCKCSEYGSRDNKTCDKYSGKCLCKNGFAGIRCDEIKSEWYIEKPTY
PLEHLKEIKINLPPVSKSGYYNFVITTDTKNMQFFDSFIIVLSIYHVGKS
SCQSYQDTMQLIKDSRYIVIPNKCLEKDLPIVLTVFTIESNNKIPPSIID
IVVIPLLDVNSTKTRKVLGECLNYANLVSSKKCDFLNAEISTNTVTKSDP
IKCKCNVTGSRNNNCNKIGGQCQCLPNVSGKTCERCASESYGFDARGCKK
CKCDLTGSLNSQCYNDTGKCLCREGVEGQHCDTCKPGYWNFPFCHSCKCN
QMSTTCDSKTGKCLNCKGNSFGYNCQNCENGYYGDTSRGILCKKCQCPGL
SSLKNNSIGCSLIFNTTAFTCMCKKGYSGQFCDQCETNHFGNAISKDGTC
QPCRCSGNIDQRIEDSCNSKTGECRKCLFNTSGFNCEKCVSGYFGNGAVR
TCTKCVCNHMGTNSKWQGICNHETGKCPCLPNVVGLQCDRCQDKFFNLSS
QIGCLPCNCDYPIGALNHSCNQLTGQCYCQAGRSGKMCNNCKDGFWGDPT
KLNGCTKCYCNLDGSVFKQCNRNNGVCRCKPGITGRNCDMCMKGTDGKMP
NCSSCGDCWLQWDHFLIVVKNTFDKLHNSSGVFMSNVKFPKEIDDVCTSL
EQNMKSLKEIKKYFPIGYDIIISNFSEKLSRLKYYVYNSNIIDFNTQQNS
IITIENSTDYAKAMISKNKIRDVTGAFNELKKSLKNILNGASESKKIYQN
ITLIKDKLFYRNEELRNINLKFIRQKSKDMDNLINEMSKNVITFNGVTCN
TITESNPLMCSEFCGGVGCKPDKCYRHAPMNKYCMGKSNQFFNLYASLLL
DRTNMSIILKEFNQQFNISINSKEIKDAYVKPESEYNTTIKLIDVTRGAI
QSRRIESVNLLIKIKTYLNGSADLKDFESLIENINKFEINFKENEIIALD
KQIRSRIRKLNNVNNILDKSKFNRKQCDVFKKSAVRAKEDTSYLLNSIKN
ISTLNRMTQKFEIIMKQFVMNFANALFSLKGNLFHMFKNENEAFQKQNNI
SYVTERIKFLKLYIMKIHKVFSNTFQQIKIKQEFQKAKLRNLKIDTKVVV
NKSNYFKLKSASNSKISERFQSLLNKSHNLNDKIKASHYKLKLNKKLIVD
KELKLQSLSKDIDEKLSRLLVLQDKIYSKSEFHAQCLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR038684Laminin_N_sf
IPR000742EGF-like_dom
IPR002049Laminin_EGF
IPR008211Laminin_N
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005198structural molecule activity
GO:0005201extracellular matrix structural constituent
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005604basement membrane
GO:0005606laminin-1 complex
GO:0005607laminin-2 complex
GO:0005615extracellular space
GO:0031012extracellular matrix
GO:0043257laminin-8 complex
GO:0043259laminin-10 complex
GO:0048471perinuclear region of cytoplasm
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0021812neuronal-glial interaction involved in cerebral cortex radial glia guided migration
GO:0030198extracellular matrix organization
GO:0030335positive regulation of cell migration
GO:0031175neuron projection development
GO:0034446substrate adhesion-dependent cell spreading
GO:0035987endodermal cell differentiation
GO:0042476odontogenesis
GO:0050679positive regulation of epithelial cell proliferation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00011EGFLAMININcoord: 466..484
score: 46.65
coord: 716..734
score: 47.37
coord: 1071..1089
score: 48.09
coord: 735..763
score: 31.5
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 1007..1057
e-value: 3.0E-7
score: 32.2
coord: 504..549
e-value: 1.9E-6
score: 29.7
coord: 452..503
e-value: 2.0E-11
score: 45.6
coord: 751..797
e-value: 2.5E-11
score: 45.3
coord: 1058..1107
e-value: 5.6E-6
score: 28.2
coord: 392..451
e-value: 4.3E-9
score: 38.1
coord: 956..1006
e-value: 1.8E-14
score: 55.4
coord: 703..750
e-value: 5.2E-11
score: 44.3
NoneNo IPR availableGENE3DG3DSA:2.170.300.10coord: 270..384
e-value: 7.4E-37
score: 127.6
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 904..955
e-value: 3.2E-13
score: 51.4
coord: 798..846
e-value: 3.7E-7
score: 31.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 847..903
e-value: 3.8E-8
score: 35.2
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 479..547
coord: 678..1677
NoneNo IPR availablePANTHERPTHR10574:SF279LAMININ SUBUNIT BETA-4coord: 16..488
NoneNo IPR availablePANTHERPTHR10574:SF279LAMININ SUBUNIT BETA-4coord: 479..547
coord: 678..1677
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 16..488
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 1059..1095
e-value: 8.00881E-9
score: 51.201
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 453..502
e-value: 6.57166E-6
score: 42.7266
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 752..793
e-value: 1.32122E-13
score: 64.683
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 330..379
e-value: 1.09418E-4
score: 39.2598
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 266..320
e-value: 1.39231E-6
score: 44.6526
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 956..1004
e-value: 2.72583E-8
score: 49.6602
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 393..440
e-value: 7.90764E-5
score: 39.645
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 704..748
e-value: 2.33679E-10
score: 55.4382
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 1007..1057
e-value: 6.84394E-12
score: 59.6754
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 505..538
e-value: 1.14937E-4
score: 39.2598
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 846..902
e-value: 0.00198188
score: 35.793
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 903..947
e-value: 5.09021E-6
score: 43.1118
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 505..545
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 798..847
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 417..455
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 904..949
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 752..800
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 956..1010
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 330..380
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 1008..1051
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 704..745
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 453..502
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 267..332
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 861..906
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 752..795
e-value: 3.7E-12
score: 56.4
coord: 393..450
e-value: 2.8E-11
score: 53.5
coord: 505..554
e-value: 0.042
score: 23.0
coord: 798..843
e-value: 0.001
score: 28.3
coord: 1008..1056
e-value: 5.7E-8
score: 42.5
coord: 904..953
e-value: 2.0E-7
score: 40.7
coord: 1059..1103
e-value: 3.4E-5
score: 33.3
coord: 453..502
e-value: 8.2E-7
score: 38.6
coord: 956..1005
e-value: 1.8E-10
score: 50.8
coord: 704..749
e-value: 3.2E-9
score: 46.6
coord: 846..901
e-value: 1.2E-4
score: 31.4
coord: 267..327
e-value: 1.5E-7
score: 41.1
coord: 330..390
e-value: 4.6E-9
score: 46.1
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 1008..1056
e-value: 4.0E-8
score: 33.3
coord: 956..1005
e-value: 5.3E-9
score: 36.1
coord: 798..838
e-value: 8.6E-6
score: 25.8
coord: 505..543
e-value: 2.8E-6
score: 27.4
coord: 846..901
e-value: 1.7E-4
score: 21.7
coord: 393..450
e-value: 2.0E-8
score: 34.2
coord: 267..327
e-value: 1.1E-6
score: 28.7
coord: 330..390
e-value: 2.8E-7
score: 30.6
coord: 752..793
e-value: 1.8E-11
score: 44.0
coord: 904..953
e-value: 7.5E-7
score: 29.2
coord: 1059..1100
e-value: 1.9E-5
score: 24.7
coord: 453..502
e-value: 1.7E-7
score: 31.3
coord: 704..749
e-value: 6.3E-9
score: 35.8
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 473..507
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 771..800
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 1028..1061
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 1008..1058
score: 16.558
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 330..392
score: 10.636
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 956..1007
score: 16.481
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 453..504
score: 11.531
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 393..452
score: 13.206
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 505..551
score: 9.569
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 904..955
score: 12.864
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 1059..1105
score: 13.035
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 704..751
score: 18.69
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 752..797
score: 18.652
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 798..845
score: 12.616
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 267..329
score: 12.54
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 846..903
score: 9.455
IPR000742EGF-like domainSMARTSM00181egf_5coord: 806..844
e-value: 24.0
score: 11.6
coord: 483..537
e-value: 81.0
score: 5.6
coord: 736..783
e-value: 210.0
score: 1.0
coord: 845..887
e-value: 130.0
score: 3.2
coord: 917..954
e-value: 28.0
score: 10.8
IPR008211Laminin, N-terminalSMARTSM00136LamNT_2coord: 23..265
e-value: 4.6E-52
score: 188.9
IPR008211Laminin, N-terminalPFAMPF00055Laminin_Ncoord: 29..265
e-value: 1.8E-64
score: 217.6
IPR008211Laminin, N-terminalPROSITEPS51117LAMININ_NTERcoord: 25..266
score: 38.195
IPR038684Laminin, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.1490coord: 14..269
e-value: 1.7E-78
score: 265.8