Dystonin

Overview
NameDystonin
Smed IDSMED30009279
Length (bp)19802
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dystonin (SMED30009279) t-SNE clustered cells

Violin plots show distribution of expression levels for Dystonin (SMED30009279) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dystonin (SMED30009279) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dystonin (SMED30009279) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009279

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 34

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30009279SMESG000043809.1 SMESG000043799.1 Contig20965newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 SMESG000043799.1 Contig20965uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 SMESG000043799.1 Contig18341newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 SMESG000043799.1 Contig18341uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043799.1 Contig45334newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043799.1 Contig45334uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 SMESG000043799.1 Contig45585newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 SMESG000043799.1 Contig45585uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 Contig38190newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 Contig38190uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 Contig48632uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009279SMESG000043809.1 Contig48632newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30009279SMESG000043809.1 SMESG000043799.1 Contig20965newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30009279SMESG000043809.1 SMESG000043799.1 Contig20965newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30009279SMESG000043809.1 SMESG000043799.1 Contig20965uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30009279SMESG000043809.1 SMESG000043799.1 Contig20965uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30009279SMESG000043809.1 SMESG000043799.1 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009279SMESG000043809.1 SMED_02081_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009279SMESG000043809.1 SMED_02081_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dystonin vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 651/2254 (28.88%), Postives = 1169/2254 (51.86%), Query Frame = 3
Query: 12939 IGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----------DSSIDESIKKLK------IIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETL----KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNS-----VEKLVCQARNDLDKLKSVDAFENSL---------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTP------PLIPIFDRSKRMETNQGISKI-----QEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF--KFKPATLPIPTKKPTTAKIPSPRVSQPLSS--PRIHQPVSSP------RIPQPVTSPRISQNIPSSRVSQSLASPRT-----PKVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            +  F +++++PL+ + +++  +G     +       + +E ++D V   +  L + V+     +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L  R+S+++ + + G  +    +   K ++  +L  L++++E LLN AE +N + +    +++ F +  EP   WL T EK L N +   T  A ++E++I ++K L++D            SI +S+K L       ++ +K+D  FS+   I+ +             +KSH     L     N      D+V L     +  E   K  KL++ D Y T  +W++      E++  +E +    +N+DQ    G +L + ++ ++   I  K+  +   + +I+  +       E ++ +A R    + +L   L          D +  ++     ++L+ E  S      ++L  +A+N+   L S++   ++L         E +E +  E+ +R++ V + +T+K  +I +   +++  ++  D  +  ++  E+K+  + D   + +   ++L+  K     +L      K+ I+  +    K++      + +S+K  +D+V K  ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++ +  +G +I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++     +  D++KLQ   + L Q G E  +  R    DKD S + ++ KL ++    + + +   E + K+++++ LA +FW D + LI      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + +I  ++       + ++    + +W      +L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +  + K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  TE  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +LE L + W+ + E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +++  ++  +  +S    I+ D+  L +KW++V+     RK++LE+A+     FH  +  FINWLT  E+ LN     S I+ T+L Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D+++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H   +K+L  R   ++ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR   + P++  E+ +  +I  H  F K L     ++N     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++          IP+ D+ +        S +     Q  +   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++ +   AKGRTN ELREK     G    MA F  + + +        P  +   S + +Q  S   P    P  +P      R+P  ++         S  ++ + A  RT      K  + PG +  S+  +R +S++GS AS
Sbjct:  430 VQVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGT-QASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLD--FSQVWYIEIQ-------------EKSHSRSELLQQALCNAKIFGEDEVELMN---WLNEVHDKLSKLSVQD-YSTEGLWKQQ----SELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWL----------DKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEIL----RHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLEL-SPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIA--RSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLI------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDD--EDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDAS 2619          
BLAST of Dystonin vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 680/2473 (27.50%), Postives = 1240/2473 (50.14%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVEN------LAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----------DSSIDESIKKLK------IIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETL----KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNS-----VEKLVCQARNDLDKLKSVDAFENSL---------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTP------PLIPIFDRSKRMETNQGISKI-----QEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKF---------------KPATLPIPTKKPTTAKIPS---PRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQ-NIPSSRVSQSLASP-RTPKVVASPGLQR--------------------KSRIPTRQTSQQGSQASTRHQSR 19454
            ++E I   +  LS  + +K  +L +K + +             Q  +RE    F +   +LDS+     D   L+++   I+  L  L++ + +        +  + T E S   +    +L A+++   K+++    R+  +    K + EF SK  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +       + +E ++D V   +  L + V+     +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L  R+S+++ + + G  +    +   K ++  +L  L++++E LLN AE +N + +    +++ F +  EP   WL T EK L N +   T  A ++E++I ++K L++D            SI +S+K L       ++ +K+D  FS+   I+ +             +KSH     L     N      D+V L     +  E   K  KL++ D Y T  +W++      E++  +E +    +N+DQ    G +L + ++ ++   I  K+  +   + +I+  +       E ++ +A R    + +L   L          D +  ++     ++L+ E  S      ++L  +A+N+   L S++   ++L         E +E +  E+ +R++ V + +T+K  +I +   +++  ++  D  +  ++  E+K+  + D   + +   ++L+  K     +L      K+ I+  +    K++      + +S+K  +D+V K  ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++ +  +G +I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++     +  D++KLQ   + L Q G E  +  R    DKD S + ++ KL ++    + + +   E + K+++++ LA +FW D + LI      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + +I  ++       + ++    + +W      +L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +  + K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  TE  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +LE L + W+ + E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +++  ++  +  +S    I+ D+  L +KW++V+     RK++LE+A+     FH  +  FINWLT  E+ LN     S I+ T+L Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D+++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H   +K+L  R   ++ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR   + P++  E+ +  +I  H  F K L     ++N     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++          IP+ D+ +        S +     Q  +   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELREK     G    MA F+                +  ++     +  + ++P+   P++  PL+       +++ ++  P  +   S   +PS+  +    S  R P  ++  G                         + P+R  S+ GS+A +R  SR
Sbjct: 3058 QVETIAQEHSTLSQQVDEKCSFLETKLQGIGHF----------QNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGT-QASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLD--FSQVWYIEIQ-------------EKSHSRSELLQQALCNAKIFGEDEVELMN---WLNEVHDKLSKLSVQD-YSTEGLWKQQ----SELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWL----------DKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEIL----RHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLEL-SPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIA--RSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLI------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDD--EDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------AKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKILHPLTRNYGKPWLTNSKMSTPCKAAECSDFPVPSAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSR 5434          

HSP 2 Score: 239.58 bits (610), Expect = 1.359e-61
Identity = 120/239 (50.21%), Postives = 166/239 (69.46%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            L   + ++ R  DERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL W+++A E Y  I  ENF+T W+DGK F A+IHK RPDLID+ +++  S   NLE AF  A+K +GV ++++PEDV     DEKS++TYV+SL++  PK
Sbjct:   19 LQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEK-IGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPK 256          

HSP 3 Score: 102.834 bits (255), Expect = 3.335e-20
Identity = 102/525 (19.43%), Postives = 227/525 (43.24%), Query Frame = 3
Query: 1725 PTLSSGVISNRQYTPIHSMELGDNVLYSSL---------------NKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAV 3209
            P  SSGV  N   T +  M++   +L SSL                   NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + + +  + L++++ +L       +    +   F+ ++   + W+  KE++++ + W +  +  ++ K++    L+ EL+ +E +I     +   L + NH A   I+   A ++++W WIL L  C++ H++    Y +FF +A EA + +  L + +  ++       + + E L +E  +  E +  YK T+  ++  ++++  L  R +    +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + +   ++I +    +N C   + EL  S+    Q  +V N   S V+ +
Sbjct:  565 PNFSSGVEPNSLQT-LKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMTAP------LKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSE-RNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNI 1075          

HSP 4 Score: 76.2554 bits (186), Expect = 2.771e-12
Identity = 245/1310 (18.70%), Postives = 551/1310 (42.06%), Query Frame = 3
Query: 14178 PSLTALVREN--------DSLTGQVGER----NMEILEN-ETNSVEKLVCQARNDLD-KLKSV-------DAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLD-----QCMEVLSNF---EQKINEMSDQINNDYS---ELEECKIDFTNLLSAWNEQK----------ESINSTIND----SKKLIRQA-----------------PGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQI------VNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEE-------LKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFIL----------GPLPTETRPVLTQIQKTKEL-KNDIEPKHRDIELINQLGYQLTKGSHPNIKNQ-VNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEI-----DMEILVKKWD-------TVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDK-MATHLKYISQ--KHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNR---TLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKL-SDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAK---NQAIE-FERLWNSLKE 17774
            PSL  +V+E         DSLTGQ+ +R    +  I+++ +  S+ + +    +DLD KL S        DA    LE  + +  E ++  K++      K  +       A ++EE L      Q   +L +F   EQK       + +  +   + ++   DF   L    E++          + + S I D    SK L  Q+                  GS+  +L+  ++ +K   ++  K ++ ++ +L E++  A ++     TL  W+ + + N+ + K   LDP +   +  ++K+L    +    +++++  + + L  +      V   + K+++  ++   ++ ++ K  ++      ++   ++ E   ++ QCA +  +I D +      + +   L  +      + + +D  +     L +           A+D   + ++L ++  I+  +  L  Q  E    +   L     F N ++ +  +F E    L +      +  ++  +K+ I+    +++               L+   +N N+T  +  A EE       +KR+ EA+   C +    +DR Q+   ++E    +L+E++ ++     +L          GP+  ET  +  Q+   K   K +IEP     + +N LG  L + +  +   Q +   L  +N  W  L   + QR  QLQ  LL  G F  A++  + W++ TE  + N K    +   ++  + + K+++  ++  +++V  ++R+  +I      +   +  ++L  L   WE L   A  ++ +LE     A  F+   + +++ +  +  +L   +  G      +EQ+ +   +       N  + + +            SIG+++++     D +++  K D        ++  + +R   L++A+   + F  D  + +NWL      L++          + +Q    R L+ DI   ++   N+D+ +   L+ + Q    ++++I++ + +I  R++ +   S++ ++ L+   + A+R    +    T LD +   +E+L  +T + +     + Q+ + KE       +    DS   +   L +  P +  + ++++V     +++ + +   ++ + ++ A+L S  +  A    LSW+   E KL S    R   D  + Q  + +   +E  LR +D + + + +    +   SEE+   ++ +L ++   ++ + ++ +E+  +LE A+   NQ  E +E LW  L E
Sbjct: 2614 PSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQI------KVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKF-CLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQL-QCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVV----------EASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEA--------------LMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKL---LDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAV------------SIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQ---NVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKV--EVELLSYETQVLKGEEASQAQM-RPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEI-LRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTE 3869          
BLAST of Dystonin vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 682/2471 (27.60%), Postives = 1237/2471 (50.06%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVEN------LAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----------DSSIDESIKKLK------IIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETL----KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTA--LVRENDSLTGQ-VGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSL---------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTP------PLIPIFDRSKRMETNQGISKI-----QEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKF---------------KPATLPIPTKKPTTAKIPS---PRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQ-NIPSSRVSQSLASP-RTPKVVASPGLQR--------------------KSRIPTRQTSQQGSQASTRHQSR 19454
            ++E I   +  LS  + +K  +L +K          ++     Q  +RE    F +   +LDS+     D   L+++   I+  L  L++ + +        +  + T E S   +    +L A+++   K+++    R+  +    K + EF SK  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +       + +E ++D V   +  L + V+     +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L  R+S+++ + + G  +    +   K ++  +L  L++++E LLN AE +N + +    +++ F +  EP   WL T EK L N +   T  A ++E++I ++K L++D            SI +S+K L       ++ +K+D  FS+   I+ +             +KSH     L     N      D+V L     +  E   K  KL++ D Y T  +W++      E++  +E +    +N+DQ    G +L + ++ ++   I  K+  +   + +I+  +       E ++ +A R    + +L   L  +    L  E   L G+   +  M   E        L  +A+N+   L S++   ++L         E +E +  E+ +R++ V + +T+K  +I +   +++  ++  D  +  ++  E+K+  + D   + +   ++L+  K     +L      K+ I+  +    K++      + +S+K  +D+V K  ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++ +  +G +I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++     +  D++KLQ   + L Q G E  +  R    DKD S + ++ KL ++    + + +   E + K+++++ LA +FW D + LI      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + +I  ++       + ++    + +W      +L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +  + K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  TE  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +LE L + W+ + E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +++  ++  +  +S    I+ D+  L +KW++V+     RK++LE+A+     FH  +  FINWLT  E+ LN     S I+ T+L Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D+++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H   +K+L  R   ++ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR   + P++  E+ +  +I  H  F K L     ++N     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++          IP+ D+ +        S +     Q  +   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELREK     G    MA F+                +  ++     +  + ++P+   P++  PL+       +++ ++  P  +   S   +PS+  +    S  R P  ++  G                         + P+R  S+ GS+A +R  SR
Sbjct: 2732 QVETIAQEHSTLSQQVDEKCSFLETK----------LQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGT-QASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLD--FSQVWYIEIQ-------------EKSHSRSELLQQALCNAKIFGEDEVELMN---WLNEVHDKLSKLSVQD-YSTEGLWKQQ----SELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKE--------LKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEIL----RHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLEL-SPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIA--RSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLI------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDD--EDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------AKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKILHPLTRNYGKPWLTNSKMSTPCKAAECSDFPVPSAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSR 5108          

HSP 2 Score: 102.064 bits (253), Expect = 5.664e-20
Identity = 102/525 (19.43%), Postives = 227/525 (43.24%), Query Frame = 3
Query: 1725 PTLSSGVISNRQYTPIHSMELGDNVLYSSL---------------NKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAV 3209
            P  SSGV  N   T +  M++   +L SSL                   NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + + +  + L++++ +L       +    +   F+ ++   + W+  KE++++ + W +  +  ++ K++    L+ EL+ +E +I     +   L + NH A   I+   A ++++W WIL L  C++ H++    Y +FF +A EA + +  L + +  ++       + + E L +E  +  E +  YK T+  ++  ++++  L  R +    +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + +   ++I +    +N C   + EL  S+    Q  +V N   S V+ +
Sbjct:  239 PNFSSGVEPNSLQT-LKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMT------APLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSE-RNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNI 749          
BLAST of Dystonin vs. Ensembl Human
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 680/2473 (27.50%), Postives = 1240/2473 (50.14%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVEN------LAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----------DSSIDESIKKLK------IIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETL----KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNS-----VEKLVCQARNDLDKLKSVDAFENSL---------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTP------PLIPIFDRSKRMETNQGISKI-----QEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKF---------------KPATLPIPTKKPTTAKIPS---PRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQ-NIPSSRVSQSLASP-RTPKVVASPGLQR--------------------KSRIPTRQTSQQGSQASTRHQSR 19454
            ++E I   +  LS  + +K  +L +K + +             Q  +RE    F +   +LDS+     D   L+++   I+  L  L++ + +        +  + T E S   +    +L A+++   K+++    R+  +    K + EF SK  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +       + +E ++D V   +  L + V+     +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L  R+S+++ + + G  +    +   K ++  +L  L++++E LLN AE +N + +    +++ F +  EP   WL T EK L N +   T  A ++E++I ++K L++D            SI +S+K L       ++ +K+D  FS+   I+ +             +KSH     L     N      D+V L     +  E   K  KL++ D Y T  +W++      E++  +E +    +N+DQ    G +L + ++ ++   I  K+  +   + +I+  +       E ++ +A R    + +L   L          D +  ++     ++L+ E  S      ++L  +A+N+   L S++   ++L         E +E +  E+ +R++ V + +T+K  +I +   +++  ++  D  +  ++  E+K+  + D   + +   ++L+  K     +L      K+ I+  +    K++      + +S+K  +D+V K  ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++ +  +G +I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++     +  D++KLQ   + L Q G E  +  R    DKD S + ++ KL ++    + + +   E + K+++++ LA +FW D + LI      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + +I  ++       + ++    + +W      +L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +  + K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  TE  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +LE L + W+ + E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +++  ++  +  +S    I+ D+  L +KW++V+     RK++LE+A+     FH  +  FINWLT  E+ LN     S I+ T+L Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D+++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H   +K+L  R   ++ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR   + P++  E+ +  +I  H  F K L     ++N     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++          IP+ D+ +        S +     Q  +   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELREK     G    MA F+                +  ++     +  + ++P+   P++  PL+       +++ ++  P  +   S   +PS+  +    S  R P  ++  G                         + P+R  S+ GS+A +R  SR
Sbjct: 3098 QVETIAQEHSTLSQQVDEKCSFLETKLQGIGHF----------QNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGT-QASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLD--FSQVWYIEIQ-------------EKSHSRSELLQQALCNAKIFGEDEVELMN---WLNEVHDKLSKLSVQD-YSTEGLWKQQ----SELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWL----------DKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEIL----RHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLEL-SPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIA--RSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLI------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDD--EDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------AKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKILHPLTRNYGKPWLTNSKMSTPCKAAECSDFPVPSAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSR 5474          

HSP 2 Score: 256.144 bits (653), Expect = 1.371e-66
Identity = 126/239 (52.72%), Postives = 171/239 (71.55%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            LDP +R VLR+ADERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL W+++A E Y  I  ENF+T W+DGK F A+IHK RPDLID+ +++  S   NLE AF  A+K +GV ++++PEDV     DEKS++TYV+SL++  PK
Sbjct:   59 LDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEK-IGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPK 296          

HSP 3 Score: 102.834 bits (255), Expect = 2.919e-20
Identity = 102/525 (19.43%), Postives = 227/525 (43.24%), Query Frame = 3
Query: 1725 PTLSSGVISNRQYTPIHSMELGDNVLYSSL---------------NKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAV 3209
            P  SSGV  N   T +  M++   +L SSL                   NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + + +  + L++++ +L       +    +   F+ ++   + W+  KE++++ + W +  +  ++ K++    L+ EL+ +E +I     +   L + NH A   I+   A ++++W WIL L  C++ H++    Y +FF +A EA + +  L + +  ++       + + E L +E  +  E +  YK T+  ++  ++++  L  R +    +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + +   ++I +    +N C   + EL  S+    Q  +V N   S V+ +
Sbjct:  605 PNFSSGVEPNSLQT-LKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMTAP------LKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSE-RNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNI 1115          
BLAST of Dystonin vs. Ensembl Human
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 662/2427 (27.28%), Postives = 1204/2427 (49.61%), Query Frame = 3
Query: 12486 IYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPEL--------------AKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----DSSIDESIK---KLKIIINKVD-GVFSENVSIDTKNKINKLFDRFSEYQ-KSHYXXXXXXXXXXXXXXXXXDQVNLF------EDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVREND----SLTGQ--VGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNE---QKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNE---KVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSP------SRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF-PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPI-QDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPLIPIFDRSKRMETNQGISKIQEPLFV--------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------------LPIPTKKPTTAKIPSPRVSQ-PLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRT-PKVVAS-PGLQRKSRIPTRQTSQQGSQAS 19436
            + + +K + + +   R+    ++  +L +++D       D DSL+ QI D+     + + ++  +   ++E  ++ E++       + +   L A+N+   K+ E    RQ  L L    V        DF RK+   N+                   +++N    +   F +++VDPL+ +L+++  +G     +       + +E +M+ +   ++ L + V+     +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R++++D L   G  +  + +   + ++  +L+ L +++  LL+ A  +  + +  + L+K F +  EP   +L   EK LAN +   T  A +++++I  +K L+ D     + + +++K    L  + +  + GV SE        KI+ L  R+SE Q +   +   L     N      D+V +       ED L      +KD K +++          + L L +E+ + +   KN+DQ    G+ L + ++  +   I  K++ +   + +I+V++ K L   E +  +A +F             LT  +RE +    +  GQ   GE+ +   +     ++K V + R  LD +  V      L      E ++ +  +  +++K V + + ++  +I +   +++  E+  D  +  ++  ++K+  +       DQ        +   ID      + +E    +  I  T  + +K +          L+   + + +Q E+ +     +  +L+ A  L  +F  +Y  L  W+ ET   + Q     +D +QL + ++E++ L  S  + KP +D ++K G  L ++ N  +G+ +    + A+  Y  IKE ++ RA  L++ +  +T++ E   K++     LEN+  R+     P + P ++D+      E + D     + ++KLQ   E           R    DKD +  EI +KL ++    + ++++  E + K +++L LA +FW D+  +       TI  T   + DL +  ++      + +  E ++ E D   +++  I   G  LI       E P+V ++ +E+   +E +  + ++++  ++       + ++    + +W      +L  + P+ T+   V  Q+ + KE K ++  +  ++E +N  G   L K +    ++ +   L  +   W  L + +  RQH+L+  LL+LG+F  A++E + W+  TE  L   +   GD   +E+ LA+H +++ D+   QA+V  + +   E+++   SS G +A+    RLE + + WE + +    +  +L+  L++A  F+ + ++    +  + S+L   K +GGLP+TA+EQL   M++Y     K     +   +    +  +     G   E  + +L +KW  V +  E RKS+LE+A+     F   + +FINWLTL E++LN   P S I++T+L Q+E H+    ++ +HR++++ LD+    LK++SQK D+VLI+NL+ S+  RWEKVV RS ER R+LD   K AK+F +  + L+D +      L+ +  I   P KI+ Q++KHKEF   LG     YD+T R G  L++K  + +DS+K+D  +  ++ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +      L+  S +D+++++ QL EL + W+ V KL+  K+ RLE+A  QA  F    + L E+ S++E  LR     P++   E + ++I  H  F K +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL W+  AE TL+  +   +   +   K    EH+ F+ +MT KQ D D +    K+K   P   P  ++S R    + +S+   P           NP+INQL ++W+QVW + L R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF TT++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    M PF     + KP++                   T  P++   P+      P S  ++ +P  +P      TS     +  SS  S    + R  PK  AS PG +  SR  +R +S++GS AS
Sbjct: 2999 VMMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIHVLKLDIEASEAECRHMLEEEGTLDLLGLKR--ELEALNKQCGKLTERGKARQEQLELTLGRV-------EDFYRKLKGLNDATTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTA-KIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSPAEQGVLSE--------KIDSLQARYSEIQDRCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKLSSV--FVKDFKQDVLHRQHA-----DHLALNEEIVNRK---KNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQARQLATKF-------QSTYEELTGWLREVEEELATSGGQSPTGEQ-IPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTV----------LQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEETRALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKEL-NPEEGEMVEEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEFHDKIEPMLETLENLSSRLR---MPPLIPAEVDK----IRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALL-----TTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGE-TEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLE---SSAGDDASSLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE-DQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPDD--TEALQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKS-RSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSSGSKLKRP--TPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDAS 5324          

HSP 2 Score: 231.106 bits (588), Expect = 6.339e-59
Identity = 114/227 (50.22%), Postives = 157/227 (69.16%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            DERD +QK+TF  W+N HLMK+ K + D++ DLRDG  L++LLEVLS  KL  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  S +S D+S K+ LL W++K    Y  I   NFS+ W DGK F ALIH+ RPDL+D++ +   S ++NLE AF  A++ LGV ++++ EDV     DEKS++TYV+S+++  PK
Sbjct:   23 DERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPK 248          

HSP 3 Score: 106.301 bits (264), Expect = 2.509e-21
Identity = 161/832 (19.35%), Postives = 362/832 (43.51%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLN---KIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKND----LKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLS------TMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVN------DLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKD---VPTNLDQLISAVTTSRQNQKDVSYE---DIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGL--QTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTKRSRIQNAHDWVSCE 4238
            +W++E    +    + NDL  +    +  +   T+  E+  SV E ++      + +M  +FH S  +    L+T++ +L    S      +S  +F+ ++   + W+  KE++++ + W D  S  +S K+  F  L  ELE ++            L++ NH A   ++   A ++S+ QW+  L  C++ H++    Y QFF +A E ++ +  L + +  ++       L   E L ++  D  E +   K +V  ++  S+++  L  R+   + +  ++VKA+C  ++          + +   L +NS    W+V +        P++CFLI   +  A + A  ++  +  +  LW   +L +  + L+S       +DLV+ W  E   +  P    +I++ L       + D + + +    +  +    +  C ARF  L  S     +  TV+    S +K        ++ L+L++      K +Q  S+  +            ++ + +  + +L+     ++      D  L      S    L+ +L  +++  + ++  + +++ KLK+ +V    + + + ++   E+ L +Q E   A        ++ LEA   T+   + ++KD   V + LD+ I+      +    ++ E   D+++ +++   ++ R+  +  Q++ R S + E   + LG   + +A    +I    +TT + ++  P    +S+ +   + +      EI + + ++D+  K +  +  +++ YE     Y+  +++Q     Q   G  KR R+ ++ D ++ E
Sbjct:  543 SWVEEMQMKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLY-----EGKMSQNFHTSYAETLGKLETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNS-NISAKRNYFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGRSKTIVQLKPRSPDHVLKNTISVKAVCDYRQ----IEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALW--HQLHVNTKSLISWNYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEEEVEACKARFQHLMKSMENEDKEETVAKMYISELK--------NIRLRLEEYEQRVVKRIQ--SLASSRTDRDAWQDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHVYGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKL-SQEEVVLAD-------LSALEAHWSTLRHWLSDVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVIAQLEIRQSEL-ESIQEVLG---DYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQTALFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQ-----QKSPG--KRRRMLSSSDAITQE 1333          
BLAST of Dystonin vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 444.891 bits (1143), Expect = 5.288e-124
Identity = 507/2231 (22.73%), Postives = 1008/2231 (45.18%), Query Frame = 3
Query: 12957 QKVDPLKKQLE---ELIDIGNKACSTVISGLGFKHMEQEMDS----VKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLIN-TKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSP-TVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVD--PYQTRDIWEESLNLVKE----VKSHEETLKNLDQVGEDLKQISSENDSAAI-NCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNME---ILENETN-----SVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQ--APGSDL-KSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQN-KINNLDPD----QLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNI--DRQQSLITKLEEMRM------KLDEWFKEVNNRLFILGPLPTETRPVLTQI-QKTKEL---KNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMI--RADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRF----MDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWL-RAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQ-YNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRH---IFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF------KFKPAT-LPIPTKK---------PTTAKIPSPRVSQPLSSPRIH---QPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTP----KVVASPGLQRKSRIPT 19403
            +KV  LK+ L+   E +D  N  C  +I   G +   +E+DS    V  ++  ++  VSD E  VD  + ++ K + +   L  ++E     ++  ++PS +   +K+QL+ + +L+  ++ ++ S+D        ++   + + +K  L N+  ++  +Y++LLN A  +  +   AV L++  ++   P   WL +A+K L      P TV+  + E+ I E + LQ++   ++     LK ++ ++  + +  VS++  N I+   ++     ++    +  +          +    L  + +  F     ++KL  +D  P +  D+ E++ N++ E    +   +E + N+ +VG+ L  I  E + A I   K++ L   + ++  SA +K++L   +IP++E F   +   D V+  L  + R+  ++  +  E   E   +LE + +     SV++L   + N L  L S D      ++++   +   K    V + V ++A +I     +++   ++L   +E  S   ++I E +     +    S+L+  +I  TN  ++ N  K    +   ++KK+ RQ    G++  + +   VD  K+  E        + + L+ A+ L ++  S ++ L  WL + +  +  +  +    P     ++H   +E+  +  ++   +P+++        L +++   Q   + +   +  + Y  ++E ++ R   +++++       E+++     L+   DR+ ++   S  P  L+  L     I+  L   Q   D L+   +  S    +A + D +   +E KL ++    K ++ + ++    + ++L  A  FW++L   +    ++   L        +   + D+++++  +  E++     I  +S  GKQL + V      PD E+A   ++     VR      IT +  ++++ LI  +EE         +L +W      +L  + P+  E    +T+I Q  KEL   K+++  +    E +     QL   + P++   V   +A +N  W+RL   L +R+H+L+ ++L +G+    + +   W+  T  +L +I      +N  ++ +AQ K++    D++  Q SV+ + R A + I+    +L  E +  L+ +   WE++++   +  F++E A KEA    G+ ++  + ++E  S L   K +GGLP+TA+ QL  F    +D+      L   +    +   E  + +   + K        +  KW+ VK L   R+ +L+ A E        +    +W+   E+ L  Q  +SR+   I +Q+  H +   ++   +  M        H++Y  +K D + I+N + S+ HR EK+  R++ER++ L     E   ++D    L   I+  L  +  + +   +  K++ ++ + KE   ++      +D TR+ G  L ++A   + K+I      +  KW  +  K  +R +    A+L  G ++++M +L SW+   +E       +    D++ V+ L++E S    + + +++ ++ +   A ALM    ++   I      L   WN V + A  +   ++EA+  A EF+   ++L ++ +  E +L+   +   +E E +   M    G + + L           + G EIL    P AE  +++++ +++++W ++    ++R   L +   +  E+                   A +  EL+  + +   Q  +  E+ I D          + +  +++ P +      +K+   N             P    L ++WK++W   +  +  L +    L+E++ ++ + +EDW+ RY+ W +H+K+RV D FRR D  H G V R+ FIDGII S    +   ++SKF T+R+EM  VAD FDK   G I+ ++F+ ALR D      KP  + E I  E++ Q   C+C  PY+I +  +  Y+FGDT   R+VRILRS VMVR+GGGW +LDEFL KHDPCR                      AKGR N  +  + + P   +++M  F      K  P T  P P  K         P +  +         +    H   +P   PR P  +++ R+S+    S    S+    TP       +S    R++RIP+
Sbjct: 2269 EKVRQLKESLKPVGEKMDAFNTDCKLLIKTAGPESDTKELDSLLKKVGDAYSDVVGKVSDKEMSVDAAVQQQGKVEDAYRALLNWLEETEEMMENRKKPSADAKVAKAQLHDYEVLMKHVEDKKPSVDGFKAMIEKIVAEASSDEEKKALGNKNAQIEDRYKDLLNSAVDRQRKLLDAVDLAERLQEVTIPLDSWLQSADKRLQALAKVPITVE--KAEEMIGEQEALQDE---LEHKSDDLKDVL-EIAPMLASLVSVEDANSISGQVNQLEARARALDAGITNMRPLLESFLQQIQDFTLDAEDMTQF-VGETEVKLGELDELPIEPDDLVEQT-NILAEIAVSIADRDEMMANIFEVGKQLA-IQGEPEEALIAQKKLDDLKFRYADLMTSADEKIALLAKAIPLSEGF---HEGFDTVMQVLEDMDRDLQTIDEEDPETQAELIFLLEEDISQKMRPSVDELTALS-NQLQVLCSAD----KADELQTNTIAMNKLVNSVADRVARRAERIEMASKQSRAVLDDLQYLIEWFSAARERILEGAPPSLDLEVLKSQLKHQRI--TNEEASAN--KVQFRNVAGEAKKVARQLGMEGNEANEKISDTVDEGKELVEEVMALCADRTETLERALALMEQLTSQFDELNKWLDQMDAELQASPSVTTATPAAELREMHDHNEELARMVAAY---RPIIEGFKSDVGSLHEVLAEDQAPLLESVAGELVQGYEEVREAVRARGHAIDNMMGATIGFGERLETLVANLQGAADRLRENEGISADPSVLESRLAENRSIVESLRDKQNAYDALK---QTASELLASAPEGDAAAGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLRNRLELVEPATGHPEQLADQQEIMAQVASEMERARPRIEALSIAGKQLADYV------PDDEKA--VIENQVANVRGGF-STITGLFAEKKRDLIAAMEEAMTFHGDLQELLKWLDMAEQKLLKMSPV--EHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPPKNAVNLRDIEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTS-GALDAETSDSLKSMNLKWEDIQKVLESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKT----HGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRLPDVIEKQLAEHESWMEEVAGRKMAMTKHQASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSEYKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL---DEVEGVKQEMDEAKGRYQECL-----------KKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQN--------EQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFA-------NLDSELREQQPEVDAACKSAKKGARN-------------PAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSNYVPNSTIVYSKFPTSRLEMAKVADRFDK-GDGMINAKEFINALRFDASNRNAKPQTDTEKITHEIELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCR----------------------AKGRLNINMFPE-ARPIHALDSMRSFTKNRHGKQLPTTGTPGPIMKIREKTDRSVPMSGGLGGTAGYTVTTDSHRHTDARPSRIPRAPSDMSAGRLSRVGSVSNSKNSIVDSSTPSRPESRASSDAGDRQTRIPS 4390          

HSP 2 Score: 353.984 bits (907), Expect = 1.602e-96
Identity = 332/1337 (24.83%), Postives = 616/1337 (46.07%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQ------------SSK------------SDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQ--QNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIE----------EKIYQFRN------QYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTIST-----LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYP-ADQHYRIIININGK----IDKVKKKFEKLSPPTLSSGVISNRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKD---SVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICS-SKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENE--INKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIK------------ILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFE---SKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTK 4196
            DERD +QK+TF  W+N HL K + ++ D+F DLRDG  L+ LLE L+ +++  +N  +RFH ++N+   LDFL+ +NIKLVNI  ED+V+GN KLTLGL+W IIL FQ   I Q            S+K            SD  S +  LLQW+R+    YP +N+ NFS+SW+DG AF A++H+ R   ID   IS +S    + L  AF  A +E GV ++++ EDV +   DEKS++TYV+SL+   P E ++           E+ Y++R       Q  D   +L     EL   ++   FR D    R E        Q      +++ + KV R+ E     H +S      +W++ + +   +  +L     +   S  +   L         K++ I  +I  +   +  +P   +   ++ I  +L   E+ I      V+ELK   +P A+  Y+ +  ++ +    +D++  +   L    + +  +       + +M       +S + +   W+  +   ++ + F  DL+ L  ++E+      +I+D   +VDE  +  ++E   +   ++ +    L++++ +L    +    D  S + F+  +   + W+  +E  ++   W D + + L      +K L+ E+E+RE   N+    G  L    H A   I+  L  ++S+W W+L L+ CL+ HL      + F  EA++A+  I E + +L + + R     L+EGE   RE+ ++ E +  Y + +  +     S+S L  R   I P   + V A+C  S EN          G+ + L +NS    W + +        P++ F I     + +     L   F  LK LW K+   +R  ++L+TM  ++ W  + F +++P  R  I++ LN DAN+L+ +L     D N+    +    L + N  F  L              N S  P +    +  +  D ++ +L+    +  +EL+  +  P+    + LE  +  HK FE  L+  +  V ++    +   + T   +V  +R+  LW+ LW+ + M+V ++K  E   + + E+  ++ + E+TL N  +  PA +D+++            + +++L A  +  S     +  +  N+  L   V+ +R N+    + D+  ++ E++ +  R+E + +QI  RL  V       +  ++E +   +W+  ++ T+ +++  P  +      + ++ L+ +  N Q    ++   I+ +NK    F++  + ++     Y + I    G   +  F  TK
Sbjct:   35 DERDNVQKKTFTKWVNKHLSKTDHKIDDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEEYIEEAYEWREWVVRAIQLVD-DRHLQGTASELI--YELQRFREDDLPPREE--------QKRRLTLVYEHLEKVMRSTELFAIPHELSAPELQRVWNELQNSIDRRFDVLERHRIQEGNSNDLLSRLARGIGITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFEDVEELKSMQHPEANDFYKQVYGLHQRRTTYLDRLTNQI--LVRLGVRTDSLHKENQQRLENMR---KTSFSRVEECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDEC-IARQAEVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQWDWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNR-TDFSLEEGERFLRELDEIKEILNKYHQVLMALTERCASISPLWQRGERI-PHP-IKVTALCDYSDENVTIKA-----GDDVYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKHRMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSEL-----DPNDPLALRLREELRRTNEHFWNLL-------------NASQKPPEP---DWASQYDQKMAELLKKLEEAWRELNDAVGKPISRSPEDLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRMYVERIKVLESVLNGMVEVADIVRQHEITL-NSFDDLPAALDKLRGHHSQLLEINMVLKVSKLGAQNEHFSQQQTVIDQLNRNVALLRQHVSRTRINEG--HHPDVDAIEDEVQKLNVRWENVNSQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETI-NRLRKPEELRPEQYQQQLDMLIAEYTNLQ----EHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTK 1317          
BLAST of Dystonin vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 444.891 bits (1143), Expect = 5.689e-124
Identity = 507/2231 (22.73%), Postives = 1008/2231 (45.18%), Query Frame = 3
Query: 12957 QKVDPLKKQLE---ELIDIGNKACSTVISGLGFKHMEQEMDS----VKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLIN-TKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSP-TVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVD--PYQTRDIWEESLNLVKE----VKSHEETLKNLDQVGEDLKQISSENDSAAI-NCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNME---ILENETN-----SVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQ--APGSDL-KSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQN-KINNLDPD----QLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNI--DRQQSLITKLEEMRM------KLDEWFKEVNNRLFILGPLPTETRPVLTQI-QKTKEL---KNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMI--RADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRF----MDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWL-RAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQ-YNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRH---IFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF------KFKPAT-LPIPTKK---------PTTAKIPSPRVSQPLSSPRIH---QPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTP----KVVASPGLQRKSRIPT 19403
            +KV  LK+ L+   E +D  N  C  +I   G +   +E+DS    V  ++  ++  VSD E  VD  + ++ K + +   L  ++E     ++  ++PS +   +K+QL+ + +L+  ++ ++ S+D        ++   + + +K  L N+  ++  +Y++LLN A  +  +   AV L++  ++   P   WL +A+K L      P TV+  + E+ I E + LQ++   ++     LK ++ ++  + +  VS++  N I+   ++     ++    +  +          +    L  + +  F     ++KL  +D  P +  D+ E++ N++ E    +   +E + N+ +VG+ L  I  E + A I   K++ L   + ++  SA +K++L   +IP++E F   +   D V+  L  + R+  ++  +  E   E   +LE + +     SV++L   + N L  L S D      ++++   +   K    V + V ++A +I     +++   ++L   +E  S   ++I E +     +    S+L+  +I  TN  ++ N  K    +   ++KK+ RQ    G++  + +   VD  K+  E        + + L+ A+ L ++  S ++ L  WL + +  +  +  +    P     ++H   +E+  +  ++   +P+++        L +++   Q   + +   +  + Y  ++E ++ R   +++++       E+++     L+   DR+ ++   S  P  L+  L     I+  L   Q   D L+   +  S    +A + D +   +E KL ++    K ++ + ++    + ++L  A  FW++L   +    ++   L        +   + D+++++  +  E++     I  +S  GKQL + V      PD E+A   ++     VR      IT +  ++++ LI  +EE         +L +W      +L  + P+  E    +T+I Q  KEL   K+++  +    E +     QL   + P++   V   +A +N  W+RL   L +R+H+L+ ++L +G+    + +   W+  T  +L +I      +N  ++ +AQ K++    D++  Q SV+ + R A + I+    +L  E +  L+ +   WE++++   +  F++E A KEA    G+ ++  + ++E  S L   K +GGLP+TA+ QL  F    +D+      L   +    +   E  + +   + K        +  KW+ VK L   R+ +L+ A E        +    +W+   E+ L  Q  +SR+   I +Q+  H +   ++   +  M        H++Y  +K D + I+N + S+ HR EK+  R++ER++ L     E   ++D    L   I+  L  +  + +   +  K++ ++ + KE   ++      +D TR+ G  L ++A   + K+I      +  KW  +  K  +R +    A+L  G ++++M +L SW+   +E       +    D++ V+ L++E S    + + +++ ++ +   A ALM    ++   I      L   WN V + A  +   ++EA+  A EF+   ++L ++ +  E +L+   +   +E E +   M    G + + L           + G EIL    P AE  +++++ +++++W ++    ++R   L +   +  E+                   A +  EL+  + +   Q  +  E+ I D          + +  +++ P +      +K+   N             P    L ++WK++W   +  +  L +    L+E++ ++ + +EDW+ RY+ W +H+K+RV D FRR D  H G V R+ FIDGII S    +   ++SKF T+R+EM  VAD FDK   G I+ ++F+ ALR D      KP  + E I  E++ Q   C+C  PY+I +  +  Y+FGDT   R+VRILRS VMVR+GGGW +LDEFL KHDPCR                      AKGR N  +  + + P   +++M  F      K  P T  P P  K         P +  +         +    H   +P   PR P  +++ R+S+    S    S+    TP       +S    R++RIP+
Sbjct: 2814 EKVRQLKESLKPVGEKMDAFNTDCKLLIKTAGPESDTKELDSLLKKVGDAYSDVVGKVSDKEMSVDAAVQQQGKVEDAYRALLNWLEETEEMMENRKKPSADAKVAKAQLHDYEVLMKHVEDKKPSVDGFKAMIEKIVAEASSDEEKKALGNKNAQIEDRYKDLLNSAVDRQRKLLDAVDLAERLQEVTIPLDSWLQSADKRLQALAKVPITVE--KAEEMIGEQEALQDE---LEHKSDDLKDVL-EIAPMLASLVSVEDANSISGQVNQLEARARALDAGITNMRPLLESFLQQIQDFTLDAEDMTQF-VGETEVKLGELDELPIEPDDLVEQT-NILAEIAVSIADRDEMMANIFEVGKQLA-IQGEPEEALIAQKKLDDLKFRYADLMTSADEKIALLAKAIPLSEGF---HEGFDTVMQVLEDMDRDLQTIDEEDPETQAELIFLLEEDISQKMRPSVDELTALS-NQLQVLCSAD----KADELQTNTIAMNKLVNSVADRVARRAERIEMASKQSRAVLDDLQYLIEWFSAARERILEGAPPSLDLEVLKSQLKHQRI--TNEEASAN--KVQFRNVAGEAKKVARQLGMEGNEANEKISDTVDEGKELVEEVMALCADRTETLERALALMEQLTSQFDELNKWLDQMDAELQASPSVTTATPAAELREMHDHNEELARMVAAY---RPIIEGFKSDVGSLHEVLAEDQAPLLESVAGELVQGYEEVREAVRARGHAIDNMMGATIGFGERLETLVANLQGAADRLRENEGISADPSVLESRLAENRSIVESLRDKQNAYDALK---QTASELLASAPEGDAAAGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLRNRLELVEPATGHPEQLADQQEIMAQVASEMERARPRIEALSIAGKQLADYV------PDDEKA--VIENQVANVRGGF-STITGLFAEKKRDLIAAMEEAMTFHGDLQELLKWLDMAEQKLLKMSPV--EHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPPKNAVNLRDIEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTS-GALDAETSDSLKSMNLKWEDIQKVLESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKT----HGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRLPDVIEKQLAEHESWMEEVAGRKMAMTKHQASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSEYKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL---DEVEGVKQEMDEAKGRYQECL-----------KKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQN--------EQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFA-------NLDSELREQQPEVDAACKSAKKGARN-------------PAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSNYVPNSTIVYSKFPTSRLEMAKVADRFDK-GDGMINAKEFINALRFDASNRNAKPQTDTEKITHEIELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCR----------------------AKGRLNINMFPE-ARPIHALDSMRSFTKNRHGKQLPTTGTPGPIMKIREKTDRSVPMSGGLGGTAGYTVTTDSHRHTDARPSRIPRAPSDMSAGRLSRVGSVSNSKNSIVDSSTPSRPESRASSDAGDRQTRIPS 4935          

HSP 2 Score: 352.443 bits (903), Expect = 4.299e-96
Identity = 332/1337 (24.83%), Postives = 617/1337 (46.15%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQ------------SSK------------SDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQ--QNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIE----------EKIYQFRN------QYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTIST-----LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYP-ADQHYRIIININGK----IDKVKKKFEKLSPPTLSSGVISNRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKD---SVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICS-SKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENE--INKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIK------------ILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFE---SKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTK 4196
            DERD +QK+TF  W+N HL K + ++ D+F DLRDG  L+ LLE L+ +++  +N  +RFH ++N+   LDFL+ +NIKLVNI  ED+V+GN KLTLGL+W IIL FQ   I Q            S+K            SD  S +  LLQW+R+    YP +N+ NFS+SW+DG AF A++H+ R   ID   IS +S    + L  AF  A +E GV ++++ EDV +   DEKS++TYV+SL+   P E ++           E+ Y++R       Q  D   +L     EL   ++   FR D    R E        Q      +++ + KV R+ E     H +S      +W++ + +   +  +L     +   S  +   L         K++ I  +I  +   +  +P   +   ++ I  +L   E+ I      V+ELK   +P A+  Y+ +  ++ +    +D++  +   L    + +  +       + +M       +S + +   W+  +   ++ + F  DL+ L  ++E+      +I+D   +VDE  +  ++E   +   ++ +    L++++ +L    +    D  S + F+  +   + W+  +E  ++   W D + + L      +K L+ E+E+RE   N+    G  L    H A   I+  L  ++S+W W+L L+ CL+ HL      + F  EA++A+  I E + +L + + R     L+EGE   RE+ ++ E +  Y + +  +     S+S L  R   I P   + V A+C  S EN          G+ + L +NS    W + +        P++ F I     + +     L   F  LK LW K+   +R  ++L+TM  ++ W  + F +++P  R  I++ LN DAN+L+ +L     D N+    +    L + N  F  L ++          S +   P  A      +  D ++ +L+    +  +EL+  +  P+    + LE  +  HK FE  L+  +  V ++    +   + T   +V  +R+  LW+ LW+ + M+V ++K  E   + + E+  ++ + E+TL N  +  PA +D+++            + +++L A  +  S     +  +  N+  L   V+ +R N+    + D+  ++ E++ +  R+E + +QI  RL  V       +  ++E +   +W+  ++ T+ +++  P  +      + ++ L+ +  N Q    ++   I+ +NK    F++  + ++     Y + I    G   +  F  TK
Sbjct:   35 DERDNVQKKTFTKWVNKHLSKTDHKIDDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEEYIEEAYEWREWVVRAIQLVD-DRHLQGTASELI--YELQRFREDDLPPREE--------QKRRLTLVYEHLEKVMRSTELFAIPHELSAPELQRVWNELQNSIDRRFDVLERHRIQEGNSNDLLSRLARGIGITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFEDVEELKSMQHPEANDFYKQVYGLHQRRTTYLDRLTNQI--LVRLGVRTDSLHKENQQRLENMR---KTSFSRVEECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDEC-IARQAEVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQWDWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNR-TDFSLEEGERFLRELDEIKEILNKYHQVLMALTERCASISPLWQRGERI-PHP-IKVTALCDYSDENVTIKA-----GDDVYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKHRMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSEL-----DPNDPLALRLREELRRTNEHFWNLLNA----------SQKPPEPDWA------SQYDQKMAELLKKLEEAWRELNDAVGKPISRSPEDLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRMYVERIKVLESVLNGMVEVADIVRQHEITL-NSFDDLPAALDKLRGHHSQLLEINMVLKVSKLGAQNEHFSQQQTVIDQLNRNVALLRQHVSRTRINEG--HHPDVDAIEDEVQKLNVRWENVNSQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETI-NRLRKPEELRPEQYQQQLDMLIAEYTNLQ----EHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTK 1317          
BLAST of Dystonin vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 440.269 bits (1131), Expect = 1.437e-122
Identity = 506/2228 (22.71%), Postives = 1004/2228 (45.06%), Query Frame = 3
Query: 12957 QKVDPLKKQLE---ELIDIGNKACSTVISGLGFKHMEQEMDS----VKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLIN-TKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSP-TVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVD--PYQTRDIWEESLNLVKE----VKSHEETLKNLDQVGEDLKQISSENDSAAI-NCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNME---ILENETN-----SVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQ--APGSDL-KSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQN-KINNLDPD----QLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNI--DRQQSLITKLEEMRM------KLDEWFKEVNNRLFILGPLPTETRPVLTQI-QKTKEL---KNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMI--RADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRF----MDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWL-RAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQ-YNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF------KFKPAT-LPIPTKK---------PTTAKIPSPRVSQPLSSPRIH---QPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTP----KVVASPGLQRKSRIPT 19403
            +KV  LK+ L+   E +D  N  C  +I   G +   +E+DS    V  ++  ++  VSD E  VD  + ++ K + +   L  ++E     ++  ++PS +   +K+QL+ + +L+  ++ ++ S+D        ++   + + +K  L N+  ++  +Y++LLN A  +  +   AV L++  ++   P   WL +A+K L      P TV+  + E+ I E + LQ++   ++     LK ++ ++  + +  VS++  N I+   ++     ++    +  +          +    L  + +  F     ++KL  +D  P +  D+ E++ N++ E    +   +E + N+ +VG+ L  I  E + A I   K++ L   + ++  SA +K++L   +IP++E F   +   D V+  L  + R+  ++  +  E   E   +LE + +     SV++L   + N L  L S D      ++++   +   K    V + V ++A +I     +++   ++L   +E  S   ++I E +     +    S+L+  +I  TN  ++ N  K    +   ++KK+ RQ    G++  + +   VD  K+  E        + + L+ A+ L ++  S ++ L  WL + +  +  +  +    P     ++H   +E+  +  ++   +P+++        L +++   Q   + +   +  + Y  ++E ++ R   +++++       E+++     L+   DR+ ++   S  P  L+  L     I+  L   Q   D L+   +  S    +A + D +   +E KL ++    K ++ + ++    + ++L  A  FW++L   +    ++   L        +   + D+++++  +  E++     I  +S  GKQL + V      PD E+A   ++     VR      IT +  ++++ LI  +EE         +L +W      +L  + P+  E    +T+I Q  KEL   K+++  +    E +     QL   + P++   V   +A +N  W+RL   L +R+H+L+ ++L +G+    + +   W+  T  +L +I      +N  ++ +AQ K++    D++  Q SV+ + R A + I+    +L  E +  L+ +   WE++++   +  F++E A KEA    G+ ++  + ++E  S L   K +GGLP+TA+ QL  F    +D+      L   +    +   E  + +   + K        +  KW+ VK L   R+ +L+ A E        +    +W+   E+ L  Q  +SR+   I +Q+  H +   ++   +  M        H++Y  +K D + I+N + S+ HR EK+  R++ER++ L     E   ++D    L   I+  L  +  + +   +  K++ ++ + KE   ++      +D TR+ G  L ++A   + K+I      +  KW  +  K  +R +    A+L  G ++++M +L SW+   +E       +    D++ V+ L++E S    + + +++ ++ +   A ALM    ++   I      L   WN V + A  +   ++EA+  A EF+   ++L ++ +  E +L+   +   +E E +   M    G + + L           + G EIL    P AE  +++++ +++++W ++    ++R   L +   +  E+                   A +  EL+  + +   Q  +  E+ I D          + +  +++ P +      +K+   N             P    L ++WK++W   +  +  L +    L+E++ ++ + +EDW+ RY+ W +H+K+RV D FRR D  H G V R+ FIDGII         SKF T+R+EM  VAD FDK   G I+ ++F+ ALR D      KP  + E I  E++ Q   C+C  PY+I +  +  Y+FGDT   R+VRILRS VMVR+GGGW +LDEFL KHDPCR                      AKGR N  +  + + P   +++M  F      K  P T  P P  K         P +  +         +    H   +P   PR P  +++ R+S+    S    S+    TP       +S    R++RIP+
Sbjct: 2689 EKVRQLKESLKPVGEKMDAFNTDCKLLIKTAGPESDTKELDSLLKKVGDAYSDVVGKVSDKEMSVDAAVQQQGKVEDAYRALLNWLEETEEMMENRKKPSADAKVAKAQLHDYEVLMKHVEDKKPSVDGFKAMIEKIVAEASSDEEKKALGNKNAQIEDRYKDLLNSAVDRQRKLLDAVDLAERLQEVTIPLDSWLQSADKRLQALAKVPITVE--KAEEMIGEQEALQDE---LEHKSDDLKDVL-EIAPMLASLVSVEDANSISGQVNQLEARARALDAGITNMRPLLESFLQQIQDFTLDAEDMTQF-VGETEVKLGELDELPIEPDDLVEQT-NILAEIAVSIADRDEMMANIFEVGKQLA-IQGEPEEALIAQKKLDDLKFRYADLMTSADEKIALLAKAIPLSEGF---HEGFDTVMQVLEDMDRDLQTIDEEDPETQAELIFLLEEDISQKMRPSVDELTALS-NQLQVLCSAD----KADELQTNTIAMNKLVNSVADRVARRAERIEMASKQSRAVLDDLQYLIEWFSAARERILEGAPPSLDLEVLKSQLKHQRI--TNEEASAN--KVQFRNVAGEAKKVARQLGMEGNEANEKISDTVDEGKELVEEVMALCADRTETLERALALMEQLTSQFDELNKWLDQMDAELQASPSVTTATPAAELREMHDHNEELARMVAAY---RPIIEGFKSDVGSLHEVLAEDQAPLLESVAGELVQGYEEVREAVRARGHAIDNMMGATIGFGERLETLVANLQGAADRLRENEGISADPSVLESRLAENRSIVESLRDKQNAYDALK---QTASELLASAPEGDAAAGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLRNRLELVEPATGHPEQLADQQEIMAQVASEMERARPRIEALSIAGKQLADYV------PDDEKA--VIENQVANVRGGF-STITGLFAEKKRDLIAAMEEAMTFHGDLQELLKWLDMAEQKLLKMSPV--EHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPPKNAVNLRDIEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTS-GALDAETSDSLKSMNLKWEDIQKVLESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKT----HGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRLPDVIEKQLAEHESWMEEVAGRKMAMTKHQASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSEYKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL---DEVEGVKQEMDEAKGRYQECL-----------KKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQN--------EQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFA-------NLDSELREQQPEVDAACKSAKKGARN-------------PAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIG--------SKFPTSRLEMAKVADRFDK-GDGMINAKEFINALRFDASNRNAKPQTDTEKITHEIELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCR----------------------AKGRLNINMFPE-ARPIHALDSMRSFTKNRHGKQLPTTGTPGPIMKIREKTDRSVPMSGGLGGTAGYTVTTDSHRHTDARPSRIPRAPSDMSAGRLSRVGSVSNSKNSIVDSSTPSRPESRASSDAGDRQTRIPS 4799          

HSP 2 Score: 206.453 bits (524), Expect = 5.333e-52
Identity = 122/325 (37.54%), Postives = 186/325 (57.23%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQ------------SSK------------SDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQ--QNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKIYQFRNQYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVD 1301
            DERD +QK+TF  W+N HL K + ++ D+F DLRDG  L+ LLE L+ +++  +N  +RFH ++N+   LDFL+ +NIKLVNI  ED+V+GN KLTLGL+W IIL FQ   I Q            S+K            SD  S +  LLQW+R+    YP +N+ NFS+SW+DG AF A++H+ R   ID   IS +S    + L  AF  A +E GV ++++ EDV +   DEKS++TYV+SL+   P E ++       R    DL + L   +   N+  D    RI+  + R++ +    +++  +   + DD++ ++
Sbjct:   35 DERDNVQKKTFTKWVNKHLSKTDHKIDDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMS------RGNSNDLLSRLARGIGITNEKLDLILKRIEDVEARVDTSPPAAVER--TVSEIVDDLNALE 351          

HSP 3 Score: 171.785 bits (434), Expect = 1.606e-41
Identity = 184/812 (22.66%), Postives = 367/812 (45.20%), Query Frame = 3
Query: 1803 YSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKD---SVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICS-SKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENE--INKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQK-----DVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFE---SKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTK 4196
            +S + +   W+  +   ++ + F  DL+ L  ++E+      +I+D   +VDE  +  ++E   +   ++ +    L++++ +L    +    D  S + F+  +   + W+  +E  ++   W D + + L      +K L+ E+E+RE   N+    G  L    H A   I+  L  ++S+W W+L L+ CL+ HL      + F  EA++A+  I E + +L + + R     L+EGE   RE+ ++ E +  Y + +  +     S+S L  R   I P   + V A+C  S EN          G+ + L +NS    W + +        P++ F I     + +     L   F  LK LW K+   +R  ++L+TM  ++ W  + F +++P  R  I++ LN DAN+L+ +L     D N+    +    L + N  F  L ++          S +   P  A      +  D ++ +L+    +  +EL+  +  P+    + LE  +  HK FE  L+  +  V ++    +   + T   +V  +R+  LW+ LW+ + M+V ++K  E   + + E+  ++ + E+TL N  +  PA +D+++   +QL      I+ V   LK   T +DQL   V   RQ+       +  + D+  ++ E++ +  R+E + +QI  RL  V       +  ++E +   +W+  ++ T+ +++  P  +      + ++ L+ +  N Q    ++   I+ +NK    F++  + ++     Y + I    G   +  F  TK
Sbjct:  424 FSRVEECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDEC-IARQAEVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQWDWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNRT-DFSLEEGERFLRELDEIKEILNKYHQVLMALTERCASISPLWQRGERI-PHP-IKVTALCDYSDENVTIKA-----GDDVYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKHRMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSEL-----DPNDPLALRLREELRRTNEHFWNLLNA----------SQKPPEPDWA------SQYDQKMAELLKKLEEAWRELNDAVGKPISRSPEDLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRMYVERIKVLESVLNGMVEVADIVRQHEITL-NSFDDLPAALDKLRGHHSQLL----EINMV---LKQQQTVIDQLNRNVALLRQHVSRTRINEGHHPDVDAIEDEVQKLNVRWENVNSQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETI-NRLRKPEELRPEQYQQQLDMLIAEYTNLQ----EHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTK 1192          
BLAST of Dystonin vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 439.884 bits (1130), Expect = 1.631e-122
Identity = 506/2228 (22.71%), Postives = 1004/2228 (45.06%), Query Frame = 3
Query: 12957 QKVDPLKKQLE---ELIDIGNKACSTVISGLGFKHMEQEMDS----VKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLIN-TKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSP-TVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVD--PYQTRDIWEESLNLVKE----VKSHEETLKNLDQVGEDLKQISSENDSAAI-NCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNME---ILENETN-----SVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQ--APGSDL-KSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQN-KINNLDPD----QLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNI--DRQQSLITKLEEMRM------KLDEWFKEVNNRLFILGPLPTETRPVLTQI-QKTKEL---KNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMI--RADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRF----MDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWL-RAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQ-YNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF------KFKPAT-LPIPTKK---------PTTAKIPSPRVSQPLSSPRIH---QPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTP----KVVASPGLQRKSRIPT 19403
            +KV  LK+ L+   E +D  N  C  +I   G +   +E+DS    V  ++  ++  VSD E  VD  + ++ K + +   L  ++E     ++  ++PS +   +K+QL+ + +L+  ++ ++ S+D        ++   + + +K  L N+  ++  +Y++LLN A  +  +   AV L++  ++   P   WL +A+K L      P TV+  + E+ I E + LQ++   ++     LK ++ ++  + +  VS++  N I+   ++     ++    +  +          +    L  + +  F     ++KL  +D  P +  D+ E++ N++ E    +   +E + N+ +VG+ L  I  E + A I   K++ L   + ++  SA +K++L   +IP++E F   +   D V+  L  + R+  ++  +  E   E   +LE + +     SV++L   + N L  L S D      ++++   +   K    V + V ++A +I     +++   ++L   +E  S   ++I E +     +    S+L+  +I  TN  ++ N  K    +   ++KK+ RQ    G++  + +   VD  K+  E        + + L+ A+ L ++  S ++ L  WL + +  +  +  +    P     ++H   +E+  +  ++   +P+++        L +++   Q   + +   +  + Y  ++E ++ R   +++++       E+++     L+   DR+ ++   S  P  L+  L     I+  L   Q   D L+   +  S    +A + D +   +E KL ++    K ++ + ++    + ++L  A  FW++L   +    ++   L        +   + D+++++  +  E++     I  +S  GKQL + V      PD E+A   ++     VR      IT +  ++++ LI  +EE         +L +W      +L  + P+  E    +T+I Q  KEL   K+++  +    E +     QL   + P++   V   +A +N  W+RL   L +R+H+L+ ++L +G+    + +   W+  T  +L +I      +N  ++ +AQ K++    D++  Q SV+ + R A + I+    +L  E +  L+ +   WE++++   +  F++E A KEA    G+ ++  + ++E  S L   K +GGLP+TA+ QL  F    +D+      L   +    +   E  + +   + K        +  KW+ VK L   R+ +L+ A E        +    +W+   E+ L  Q  +SR+   I +Q+  H +   ++   +  M        H++Y  +K D + I+N + S+ HR EK+  R++ER++ L     E   ++D    L   I+  L  +  + +   +  K++ ++ + KE   ++      +D TR+ G  L ++A   + K+I      +  KW  +  K  +R +    A+L  G ++++M +L SW+   +E       +    D++ V+ L++E S    + + +++ ++ +   A ALM    ++   I      L   WN V + A  +   ++EA+  A EF+   ++L ++ +  E +L+   +   +E E +   M    G + + L           + G EIL    P AE  +++++ +++++W ++    ++R   L +   +  E+                   A +  EL+  + +   Q  +  E+ I D          + +  +++ P +      +K+   N             P    L ++WK++W   +  +  L +    L+E++ ++ + +EDW+ RY+ W +H+K+RV D FRR D  H G V R+ FIDGII         SKF T+R+EM  VAD FDK   G I+ ++F+ ALR D      KP  + E I  E++ Q   C+C  PY+I +  +  Y+FGDT   R+VRILRS VMVR+GGGW +LDEFL KHDPCR                      AKGR N  +  + + P   +++M  F      K  P T  P P  K         P +  +         +    H   +P   PR P  +++ R+S+    S    S+    TP       +S    R++RIP+
Sbjct: 2802 EKVRQLKESLKPVGEKMDAFNTDCKLLIKTAGPESDTKELDSLLKKVGDAYSDVVGKVSDKEMSVDAAVQQQGKVEDAYRALLNWLEETEEMMENRKKPSADAKVAKAQLHDYEVLMKHVEDKKPSVDGFKAMIEKIVAEASSDEEKKALGNKNAQIEDRYKDLLNSAVDRQRKLLDAVDLAERLQEVTIPLDSWLQSADKRLQALAKVPITVE--KAEEMIGEQEALQDE---LEHKSDDLKDVL-EIAPMLASLVSVEDANSISGQVNQLEARARALDAGITNMRPLLESFLQQIQDFTLDAEDMTQF-VGETEVKLGELDELPIEPDDLVEQT-NILAEIAVSIADRDEMMANIFEVGKQLA-IQGEPEEALIAQKKLDDLKFRYADLMTSADEKIALLAKAIPLSEGF---HEGFDTVMQVLEDMDRDLQTIDEEDPETQAELIFLLEEDISQKMRPSVDELTALS-NQLQVLCSAD----KADELQTNTIAMNKLVNSVADRVARRAERIEMASKQSRAVLDDLQYLIEWFSAARERILEGAPPSLDLEVLKSQLKHQRI--TNEEASAN--KVQFRNVAGEAKKVARQLGMEGNEANEKISDTVDEGKELVEEVMALCADRTETLERALALMEQLTSQFDELNKWLDQMDAELQASPSVTTATPAAELREMHDHNEELARMVAAY---RPIIEGFKSDVGSLHEVLAEDQAPLLESVAGELVQGYEEVREAVRARGHAIDNMMGATIGFGERLETLVANLQGAADRLRENEGISADPSVLESRLAENRSIVESLRDKQNAYDALK---QTASELLASAPEGDAAAGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLRNRLELVEPATGHPEQLADQQEIMAQVASEMERARPRIEALSIAGKQLADYV------PDDEKA--VIENQVANVRGGF-STITGLFAEKKRDLIAAMEEAMTFHGDLQELLKWLDMAEQKLLKMSPV--EHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPPKNAVNLRDIEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTS-GALDAETSDSLKSMNLKWEDIQKVLESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKT----HGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRLPDVIEKQLAEHESWMEEVAGRKMAMTKHQASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSEYKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL---DEVEGVKQEMDEAKGRYQECL-----------KKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQN--------EQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFA-------NLDSELREQQPEVDAACKSAKKGARN-------------PAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIG--------SKFPTSRLEMAKVADRFDK-GDGMINAKEFINALRFDASNRNAKPQTDTEKITHEIELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCR----------------------AKGRLNINMFPE-ARPIHALDSMRSFTKNRHGKQLPTTGTPGPIMKIREKTDRSVPMSGGLGGTAGYTVTTDSHRHTDARPSRIPRAPSDMSAGRLSRVGSVSNSKNSIVDSSTPSRPESRASSDAGDRQTRIPS 4912          

HSP 2 Score: 354.369 bits (908), Expect = 1.123e-96
Identity = 337/1330 (25.34%), Postives = 616/1330 (46.32%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQ------------SSK------------SDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQ--QNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIE----------EKIYQFRN------QYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTIST-----LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYP-ADQHYRIIININGK----IDKVKKKFEKLSPPTLSSGVISNRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKD---SVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICS-SKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENE--INKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQK-----DVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFE---SKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTK 4196
            DERD +QK+TF  W+N HL K + ++ D+F DLRDG  L+ LLE L+ +++  +N  +RFH ++N+   LDFL+ +NIKLVNI  ED+V+GN KLTLGL+W IIL FQ   I Q            S+K            SD  S +  LLQW+R+    YP +N+ NFS+SW+DG AF A++H+ R   ID   IS +S    + L  AF  A +E GV ++++ EDV +   DEKS++TYV+SL+   P E ++           E+ Y++R       Q  D   +L     EL   ++   FR D    R E        Q      +++ + KV R+ E     H +S      +W++ + +   +  +L     +   S  +   L         K++ I  +I  +   +  +P   +   ++ I  +L   E+ I      V+ELK   +P A+  Y+ +  ++ +    +D++  +   L    + +  +       + +M       +S + +   W+  +   ++ + F  DL+ L  ++E+      +I+D   +VDE  +  ++E   +   ++ +    L++++ +L    +    D  S + F+  +   + W+  +E  ++   W D + + L      +K L+ E+E+RE   N+    G  L    H A   I+  L  ++S+W W+L L+ CL+ HL      + F  EA++A+  I E + +L + + R     L+EGE   RE+ ++ E +  Y + +  +     S+S L  R   I P   + V A+C  S EN          G+ + L +NS    W + +        P++ F I     + +     L   F  LK LW K+   +R  ++L+TM  ++ W  + F +++P  R  I++ LN DAN+L+ +L     D N+    +    L + N  F  L ++          S +   P  A      +  D ++ +L+    +  +EL+  +  P+    + LE  +  HK FE  L+  +  V ++    +   + T   +V  +R+  LW+ LW+ + M+V ++K  E   + + E+  ++ + E+TL N  +  PA +D+++   +QL      I+ V   LK   T +DQL   V   RQ+       +  + D+  ++ E++ +  R+E + +QI  RL  V       +  ++E +   +W+  ++ T+ +++  P  +      + ++ L+ +  N Q    ++   I+ +NK    F++  + ++     Y + I    G   +  F  TK
Sbjct:   35 DERDNVQKKTFTKWVNKHLSKTDHKIDDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEEYIEEAYEWREWVVRAIQLVD-DRHLQGTASELI--YELQRFREDDLPPREE--------QKRRLTLVYEHLEKVMRSTELFAIPHELSAPELQRVWNELQNSIDRRFDVLERHRIQEGNSNDLLSRLARGIGITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFEDVEELKSMQHPEANDFYKQVYGLHQRRTTYLDRLTNQI--LVRLGVRTDSLHKENQQRLENMR---KTSFSRVEECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDEC-IARQAEVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQWDWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNR-TDFSLEEGERFLRELDEIKEILNKYHQVLMALTERCASISPLWQRGERI-PHP-IKVTALCDYSDENVTIKA-----GDDVYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKHRMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSEL-----DPNDPLALRLREELRRTNEHFWNLLNA----------SQKPPEPDWA------SQYDQKMAELLKKLEEAWRELNDAVGKPISRSPEDLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRMYVERIKVLESVLNGMVEVADIVRQHEITL-NSFDDLPAALDKLRGHHSQLL----EINMV---LKQQQTVIDQLNRNVALLRQHVSRTRINEGHHPDVDAIEDEVQKLNVRWENVNSQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETI-NRLRKPEELRPEQYQQQLDMLIAEYTNLQ----EHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTK 1305          
BLAST of Dystonin vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 439.884 bits (1130), Expect = 1.777e-122
Identity = 506/2228 (22.71%), Postives = 1004/2228 (45.06%), Query Frame = 3
Query: 12957 QKVDPLKKQLE---ELIDIGNKACSTVISGLGFKHMEQEMDS----VKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLIN-TKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSP-TVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVD--PYQTRDIWEESLNLVKE----VKSHEETLKNLDQVGEDLKQISSENDSAAI-NCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNME---ILENETN-----SVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQ--APGSDL-KSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQN-KINNLDPD----QLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNI--DRQQSLITKLEEMRM------KLDEWFKEVNNRLFILGPLPTETRPVLTQI-QKTKEL---KNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMI--RADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRF----MDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWL-RAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQ-YNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF------KFKPAT-LPIPTKK---------PTTAKIPSPRVSQPLSSPRIH---QPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTP----KVVASPGLQRKSRIPT 19403
            +KV  LK+ L+   E +D  N  C  +I   G +   +E+DS    V  ++  ++  VSD E  VD  + ++ K + +   L  ++E     ++  ++PS +   +K+QL+ + +L+  ++ ++ S+D        ++   + + +K  L N+  ++  +Y++LLN A  +  +   AV L++  ++   P   WL +A+K L      P TV+  + E+ I E + LQ++   ++     LK ++ ++  + +  VS++  N I+   ++     ++    +  +          +    L  + +  F     ++KL  +D  P +  D+ E++ N++ E    +   +E + N+ +VG+ L  I  E + A I   K++ L   + ++  SA +K++L   +IP++E F   +   D V+  L  + R+  ++  +  E   E   +LE + +     SV++L   + N L  L S D      ++++   +   K    V + V ++A +I     +++   ++L   +E  S   ++I E +     +    S+L+  +I  TN  ++ N  K    +   ++KK+ RQ    G++  + +   VD  K+  E        + + L+ A+ L ++  S ++ L  WL + +  +  +  +    P     ++H   +E+  +  ++   +P+++        L +++   Q   + +   +  + Y  ++E ++ R   +++++       E+++     L+   DR+ ++   S  P  L+  L     I+  L   Q   D L+   +  S    +A + D +   +E KL ++    K ++ + ++    + ++L  A  FW++L   +    ++   L        +   + D+++++  +  E++     I  +S  GKQL + V      PD E+A   ++     VR      IT +  ++++ LI  +EE         +L +W      +L  + P+  E    +T+I Q  KEL   K+++  +    E +     QL   + P++   V   +A +N  W+RL   L +R+H+L+ ++L +G+    + +   W+  T  +L +I      +N  ++ +AQ K++    D++  Q SV+ + R A + I+    +L  E +  L+ +   WE++++   +  F++E A KEA    G+ ++  + ++E  S L   K +GGLP+TA+ QL  F    +D+      L   +    +   E  + +   + K        +  KW+ VK L   R+ +L+ A E        +    +W+   E+ L  Q  +SR+   I +Q+  H +   ++   +  M        H++Y  +K D + I+N + S+ HR EK+  R++ER++ L     E   ++D    L   I+  L  +  + +   +  K++ ++ + KE   ++      +D TR+ G  L ++A   + K+I      +  KW  +  K  +R +    A+L  G ++++M +L SW+   +E       +    D++ V+ L++E S    + + +++ ++ +   A ALM    ++   I      L   WN V + A  +   ++EA+  A EF+   ++L ++ +  E +L+   +   +E E +   M    G + + L           + G EIL    P AE  +++++ +++++W ++    ++R   L +   +  E+                   A +  EL+  + +   Q  +  E+ I D          + +  +++ P +      +K+   N             P    L ++WK++W   +  +  L +    L+E++ ++ + +EDW+ RY+ W +H+K+RV D FRR D  H G V R+ FIDGII         SKF T+R+EM  VAD FDK   G I+ ++F+ ALR D      KP  + E I  E++ Q   C+C  PY+I +  +  Y+FGDT   R+VRILRS VMVR+GGGW +LDEFL KHDPCR                      AKGR N  +  + + P   +++M  F      K  P T  P P  K         P +  +         +    H   +P   PR P  +++ R+S+    S    S+    TP       +S    R++RIP+
Sbjct: 2814 EKVRQLKESLKPVGEKMDAFNTDCKLLIKTAGPESDTKELDSLLKKVGDAYSDVVGKVSDKEMSVDAAVQQQGKVEDAYRALLNWLEETEEMMENRKKPSADAKVAKAQLHDYEVLMKHVEDKKPSVDGFKAMIEKIVAEASSDEEKKALGNKNAQIEDRYKDLLNSAVDRQRKLLDAVDLAERLQEVTIPLDSWLQSADKRLQALAKVPITVE--KAEEMIGEQEALQDE---LEHKSDDLKDVL-EIAPMLASLVSVEDANSISGQVNQLEARARALDAGITNMRPLLESFLQQIQDFTLDAEDMTQF-VGETEVKLGELDELPIEPDDLVEQT-NILAEIAVSIADRDEMMANIFEVGKQLA-IQGEPEEALIAQKKLDDLKFRYADLMTSADEKIALLAKAIPLSEGF---HEGFDTVMQVLEDMDRDLQTIDEEDPETQAELIFLLEEDISQKMRPSVDELTALS-NQLQVLCSAD----KADELQTNTIAMNKLVNSVADRVARRAERIEMASKQSRAVLDDLQYLIEWFSAARERILEGAPPSLDLEVLKSQLKHQRI--TNEEASAN--KVQFRNVAGEAKKVARQLGMEGNEANEKISDTVDEGKELVEEVMALCADRTETLERALALMEQLTSQFDELNKWLDQMDAELQASPSVTTATPAAELREMHDHNEELARMVAAY---RPIIEGFKSDVGSLHEVLAEDQAPLLESVAGELVQGYEEVREAVRARGHAIDNMMGATIGFGERLETLVANLQGAADRLRENEGISADPSVLESRLAENRSIVESLRDKQNAYDALK---QTASELLASAPEGDAAAGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKAVDDLRNRLELVEPATGHPEQLADQQEIMAQVASEMERARPRIEALSIAGKQLADYV------PDDEKA--VIENQVANVRGGF-STITGLFAEKKRDLIAAMEEAMTFHGDLQELLKWLDMAEQKLLKMSPV--EHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVADLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPPKNAVNLRDIEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTS-GALDAETSDSLKSMNLKWEDIQKVLESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKALKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKT----HGAMKTKWNKVKELLVDREKKLQVAYEQAVALESALNDMEDWIIAAERKLTDQPSISRLPDVIEKQLAEHESWMEEVAGRKMAMTKHQASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQDGLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGLAERATRSEYKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDDELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKDSIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL---DEVEGVKQEMDEAKGRYQECL-----------KKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDEREFTLLEQEQKAKEQN--------EQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFA-------NLDSELREQQPEVDAACKSAKKGARN-------------PAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEGWKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIG--------SKFPTSRLEMAKVADRFDK-GDGMINAKEFINALRFDASNRNAKPQTDTEKITHEIELQKKTCSCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCR----------------------AKGRLNINMFPE-ARPIHALDSMRSFTKNRHGKQLPTTGTPGPIMKIREKTDRSVPMSGGLGGTAGYTVTTDSHRHTDARPSRIPRAPSDMSAGRLSRVGSVSNSKNSIVDSSTPSRPESRASSDAGDRQTRIPS 4924          

HSP 2 Score: 352.443 bits (903), Expect = 4.515e-96
Identity = 332/1337 (24.83%), Postives = 617/1337 (46.15%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQ------------SSK------------SDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQ--QNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIE----------EKIYQFRN------QYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTIST-----LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYP-ADQHYRIIININGK----IDKVKKKFEKLSPPTLSSGVISNRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKD---SVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICS-SKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENE--INKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIK------------ILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFE---SKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTK 4196
            DERD +QK+TF  W+N HL K + ++ D+F DLRDG  L+ LLE L+ +++  +N  +RFH ++N+   LDFL+ +NIKLVNI  ED+V+GN KLTLGL+W IIL FQ   I Q            S+K            SD  S +  LLQW+R+    YP +N+ NFS+SW+DG AF A++H+ R   ID   IS +S    + L  AF  A +E GV ++++ EDV +   DEKS++TYV+SL+   P E ++           E+ Y++R       Q  D   +L     EL   ++   FR D    R E        Q      +++ + KV R+ E     H +S      +W++ + +   +  +L     +   S  +   L         K++ I  +I  +   +  +P   +   ++ I  +L   E+ I      V+ELK   +P A+  Y+ +  ++ +    +D++  +   L    + +  +       + +M       +S + +   W+  +   ++ + F  DL+ L  ++E+      +I+D   +VDE  +  ++E   +   ++ +    L++++ +L    +    D  S + F+  +   + W+  +E  ++   W D + + L      +K L+ E+E+RE   N+    G  L    H A   I+  L  ++S+W W+L L+ CL+ HL      + F  EA++A+  I E + +L + + R     L+EGE   RE+ ++ E +  Y + +  +     S+S L  R   I P   + V A+C  S EN          G+ + L +NS    W + +        P++ F I     + +     L   F  LK LW K+   +R  ++L+TM  ++ W  + F +++P  R  I++ LN DAN+L+ +L     D N+    +    L + N  F  L ++          S +   P  A      +  D ++ +L+    +  +EL+  +  P+    + LE  +  HK FE  L+  +  V ++    +   + T   +V  +R+  LW+ LW+ + M+V ++K  E   + + E+  ++ + E+TL N  +  PA +D+++            + +++L A  +  S     +  +  N+  L   V+ +R N+    + D+  ++ E++ +  R+E + +QI  RL  V       +  ++E +   +W+  ++ T+ +++  P  +      + ++ L+ +  N Q    ++   I+ +NK    F++  + ++     Y + I    G   +  F  TK
Sbjct:   35 DERDNVQKKTFTKWVNKHLSKTDHKIDDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEEYIEEAYEWREWVVRAIQLVD-DRHLQGTASELI--YELQRFREDDLPPREE--------QKRRLTLVYEHLEKVMRSTELFAIPHELSAPELQRVWNELQNSIDRRFDVLERHRIQEGNSNDLLSRLARGIGITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFEDVEELKSMQHPEANDFYKQVYGLHQRRTTYLDRLTNQI--LVRLGVRTDSLHKENQQRLENMR---KTSFSRVEECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDEC-IARQAEVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQWDWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNRT-DFSLEEGERFLRELDEIKEILNKYHQVLMALTERCASISPLWQRGERI-PHP-IKVTALCDYSDENVTIKA-----GDDVYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKHRMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSEL-----DPNDPLALRLREELRRTNEHFWNLLNA----------SQKPPEPDWA------SQYDQKMAELLKKLEEAWRELNDAVGKPISRSPEDLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRMYVERIKVLESVLNGMVEVADIVRQHEITL-NSFDDLPAALDKLRGHHSQLLEINMVLKVSKLGAQNEHFSQQQTVIDQLNRNVALLRQHVSRTRINEG--HHPDVDAIEDEVQKLNVRWENVNSQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETI-NRLRKPEELRPEQYQQQLDMLIAEYTNLQ----EHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTK 1317          
BLAST of Dystonin vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0087621)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 656/2509 (26.15%), Postives = 1246/2509 (49.66%), Query Frame = 3
Query: 12297 KLESEIKTTQSDMHLIKPDMENTKLL---IASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE-----------QKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEES---LNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALV-----RENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTIND-----------SKKLIRQAPGSD-LKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF----PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILER---DTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL---------IPIFDRSKRMETNQGI-----SKI-------------------------QEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIH-------QPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVA---------------------------SPGLQRKSRIP-TRQTSQQGSQASTRHQS 19451
            KL   +K  + ++  +   +++ K L   I++ A+ +  +A  L  E++ + +R   L   L  +   L S   A+ +   +++       +L  +I+       ++  ++ QI D+  ++ + + +   L + +   + L +           ++I T  K++ ++DN           + D +++L    K + EF   ++  +  I + +++     P  ++L  +    ++   F E+KV+PL   ++++   G     +  SG+    +E++++ +   ++ L + +++ +  +D+ L++  KF  +L  L +++ +    +  ++ PS +Y   K+QL   + L   L  RQ+S+  L   G ++  + +  +++ ++ +L++L  +++ L + AE +    + A++++K F D   P  +WLD  E+++   +  PT D  ++++RI+E+  L ++          L  +  ++  + S+  +++   K+  + +R++    +      +        +     V  ++D +   ES   +LK     P     + E+    L L + +  H   +++  + G +L +  S +++  +  K++ L   + +++      L   +N++P+ ++F  A+N+L   + S  A +     R+ D L  +    +M  + +  N V   +CQ          +   E +   +E I   + +RF  ++ ++ +KA ++  +  +AK    ++D+ +E     +  + E       D   +E        L+ A  ++  SIN  I+            SKK++R++P S+   +L+  +D +K+  ++  +    +   L++A+PL++ F  S+  L  WL + E+ + +  +  L PDQ+   + + + L  S  + KPLLD + K+G  L  +V    G  I   ++    RY  ++  ++ R   LE  +  +++ ++K++     L N  D++      S  P+K+ E++   D ++ DLDK Q     +Q    +     K  N  D +V +I  KL K+++    +Q+ T +    + ++LS+A  FW  L  +     ++   L+         + +  ++  ++++R EID  + ++ ++ + G  L+     P++ P+V++  E+L   ++ + +   ++  N+        +  E    L ++  +  ++   LG + ++   V  QI++ K  K++++P   ++E +N+   +LT+ + P     +   L+ +N  W  LL G+ +RQ QL+  LL LG+F  A++E + WI  T+++L  +K   GD   LE+ LA+ K++  D+   Q SV  +     ++I+ +  S+    TQ +L +L   W++L + A  +  ELE+AL+EA  +  + Q+I   + ++ + +   K  GGLP+TA EQL+RFM++Y       PK+     +  E     ++    S    ++  +  L ++WD V + A  +K +LE A++    FH  +  F+ WLT  EK L+   PVSR++ TI  Q+E H+ L++D+++HRE ML LDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R LD+GYKEA+ F D    ++  +    ++L++   + +  + P KI++ I K KE H  LG     YD T R G  L ++AP  D   +D+++  L+ +W  + +KSI+R++ L +ALLLSG + DA+  LL WL+  + +L+++     GD+ TVQ L   H  +E+ L+ R   ++ +      L  +   ++  +  QL E++S W  V     ++  RL+ A   A +      +L ++   +EH+LR    +P++EK  +   M+  H  F K+L + E +  +  ++  +I+  AYP+A   IK++++II+ +W ++  W+  R   L+ HL  L +    +++LL WL+  EGTLL  +  +L   +   +    +H+ F+ +   +Q + D       ++ PP           P+F  S+    +QG+     S+I                          E  F +P+   L +KW+ VW +   R++ L DH+ YLK+VE  +NF+++DWR+R++ +MNH KSR+ D FR+ D D++G + R  FIDGI++        +KF T+ +EM+ VAD+FD+   G ID+++F+AALRPD +  + KPAN+++ IHDEVK+ +  CTC   +++ Q G+GKY+FGD++KLRLVRILRS VMVR+GGGW ALDEFL K+DPCR                      AKGRTN ELRE+     G   +MA F  + +T       P  A   S       SSP  H        P  S + P      R  ++IP SR S+S  S  TP  ++                           +PG  R    P +R  S+QGS+  +RH S
Sbjct: 6259 KLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGRLDN----------RVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT-DEEKIQQRIREHDRLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDA---SDNIGALLAESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQ----------LSPGEGA-ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREA------DLPAME------PKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIA--KAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDK-PEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSS--SNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGP-VHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDL--ERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAPDDEK--VSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRAC--KPRQLPPGARKPSRSGKTPVFKGSR----DQGLNARKGSRITPTRDTPDRDRLPHYGPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILN--------TKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQ--ERKPANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR----------------------AKGRTNIELREQFILADGVSQSMAAFTPRRST-------PNAAATAS-------SSPHAHNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGS 8668          

HSP 2 Score: 320.472 bits (820), Expect = 3.309e-86
Identity = 271/1125 (24.09%), Postives = 525/1125 (46.67%), Query Frame = 3
Query:  726 QFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDI--------EEKIYQFRN---QYADLYANLNSALEELNDDF------------DHNDFRID-FNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGV--ISNRQYTPIH-------------SMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTF-----NEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIG 3938
            +  DIV   K D++S ++ LL+W+R++   YP + + +F++SW+DG AF AL+H+ RPDL+D +    +  ++ LE AF+  +KE GV ++++PEDV +   DEKS++TY++SL+++ P+   I        + +++++R+   Q+        + L+E +  F            D   FR D  +  + E + L  +  Y+     F+ + +VD   E + +   I   W +  T  +++ +IL  E ++++R ++++  +  E   +  K+ ++E +I +    + +    +    + ++  E+   E  I +M      L    YP       +  ++ K++K+ +++ +L     ++ V  +S  +Y P+H             S ++  N  +  L +   W   K   +   ++ +DL  +          +KI ++F T        + K S DE  +             + Q  N L+  + EL    +K  +D  S   FL +++  + W+  KE  +I   W D + + L      ++NL+ ELE RE      +  G  L    H A+  I+  L  L+ +W W+L LT CL+ HL+    Y QFF E  +A+  + +    LNS+F +    GLD+GE L R ++D+ E +  + ETV  +   +Q+V  L+ R   +   ++  V+AIC+ K+       Q  +GE + L +NSG   WRV  ++ +    P  C L+     +A   A  L   F     LW K+ L+LR+ ++ +T+ +VK W  + F  + P  R  I   LN DA++L   L   + ++ ++ +    +++ N  F E         + R  + + S     +  E   ++  +L+D       M +EL   + +P+  D+D LE  +  H ++E  L   EP++  L    +    +T  LK  L+ +++LW++L  ++ +   +LK  E   + L++ + VI E+E  L  +++  P+  + ++ +  QL   QD I+     +  +    DQL       R         D+++L   ++ +  R+  + NQ+ +R+            L++ ++  ++W+ G
Sbjct:  210 EISDIV-VGKEDNVSAREALLRWARRSTARYPGVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERS--FPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQI--YKELERYFETVGEVD--VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPH------VSELHKKVNKLHQRWAQLRTNFHTNLVQKLSGLKY-PVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELAL-------------YQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ-LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQS-DFGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPV--NRQGPVQAICAYKQQGQL---QIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKL---LSEGDPNDPQLRRLRREMDEVNRLFDEF--------EKRARAEEESKQASRIFTEECLAIKSKLED-------MARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHVISELENELA-RHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQL------GRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDG 1275          

HSP 3 Score: 143.665 bits (361), Expect = 6.915e-33
Identity = 497/2409 (20.63%), Postives = 948/2409 (39.35%), Query Frame = 3
Query: 5037 KQIKFLDPITNTELKYTDAIRYQYINDDISEILFVD-----PSENSFHL-----------TTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEF---------------------------PF-------LVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLV---------TENGKIIVDKNKPSLSFLDA----FNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEA------IDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSN--QILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDP-IRCEIRDNCGHIITL-----NDAIN--EDLFPE-----FVP------------TDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNVTVYMT-----------------------------DVQNS------VQNK---TLEI--------PNEEKFVDTKTTKTLESIKRNYFGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRK----PSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIINP-----NTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNY-----YYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIIT--LTNRSLYFENLNKRHDNYQIIS--VYDP--------RINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLHTIMKT---------RQYMPL-SC---PFTNVHIRTIEEEMNFSIPQSLPENVLRVFSQKPNDNKNVEGLIITSTSVN----LDHEIQIKTDNN--KNQVDINQADAPNFAKNYIEMVKSEMEKLSVIEQK---LLKEVNVF-------------LNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRS-RLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISN-----VKSVEDLQKSLTDLKLLDN------EFAS----YNNDIRVLIGSKIKFIDK----INKLEEQRKKFSD-LVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQ-------KILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIK-NIGSLSLDPKYINEQERLIQTILAEISSRQPFLENV------LMNNAS------RNEPKLKELDDKIKQKLLVASNIEAK-VNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPL---SPTSITKQPTTAN--RQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQ--DLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEE-------IQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKID 11486
            + I   DP++   +    AI    ++     ++ +      P E +F L           + + AV+   +DPE+G +FD    + + +  + + G++   IS++   + K E                            PF       L+  +N   S+ E L R     ++   + P   ++I L +A++ G V          ++ KI+  K    +  LD      +   I L+E+ + G       P     L+L+  +  G+ D    KF  TI ++Q  LK A   K I                 N E+L +L    E++I I              +I +GY D I          ++  P     +S+ E             ENR                 I +   RKR              D +Y    D     F   +N  ++E++   + I+   +   S   V N  + + +    A E GI+D   G  +  +D         +  IL   +EA      I+  VK++ +E+    F DP SG  ++  +A+   L+D       + K+   + L +  A+D G +  +    KL   N  +T     FD GI+   N  +S  +  AI+    D     L  P  GR I L E++ + + +P + C   +    + TL     N  IN  E +F E     FVP             +       E L  G+ +  T     P  +    + EA  ++++    S V  + T                             D+Q +      V N+   +LE+        P   KF D  T + L+ I+  + G    +  +   K+    +ELPL+ A +     V++     P +     + + L    L T   +T  +T         +S +L    P     +  R+++LEEAI+ NI DP   ++R   +     +  +V+ GL+      +  +  ++    + + +      YV + V       ++ L             D +TG   T +     GS  A   +    N SL      K +   +  S  V DP           +L+   EA  + +++   +  +N +T+++ TL +A + GL+ T  ++           Y P   C   PF  +H   I     F++ +++   ++   S    D     G+I+  T+      +D      TD N  KN +D+ +A          E  ++  EK ++ E+    LLK V                ++E  NQ  ++  + + +E  SQQ  V T + +I + ++   D +       LE +   L++  ++    +N+R+ RLL            RL        KL+  +D  S+      +++ED ++SL+DL  L +      EF S    +  D+R +  +  KF+D+    +  L + R    + L  V  +S+ +S   QE++     +   Q      YK  L+++  + + +  L  +Q++     + + E L+       +I+S         +    +    L+ E++S+ +++   + +L N ++SL    +  E I+    PI    N +  +   L E  + +++  + +     ++++L  W+ + + + K N+   SL  + + EQ R  + +LA++ S Q  +++V      L+ +AS      + E  L ++  K  +KL   +N   + ++D    L  +   + +    +A   E L  R    L  E+   +++E+    +      E   +  K+L+S  +  D   +   ++ LE  W ++N  I+ R+K    +      Y  LK +++  L + E  ++   P+AIDL  ++ QH++++    ++    P I++   IG++YD+++           +  SP RK S       T PL   S  + +  PT           S    S  SS D   L+ E S    ++++I +RY  IG +L +R+ ++  L  +     +  K  +  L+    +L    V N    +  I+  R   +    + +L +  T  Q  D+LR +  VPG  +L+ + D +++K+ +L D  K  +         +   G +K  +++    KERML VLGP+ +      +Q+QQV  L +E    +  +K  + +G +++  ++ T  +   +E  L  +  K D+L   L DR  ++      SK+F   +N + + L  + + +D     + T  D +E       ++ +L+  + +L + E  + TL   + D  +  ++ ++V+ L +    +Q K+D
Sbjct: 3768 QSISVRDPVSGEVIPLRMAIELGVVDMQAGTVIDIQTLKEIPMELAFQLGFLVPGARKPISLEAAVRKGLYDPETGKLFDSESQNQVDVQKSIEIGLVDPKISLIVDTVTKKEVKLDCAIEDDLVLPATGQIKDNKNNTLVPFDVGVQQCLLKTDNVTWSLPELLQREYYTPSTGKVLNPVTGEEILLQQAIEMGFVELETTLVKDVDHDKILPGKEAAKVGLLDTVRGTLSSPNISLDEAFVKGYLISTKKP-----LSLVDCLLRGLYDPSTAKF--TIDDKQLDLKAAIAQKLI-----------------NPEELVLLDPKTESIISITE------------AIAKGYLDPIEG--------YVINPYASTKLSLHEA-----------LENR-----------------ILIPPKRKRSL-----------PDAVYRGLYDPKTGQF---SNTVTREKLTTERAIRRGILDPDST--VVNVGSGQIIPFGVATETGIVDSKHGTVRDADDHPIDFKEAFDRGIL---VEAKKPLRLIEAVVKNVYDEVDG-HFVDPKSGEKLNFAEALNTNLLDEHSVQIRDFKTGLYKQLNLTHAKDTGII--DAQNSKLLYNNQTMTLKHA-FDIGILMDVNAPIS--IQRAIHQGLFDDKTGKLSDPRTGRQITLLESMRSFVVNPHLPCYFDEQTEQMYTLSETCRNGIINRREGVFREPGSNSFVPLGEALSLGLIVDIENAGFGLYELLSMGFYETSTRKVLHPVTNRKLNLNEACVEDVVSLSSSLVKHHETGKYLRLANAIKEQLVDDSRGCYNLGNEQLDLQAARARGLIVSNRRLLSLELVLRQQLYRPETGKFCDPTTGEYLDLIEAIHSGFIDPATTV--FKNQLTGKELPLTEAIENGDIDVSKGRVFDPKSKSAYNYDVALSRGILVT---ITRPLTDRNDVVRRQDSVELLNQTPVSVVISKPREMSLEEAIRYNIIDPKTALVRDFDSFKFLPYSVAVERGLV------DTTKRTLVDPKALYFAFDPTLIVYVREPVTFDQAAESKCL-------------DLQTG-LLTYVPASVPGSATAAPASDDSANDSLTVIETPKVYTLKEAASAGVVDPDSALVKDLAKAKLVRLPEAFRKGLMDANKANVLNTQTSKLCTLQEAYESGLICTPKRSFGLLEAITFNLYNPTNGCLVDPF-QMHPDIIRRR-KFTLAEAIGSGLVDPSSTVVRDPST--GVIVPLTAAISSGLIDATEGRLTDANEPKNNIDLVKAAEKGLLLPA-EQRQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREKIDELRNQ--INALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDR----VNDRTVRLL-----------RRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVS-----LVSAQ------YKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPME-INQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKF-EKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKINDIGAQYDALI-----------RPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRRSSQDGFQLS-ELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT-TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDS----KERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGT-PDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLD----TLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLD 5997          

HSP 4 Score: 97.4413 bits (241), Expect = 5.965e-19
Identity = 344/1843 (18.67%), Postives = 762/1843 (41.35%), Query Frame = 3
Query: 12783 IIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSE--------QKVDPLKKQLEE----LIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDL--------DAEEEPSIEYHKS--KSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND---DSSIDESIKKLKIIINKVDGVFSENVSID---TKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFE---SAMKDLKLNIVDPY---QTRDIWEESLNLVKEVKSHEETLKNLD----QVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDI-----FVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNF----EQKINEMSDQINNDY-------SELEECKI---DFTNLLSAWNEQK-ESINSTIND----SKKLIRQA-PGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYD--LDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-DKKKLIEDLRGEIDVHEKDIGKIS------QKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR--LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKR----FMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATH-LKYISQKHDIVL--IRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQ-SEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGS-IKHYINIIKSQWSDLLSWSEQRGLNLKDHL 18062
            ++  +DDR NSL               D  ++ D A N   L + L N S N+             +K++ L++QLE     L D+  ++ +T+ + LG      +++S   + ++  Q ++ ++  +D    K+ + + SL + + F EN S+ L        +  +   +  HK   + Q+++H  +   +  R+  +  L   G DL   T   +   ++ +LD +  ++E L   A  ++ R    ++  K +    E  L WL TAE  LA+  T   +   ++E R+++ +  +++    S   E+ K L          F  +  ID    K ++  + DR+         +   +      L ++ D++   + +L   E   +A   L     DP    + + I EE  NL K ++S +   K++       G D   ++SE D  A   +++ L    D+       +    +++     +F   N ++  +   L  L  E + L+     R ++I++ + + V K+    +  LD+L  V   E++ E+  D+     F  +  + +E ++ + K    +G    + +  E+NL   ++ L  F     Q ++++ D +++++       SEL++ +    DF N    + E+K E +   ++      + L+R A  G    +++  ++++  +     + +  + ++LD A+  + +F  +   L  WL +TEE +   K  + D   +    QE K L     D++  +  +   G  ++      +  +I   + D  KR++ + +  + R  DLE+ + +    ++K+      L+N    +          EK+ + +   D  L+D  L K   F D     + + +    +    +++V + EK+  ++    GL    ++  + I  LL+ + +    L L    + ++   + +   E    +SV    +KL+E +   ++++E   G  S      + G +L++ ++N +E   ++   + L+R +  + +     + +      L+ +  E   +L EW +     L      P+E R           L+ ++      ++ INQ+G QL + S       + S + R N  +  +++ + ++  +L        E    +DE +EW    + +L    +   +   +   L +H+ I  D++  +  V  +   + ++++E   S  + AT R  L+ L++  + + +    +   LE AL  +  F    Q ++  +D++  ++         PD    Q  +       I    P L+   +      A ++      I + ++ D      ++  ++     R+  LE A++    F   +   +  L  T   +NQ  P+S +   I EQ+E + AL  D+   ++    + + A   +     K D  +  I+  +  +++ W  V + + +R  +LD     A+ F     +++  +    E L         P  I++Q    +E    +       +  RR G  L +     D  ++ + + +L   W ++     +RE+ L DA+  +  + + + NLL +L   E K +      G D++ V+  + +    + ++      +E +N  A+ L  + S E ++ I + L+ +   W  + +   E++++LE A     +F+   N L  + +K++  L Q    P +   +L+   ++   +   ++  ++  ++     G +++ +     E S  +  +  + ++W  LL  +  R   L++ L
Sbjct: 5886 LVGKLDDRANSL-----------GGAADSSKEFDAAVN--RLREALQNISDNLDTLPTDGDHQENLRKIENLERQLEGQRPLLADV-EQSAATLCNILGDPASRADVNSRVAALEK--QYLA-LQKKLD---TKKAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIYREVMAREHEVIMLINKGKDL---TDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADL-TPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGL-------GETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLA--DRMSELQGRLDD-------RCGELQSAATAVSQF---NEQMKSLGIDLNDLETEIEKLSPP--GREIKIVQVQIDDVGKI----QTKLDRL--VGRLEDA-ERAADVLVDAGFAADTTQTREQISTLRK---TLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQD-VSDEFKRMKPVGSELDQIRRQQEDFRN----FRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDR-LHDEILGKKPDFSD-----LADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGL----VDASDNIGALLAESRQGLRHLVL---SYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISN-DEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAAL-----APSEPRQA-----DVLRLEGELADMRPILDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQS-ENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDN----ARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGA-VGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGD--PQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEAL 7636          

HSP 5 Score: 83.1889 bits (204), Expect = 1.083e-14
Identity = 131/600 (21.83%), Postives = 232/600 (38.67%), Query Frame = 3
Query: 5595 IIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQ----------------------------------------------AINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRI---VFLTCPLIKFSISIDEIAINIDQTECNLFE------NRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNY-KIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEA--EDL------GFVLTEKLEIKLPTINDLITQGLVD------FDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHI--------------ITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNVTV 7121
            I  P   + LT+  AIQL I+D +  + +  + + + +L++A +   I   L K L       + +  +L++L+                                              AI    +D KTG ++   + Q IS+ E Y    +  ++   I          I   + +D      D+   + F       N+ +  ++  V D+K++  I+L EA +   +N   G Y +E  +   +F +A +   I                   +       + + +P+ +E +S  QA+E G++D   GN  K I      + + + EAI  G +         L  E K   ++D ++G +IS  +A+E+GL+           + F + +SN  ++ N A   DL      GF L    +  +P +   +++GLV       F  GI         +++ + +  N ID     L  P  G  + L  AIE     P    +  +  +I              +T+     E       P D   +TF EA+ QG+ID +   F+DP+  N+Y V++AL   +L  P SN TV
Sbjct: 1501 IRDPRTGRVLTIGEAIQLRILDVRTGEML--VGDRRITLEQAADQGLIDLQLAKQLLEPGAGRDASGRELSLLEVIQREISEAESGYETAEKRIKVNNTVTVEQTSGELGSPENPRNIADAITAGSVDTKTG-LYRVKSGQTISLAEAYERGYLIRHESVTIKSNALCLSDAIAHGL-VDGAGWIADRNSGDKFRLDSAIANQLIDASVREVVDAKRDTKITLQEALQSGVLNAKTGRYVNEVTKEKLTFAEARNRQLIVK---------PYTLKDICDLNLLDKQAQITSPMRREKLSIMQAIEAGVLD---GNLLKCITKRKGEL-VTLQEAIADGIV---------LPAECK---YRDFMTGELISIPEAVERGLISSVAQRSIFDIDGFKDLRSNDYVSFNVALSRDLLRRKSTGFALETGRDSLVP-LEVAVSEGLVRQEVYEMFSRGIGVQNASGKELSVFDLVYHNLIDPKTGYLLDPKTGETVPLDTAIERKFITPEGALLLSSLLNITLTTETVTRTINRYVTIRAGSQE-------PVDSVLLTFTEAVRQGFIDEERQLFKDPKTGNIYSVQQALNYGLL-VPDSNQTV 2062          

HSP 6 Score: 80.1073 bits (196), Expect = 9.680e-14
Identity = 144/665 (21.65%), Postives = 256/665 (38.50%), Query Frame = 3
Query: 5034 DKQIKFLDPITNTELKYTDAIRYQYINDDISEILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVT---------ENGKIIVDKNKPSLSFLDAFNKGYIKLNESL--ISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPI----TKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKII------GFKDPISGGIISP----------------IDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPN-------REVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD 6896
            DK  K  DP T  ++   +++R   +N  +    F + +E  + L+  E  +N   +   G   +   +S++PL  A   G++                   VDI N    + E L  G  + ++   + P  ++K++L EA    +V+         E GK +   N      +D     Y   NE L   +   + +I  N  + L+L   ++  +   +  KF +  T E   L EA  + FI  +     TV+     G  ++L + +AI    ID+  G++FD  +    +     YD  ++      +V +T PL       +++    D  E        L QT  +V  SK  E +SL+EA + + I+    +        +  ++ A++   + T                   +   ++   F+P      +E V+  QA E   +D  +G          +  +P   A + G   A      S N+ L +I        K+  S G++ P                 +A  KGL+D    N  NT+++++ T+ EA + G + T K    L    + IT  L +  +G +  P        R    TL EAI S  +D   ++++ P  G  + L  AI + L D     + D
Sbjct: 4327 DKTGKLSDPRTGRQITLLESMRSFVVNPHLP-CYFDEQTEQMYTLS--ETCRNGIINRREGVFREPGSNSFVPLGEALSLGLI-------------------VDIENAGFGLYELLSMGFYETSTRKVLHPVTNRKLNLNEACVEDVVSLSSSLVKHHETGKYLRLANAIKEQLVDDSRGCYNLGNEQLDLQAARARGLIVSN-RRLLSLELVLRQQLYRPETGKFCDPTTGEYLDLIEAIHSGFIDPAT----TVFKNQLTG--KELPLTEAIENGDIDVSKGRVFDPKSKSAYN-----YDVALSRGI---LVTITRPLTDR----NDVVRRQDSVEL-------LNQTPVSVVISKPRE-MSLEEAIRYNIIDPKTALVRDFDSFKFLPYSVAVERGLVDTTKR--------------TLVDPKALYFAFDPTLIVYVREPVTFDQAAESKCLDLQTG---------LLTYVP---ASVPGSATAAPASDDSANDSLTVIETPKVYTLKEAASAGVVDPDSALVKDLAKAKLVRLPEAFRKGLMDANKANVLNTQTSKLCTLQEAYESGLICTPKRSFGL---LEAITFNLYNPTNGCLVDPFQMHPDIIRRRKFTLAEAIGSGLVDPSSTVVRDPSTGVIVPLTAAISSGLIDATEGRLTD 4913          

HSP 7 Score: 73.559 bits (179), Expect = 1.081e-11
Identity = 67/262 (25.57%), Postives = 121/262 (46.18%), Query Frame = 3
Query: 5364 SISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSL-LKD------LTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFI 6125
            S++EA  RG +  +   +IK N    + L +A+ +GLV   G  I D+N      LD+       +   LI    +E++      K+TL  A+Q G+++ K  +++N +T E+ +  EA   + I K   LKD      L     IT+    EKL+I+QAI   ++D    +   +   + +++ E   D I+   +     F+T  LI    +++   I+    + ++F+       I    D + N+Y+S + A  RD +
Sbjct: 1641 SLAEAYERGYLIRHESVTIKSN---ALCLSDAIAHGLVDGAG-WIADRNSGDKFRLDS------AIANQLIDASVREVVDAKRDTKITLQEALQSGVLNAKTGRYVNEVTKEKLTFAEARNRQLIVKPYTLKDICDLNLLDKQAQITSPMRREKLSIMQAIEAGVLDGNLLKCITKRKGELVTLQEAIADGIVLPAECKYRDFMTGELISIPEAVERGLIS-SVAQRSIFD-------IDGFKDLRSNDYVSFNVALSRDLL 1884          

HSP 8 Score: 71.2478 bits (173), Expect = 4.948e-11
Identity = 142/663 (21.42%), Postives = 269/663 (40.57%), Query Frame = 3
Query: 6399 FVIDIPINEAILS-GYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGH-IITLNDAINEDL---------FPEFV--------------PTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILD--------------------------HPQSNVTVYMTDVQN------SVQNKTLEI----------PNEEKFVDTKTTKTL---ESIKRNYFGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLS------TNESLTSNITSLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTG--KSTTLINGLENGSVFATIITLTNRSLYFEN--LNKRH--------DNYQIISVY----------------DPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLH 8075
              ID    + +L  G + +I E + S   +++ I  +DP+SG +I    AIE G+VD +     + ++ + + M  A  LGF++      K  ++   + +GL D ++G +     +  + + ++I    +D   S++      + + L  AIE+DL  P   +I+DN  + ++  +  + + L          PE +              P    +I  ++A+E G+++L+T   +D  +D +   +EA    +LD                           P S V   +  + +      ++ +K L++          P E   +D KT   +   E+I + Y  D  +  +I     AS +  L L  A + RI  +  K   S+ +A   GL  PK        T E LT+      G   + +ST   ++N  +G+ +    A +  I D     +R   +++   ++E+   G++V      RL E +++      + ++V    G       + L  N +D  +  I+D KTG  K   L +  + G     II   N  L + N  +  +H        D    IS+                 DPR  + IT  E++   V+N     Y + +T ++ TLS+  ++G+++
Sbjct: 3737 VTIDTQTGQVVLDDGRVCSIVEAINSGKLDIQSISVRDPVSGEVIPLRMAIELGVVDMQAGTVIDIQTLKEIPMELAFQLGFLVPGAR--KPISLEAAVRKGLYDPETGKLFDSESQNQVDVQKSIEIGLVDPKISLIVDTVTKKEVKLDCAIEDDLVLPATGQIKDNKNNTLVPFDVGVQQCLLKTDNVTWSLPELLQREYYTPSTGKVLNPVTGEEILLQQAIEMGFVELETTLVKDVDHDKILPGKEAAKVGLLDTVRGTLSSPNISLDEAFVKGYLISTKKPLSLVDCLLRGLYDPSTAKFTIDDKQLDLKAAIAQKLINPEELVLLDPKTESIISITEAIAKGYL-DPIEGYVINPY--ASTK--LSLHEALENRIL-IPPKRKRSLPDAVYRGLYDPKTGQFSNTVTREKLTTERAIRRGI-LDPDST---VVNVGSGQIIPFGVATETGIVDSKHGTVRDA-DDHPIDFKEAFDRGILVEAKKPLRLIEAVVKNVYDEVDGHFVDPKSGEKLNFA-EALNTNLLDEHSVQIRDFKTGLYKQLNLTHAKDTG-----IIDAQNSKLLYNNQTMTLKHAFDIGILMDVNAPISIQRAIHQGLFDDKTGKLSDPRTGRQITLLESMRSFVVNPHLPCYFDEQTEQMYTLSETCRNGIIN 4380          

HSP 9 Score: 55.4546 bits (132), Expect = 2.753e-6
Identity = 81/378 (21.43%), Postives = 147/378 (38.89%), Query Frame = 3
Query: 5349 NNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKL-NESLISGPN-----QEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSL-----------------KEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAIN--IDQTECNLFENRKLY------QTITTVYDS----KQNEYISLDEARKRDFIN-DDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXX------XXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGII 6356
              E  +I +A  +G++D      + P   Q IS+ EA+   +       I+D     +  + A   G + +    L++        + +  P   +++ +  A + GI+         +  +E  ++                 K+A     I +   + L      TN   E + I +A+N  LID + GQ+ D  NN+ +++ +    KII   Q N I+    PL K S+S+  +A    ID     +      Y        +  V D      + E  +L+EA  +  IN DD    Y  K     + T+AI+A     + ++ K +V              + +   S   V +P TK+ +  +QA+E+  I
Sbjct: 2315 TGETENIFDAARQGLVDEQLIKIVDPTTKQPISVTEAIARSIYDPKTATILDSEGQPVDLITATKLGLLSVVGAPLVAAEGALRTVRFVTDPRTGEQIPVEVAYERGIVSRDQLHRGRSFDSEPATVEDKVVVLQRMRKVILKPKDALRKGIIDEETCEILENTSNFTNPKGEVVNITEALNTGLIDGRRGQVIDPQNNRVLNLRQAVEQKIIDSEQTNHILM---PLAK-SLSVPRLADQGLIDPQTQTIVHPESGYPLSIHEAIVCEVLDPHSKLHKPEKCTLEEAITKGIINADDSTFNYKNK---TLNITEAIEAKLFDPSYDQQKSKVEIPPVGMIFPVAVEKSLVEPSKRVVLHPSTKKALPIKQAIEENFI 2685          

HSP 10 Score: 54.299 bits (129), Expect = 6.513e-6
Identity = 68/282 (24.11%), Postives = 124/282 (43.97%), Query Frame = 3
Query: 6294 VFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGF-KDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIV-------TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV 7115
            + +P TK+ +S  +A+   I D  +    I++  G  +D+ I    L G +  +   + +    L+ + F  DP +G  I    A E+G+V R   +   +  ++  T+   ED   VL    ++ L    D + +G++D ++  +       T P  EV + + EA+N+  ID  R  +  P N R + LR+A+E  + D       +   HI+              +P  K+ ++     +QG ID +T T   P +     + EA+   +LD P S +
Sbjct: 2337 IVDPTTKQPISVTEAIARSIYDPKTAT--ILDSEGQPVDL-ITATKL-GLLSVVGAPLVAAEGALRTVRFVTDPRTGEQIPVEVAYERGIVSRDQLHRGRSFDSEPATV---EDKVVVLQRMRKVILKP-KDALRKGIIDEETCEILENTSNFTNPKGEV-VNITEALNTGLIDGRRGQVIDPQNNRVLNLRQAVEQKIID------SEQTNHIL--------------MPLAKS-LSVPRLADQGLIDPQTQTIVHPESGYPLSIHEAIVCEVLD-PHSKL 2587          
BLAST of Dystonin vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273222)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 655/2491 (26.29%), Postives = 1246/2491 (50.02%), Query Frame = 3
Query: 12297 KLESEIKTTQSDMHLIKPDMENTKLL---IASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE-----------QKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEES---LNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALV-----RENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTIND-----------SKKLIRQAPGSD-LKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF----PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILER---DTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHD------EIITNSKK-----KTPPLI------PIFDR----SKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQ-------PVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVA---------------------------SPGLQRKSRIP-TRQTSQQGSQASTRHQS 19451
            KL   +K  + ++  +   +++ K L   I++ A+ +  +A  L  E++ + +R   L   L  +   L S   A+ +   +++       +L  +I+       ++  ++ QI D+  ++ + + +   L + +   + L +           ++I T  K++ ++DN           + D +++L    K + EF   ++  +  I + +++     P  ++L  +    ++   F E+KV+PL   ++++   G     +  SG+    +E++++ +   ++ L + +++ +  +D+ L++  KF  +L  L +++ +    +  ++ PS +Y   K+QL   + L   L  RQ+S+  L   G ++  + +  +++ ++ +L++L  +++ L + AE +    + A++++K F D   P  +WLD  E+++   +  PT D  ++++RI+E+  L ++          L  +  ++  + S+  +++   K+  + +R++    +      +        +     V  ++D +   ES   +LK     P     + E+    L L + +  H   +++  + G +L +  S +++  +  K++ L   + +++      L   +N++P+ ++F  A+N+L   + S  A +     R+ D L  +    +M  + +  N V   +CQ          +   E +   +E I   + +RF  ++ ++ +KA ++  +  +AK    ++D+ +E     +  + E       D   +E        L+ A  ++  SIN  I+            SKK++R++P S+   +L+  +D +K+  ++  +    +   L++A+PL++ F  S+  L  WL + E+ + +  +  L PDQ+   + + + L  S  + KPLLD + K+G  L  +V    G  I   ++    RY  ++  ++ R   LE  +  +++ ++K++     L N  D++      S  P+K+ E++   D ++ DLDK Q     +Q    +     K  N  D +V +I  KL K+++    +Q+ T +    + ++LS+A  FW  L  +     ++   L+         + +  ++  ++++R EID  + ++ ++ + G  L+     P++ P+V++  E+L   ++ + +   ++  N+        +  E    L ++  +  ++   LG + ++   V  QI++ K  K++++P   ++E +N+   +LT+ + P     +   L+ +N  W  LL G+ +RQ QL+  LL LG+F  A++E + WI  T+++L  +K   GD   LE+ LA+ K++  D+   Q SV  +     ++I+ +  S+    TQ +L +L   W++L + A  +  ELE+AL+EA  +  + Q+I   + ++ + +   K  GGLP+TA EQL+RFM++Y       PK+     +  E     ++    S    ++  +  L ++WD V + A  +K +LE A++    FH  +  F+ WLT  EK L+   PVSR++ TI  Q+E H+ L++D+++HRE ML LDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R LD+GYKEA+ F D    ++  +    ++L++   + +  + P KI++ I K KE H  LG     YD T R G  L ++AP  D   +D+++  L+ +W  + +KSI+R++ L +ALLLSG + DA+  LL WL+  + +L+++     GD+ TVQ L   H  +E+ L+ R   ++ +      L  +   ++  +  QL E++S W  V     ++  RL+ A   A +      +L ++   +EH+LR    +P++EK  +   M+  H  F K+L + E +  +  ++  +I+  AYP+A   IK++++II+ +W ++  W+  R   L+ HL  L +    +++LL WL+  EGTLL  +  +L   +   +    +H+ F+ +   +Q + D      ++   ++K     KTP  I      P  DR      R   +    +++   F +P+   L +KW+ VW +   R++ L DH+ YLK+VE  +NF+++DWR+R++ +MNH KSR+ D FR+ D D++G + R  FIDGI++        +KF T+ +EM+ VAD+FD+   G ID+++F+AALRPD +  + KPAN+++ IHDEVK+ +  CTC   +++ Q G+GKY+FGD++KLRLVRILRS VMVR+GGGW ALDEFL K+DPCR                      AKGRTN ELRE+     G   +MA F  + +T       P  A   S       SSP  H        P  S + P      R  ++IP SR S+S  S  TP  ++                           +PG  R    P +R  S+QGS+  +RH S
Sbjct: 2844 KLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGRLDN----------RVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT-DEEKIQQRIREHDRLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDA---SDNIGALLAESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQ----------LSPGEGA-ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREA------DLPAME------PKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIA--KAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDK-PEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSS--SNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGP-VHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDL--ERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAPDDEK--VSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRITPTRDTPDRDRLPHYGPRFSPSTSGPELE---FRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILN--------TKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQ--ERKPANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR----------------------AKGRTNIELREQFILADGVSQSMAAFTPRRST-------PNAAATAS-------SSPHAHNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGS 5238          

HSP 2 Score: 476.863 bits (1226), Expect = 1.520e-133
Identity = 361/1309 (27.58%), Postives = 643/1309 (49.12%), Query Frame = 3
Query:  354 INLLQLDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDI--------EEKIYQFRN---QYADLYANLNSALEELNDDF------------DHNDFRID-FNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGV--ISNRQYTPIH-------------SMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTF-----NEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYE 4118
            +++LQLDP DR VLR+ADERDA+QK+TF  W+N HL K N+RV D+F DLRDG  LL+LLEVLS + L  +    RFH L+N    LDFLR + IKLVNI AED+VDGNPKLTLGL+W IIL FQ  DIV   K D++S ++ LL+W+R++   YP + + +F++SW+DG AF AL+H+ RPDL+D +    +  ++ LE AF+  +KE GV ++++PEDV +   DEKS++TY++SL+++ P+   I        + +++++R+   Q+        + L+E +  F            D   FR D  +  + E + L  +  Y+     F+ + +VD   E + +   I   W +  T  +++ +IL  E ++++R ++++  +  E   +  K+ ++E +I +    + +    +    + ++  E+   E  I +M      L    YP       +  ++ K++K+ +++ +L     ++ V  +S  +Y P+H             S ++  N  +  L +   W   K   +   ++ +DL  +          +KI ++F T        + K S DE  +             + Q  N L+  + EL    +K  +D  S   FL +++  + W+  KE  +I   W D + + L      ++NL+ ELE RE      +  G  L    H A+  I+  L  L+ +W W+L LT CL+ HL+    Y QFF E  +A+  + +    LNS+F +    GLD+GE L R ++D+ E +  + ETV  +   +Q+V  L+ R   +   ++  V+AIC+ K+       Q  +GE + L +NSG   WRV  ++ +    P  C L+     +A   A  L   F     LW K+ L+LR+ ++ +T+ +VK W  + F  + P  R  I   LN DA++L   L   + ++ ++ +    +++ N  F E         + R  + + S     +  E   ++  +L+D       M +EL   + +P+  D+D LE  +  H ++E  L   EP++  L    +    +T  LK  L+ +++LW++L  ++ +   +LK  E   + L++ + VI E+E  L  +++  P+  + ++ +  QL   QD I+     +  +    DQL       R         D+++L   ++ +  R+  + NQ+ +R+            L++ ++  ++W+ G  T   S +    + +E       + K+    +E    KP+I+ +N +    +   + Y+
Sbjct:   16 LSILQLDPADRAVLRIADERDAIQKKTFTKWVNKHLKKANRRVVDLFEDLRDGHNLLSLLEVLSGEHLPREKGKMRFHMLQNAQMALDFLRYKKIKLVNIRAEDIVDGNPKLTLGLIWTIILHFQISDIV-VGKEDNVSAREALLRWARRSTARYPGVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERS--FPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQI--YKELERYFETVGEVD--VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPH------VSELHKKVNKLHQRWAQLRTNFHTNLVQKLSGLKY-PVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELAL-------------YQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ-LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQS-DFGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPV--NRQGPVQAICAYKQQGQL---QIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKL---LSEGDPNDPQLRRLRREMDEVNRLFDEF--------EKRARAEEESKQASRIFTEECLAIKSKLED-------MARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHVISELENELA-RHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQL------GRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDGT-TERLSAMPTATSAYE-------LDKLLGAAIE---RKPKIENVNVAGGRLIREAKIYD 1254          

HSP 3 Score: 114.005 bits (284), Expect = 6.392e-24
Identity = 231/1074 (21.51%), Postives = 474/1074 (44.13%), Query Frame = 3
Query: 8433 LNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRS-RLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNV-----KSVEDLQKSLTDLKLLDN------EFAS----YNNDIRVLIGSKIKFIDK----INKLEEQRKKFSD-LVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQ-------KILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIK-NIGSLSLDPKYINEQERLIQTILAEISSRQPFLENV------LMNNAS------RNEPKLKELDDKIKQKLLVASNIEAK-VNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPL---SPTSITKQPTTAN--RQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQ--DLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEE-------IQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKID 11486
            ++E  NQ  ++  + + +E  SQQ  V T + +I + ++   D +       LE +   L++  ++    +N+R+ RLL            RL        KL+  +D  S+      +++ED ++SL+DL  L +      EF S    +  D+R +  +  KF+D+    +  L + R    + L  V  +S+ +S   QE++     +   Q      YK  L+++  + + +  L  +Q++     + + E L+       +I+S         +    +    L+ E++S+ +++   + +L N ++SL    +  E I+    PI    N +  +   L E  + +++  + +     ++++L  W+ + + + K N+   SL  + + EQ R  + +LA++ S Q  +++V      L+ +AS      + E  L ++  K  +KL   +N   + ++D    L  +   + +    +A   E L  R    L  E+   +++E+    +      E   +  K+L+S  +  D   +   ++ LE  W ++N  I+ R+K    +      Y  LK +++  L + E  ++   P+AIDL  ++ QH++++    ++    P I++   IG++YD+++           +  SP RK S       T PL   S  + +  PT           S    S  SS D   L+ E S    ++++I +RY  IG +L +R+ ++  L  +     +  K  +  L+    +L    V N    +  I+  R   +    + +L +  T  Q  D+LR +  VPG  +L+ + D +++K+ +L D  K  +         +   G +K  +++    KERML VLGP+ +      +Q+QQV  L +E    +  +K  + +G +++  ++ T  +   +E  L  +  K D+L   L DR  ++      SK+F   +N + + L  + + +D     + T  D +E       ++ +L+  + +L + E  + TL   + D  +  ++ ++V+ L +    +Q K+D
Sbjct: 1561 IDELRNQ--INALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDR----VNDRTVRLL-----------RRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVS-----LVSAQ------YKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPME-INQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKF-EKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKINDIGAQYDALI-----------RPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRRSSQDGFQLS-ELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT-TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDS----KERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGT-PDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLD----TLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLD 2582          

HSP 4 Score: 87.4261 bits (215), Expect = 5.638e-16
Identity = 344/1843 (18.67%), Postives = 763/1843 (41.40%), Query Frame = 3
Query: 12783 IIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSE--------QKVDPLKKQLEE----LIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDL--------DAEEEPSIEYHKS--KSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND---DSSIDESIKKLKIIINKVDGVFSENVSID---TKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFE---SAMKDLKLNIVDPY---QTRDIWEESLNLVKEVKSHEETLKNLD----QVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDI-----FVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNF----EQKINEMSDQINNDY-------SELEECKI---DFTNLLSAWNEQK-ESINSTIND----SKKLIRQA-PGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYD--LDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-DKKKLIEDLRGEIDVHEKDIGKIS------QKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR--LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKR----FMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATH-LKYISQKHDIVL--IRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQ-SEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGS-IKHYINIIKSQWSDLLSWSEQRGLNLKDHL 18062
            ++  +DDR NSL        EF++  N              L + L N S N+             +K++ L++QLE     L D+  ++ +T+ + LG      +++S   + ++  Q ++ ++  +D K   + + + SL + + F EN S+ L        +  +   +  HK   + Q+++H  +   +  R+  +  L   G DL   T   +   ++ +LD +  ++E L   A  ++ R    ++  K +    E  L WL TAE  LA+  T   +   ++E R+++ +  +++    S   E+ K L          F  +  ID    K ++  + DR+         +   +      L ++ D++   + +L   E   +A   L     DP    + + I EE  NL K ++S +   K++       G D   ++SE D  A   +++ L    D+       +    +++     +F   N ++  +   L  L  E + L+     R ++I++ + + V K+    +  LD+L  V   E++ E+  D+     F  +  + +E ++ + K    +G    + +  E+NL   ++ L  F     Q ++++ D +++++       SEL++ +    DF N    + E+K E +   ++      + L+R A  G    +++  ++++  +     + +  + ++LD A+  + +F  +   L  WL +TEE +   K  + D   +    QE K L     D++  +  +   G  ++      +  +I   + D  KR++ + +  + R  DLE+ + +    ++K+      L+N    +          EK+ + +   D  L+D  L K   F D     + + +    +    +++V + EK+  ++    GL    ++  + I  LL+ + +    L L    + ++   + +   E    +SV    +KL+E +   ++++E   G  S      + G +L++ ++N +E   ++   + L+R +  + +     + +      L+ +  E   +L EW +     L      P+E  P    + + +    D+ P    ++ INQ+G QL + S       + S + R N  +  +++ + ++  +L        E    +DE +EW    + +L    +   +   +   L +H+ I  D++  +  V  +   + ++++E   S  + AT R  L+ L++  + + +    +   LE AL  +  F    Q ++  +D++  ++         PD    Q  +       I    P L+   +      A ++      I + ++ D      ++  ++     R+  LE A++    F   +   +  L  T   +NQ  P+S +   I EQ+E + AL  D+   ++    + + A   +     K D  +  I+  +  +++ W  V + + +R  +LD     A+ F     +++  +    E L         P  I++Q    +E    +       +  RR G  L +     D  ++ + + +L   W ++     +RE+ L DA+  +  + + + NLL +L   E K +      G D++ V+  + +    + ++      +E +N  A+ L  + S E ++ I + L+ +   W  + +   E++++LE A     +F+   N L  + +K++  L Q    P +   +L+   ++   +   ++  ++  ++     G +++ +     E S  +  +  + ++W  LL  +  R   L++ L
Sbjct: 2471 LVGKLDDRANSLGGAADSSKEFDAAVN-------------RLREALQNISDNLDTLPTDGDHQENLRKIENLERQLEGQRPLLADV-EQSAATLCNILGDPASRADVNSRVAALEK--QYLA-LQKKLDTK---KAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIYREVMAREHEVIMLINKGKDL---TDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADL-TPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGL-------GETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLA--DRMSELQGRLDD-------RCGELQSAATAVSQF---NEQMKSLGIDLNDLETEIEKLSPP--GREIKIVQVQIDDVGKI----QTKLDRL--VGRLEDA-ERAADVLVDAGFAADTTQTREQISTLRK---TLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQD-VSDEFKRMKPVGSELDQIRRQQEDFRN----FRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDR-LHDEILGKKPDFSD-----LADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGL----VDASDNIGALLAESRQGLRHLVL---SYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISN-DEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAAL-----APSE--PRQADVLRLEGELADMRPI---LDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQS-ENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDN----ARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGA-VGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGD--PQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEAL 4221          
BLAST of Dystonin vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0273225)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 655/2491 (26.29%), Postives = 1246/2491 (50.02%), Query Frame = 3
Query: 12297 KLESEIKTTQSDMHLIKPDMENTKLL---IASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE-----------QKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEES---LNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALV-----RENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTIND-----------SKKLIRQAPGSD-LKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF----PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILER---DTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHD------EIITNSKK-----KTPPLI------PIFDR----SKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQ-------PVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVA---------------------------SPGLQRKSRIP-TRQTSQQGSQASTRHQS 19451
            KL   +K  + ++  +   +++ K L   I++ A+ +  +A  L  E++ + +R   L   L  +   L S   A+ +   +++       +L  +I+       ++  ++ QI D+  ++ + + +   L + +   + L +           ++I T  K++ ++DN           + D +++L    K + EF   ++  +  I + +++     P  ++L  +    ++   F E+KV+PL   ++++   G     +  SG+    +E++++ +   ++ L + +++ +  +D+ L++  KF  +L  L +++ +    +  ++ PS +Y   K+QL   + L   L  RQ+S+  L   G ++  + +  +++ ++ +L++L  +++ L + AE +    + A++++K F D   P  +WLD  E+++   +  PT D  ++++RI+E+  L ++          L  +  ++  + S+  +++   K+  + +R++    +      +        +     V  ++D +   ES   +LK     P     + E+    L L + +  H   +++  + G +L +  S +++  +  K++ L   + +++      L   +N++P+ ++F  A+N+L   + S  A +     R+ D L  +    +M  + +  N V   +CQ          +   E +   +E I   + +RF  ++ ++ +KA ++  +  +AK    ++D+ +E     +  + E       D   +E        L+ A  ++  SIN  I+            SKK++R++P S+   +L+  +D +K+  ++  +    +   L++A+PL++ F  S+  L  WL + E+ + +  +  L PDQ+   + + + L  S  + KPLLD + K+G  L  +V    G  I   ++    RY  ++  ++ R   LE  +  +++ ++K++     L N  D++      S  P+K+ E++   D ++ DLDK Q     +Q    +     K  N  D +V +I  KL K+++    +Q+ T +    + ++LS+A  FW  L  +     ++   L+         + +  ++  ++++R EID  + ++ ++ + G  L+     P++ P+V++  E+L   ++ + +   ++  N+        +  E    L ++  +  ++   LG + ++   V  QI++ K  K++++P   ++E +N+   +LT+ + P     +   L+ +N  W  LL G+ +RQ QL+  LL LG+F  A++E + WI  T+++L  +K   GD   LE+ LA+ K++  D+   Q SV  +     ++I+ +  S+    TQ +L +L   W++L + A  +  ELE+AL+EA  +  + Q+I   + ++ + +   K  GGLP+TA EQL+RFM++Y       PK+     +  E     ++    S    ++  +  L ++WD V + A  +K +LE A++    FH  +  F+ WLT  EK L+   PVSR++ TI  Q+E H+ L++D+++HRE ML LDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R LD+GYKEA+ F D    ++  +    ++L++   + +  + P KI++ I K KE H  LG     YD T R G  L ++AP  D   +D+++  L+ +W  + +KSI+R++ L +ALLLSG + DA+  LL WL+  + +L+++     GD+ TVQ L   H  +E+ L+ R   ++ +      L  +   ++  +  QL E++S W  V     ++  RL+ A   A +      +L ++   +EH+LR    +P++EK  +   M+  H  F K+L + E +  +  ++  +I+  AYP+A   IK++++II+ +W ++  W+  R   L+ HL  L +    +++LL WL+  EGTLL  +  +L   +   +    +H+ F+ +   +Q + D      ++   ++K     KTP  I      P  DR      R   +    +++   F +P+   L +KW+ VW +   R++ L DH+ YLK+VE  +NF+++DWR+R++ +MNH KSR+ D FR+ D D++G + R  FIDGI++        +KF T+ +EM+ VAD+FD+   G ID+++F+AALRPD +  + KPAN+++ IHDEVK+ +  CTC   +++ Q G+GKY+FGD++KLRLVRILRS VMVR+GGGW ALDEFL K+DPCR                      AKGRTN ELRE+     G   +MA F  + +T       P  A   S       SSP  H        P  S + P      R  ++IP SR S+S  S  TP  ++                           +PG  R    P +R  S+QGS+  +RH S
Sbjct: 2955 KLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGRLDN----------RVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT-DEEKIQQRIREHDRLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDA---SDNIGALLAESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQ----------LSPGEGA-ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREA------DLPAME------PKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIA--KAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDK-PEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSS--SNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGP-VHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDL--ERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAPDDEK--VSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRITPTRDTPDRDRLPHYGPRFSPSTSGPELE---FRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILN--------TKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQ--ERKPANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR----------------------AKGRTNIELREQFILADGVSQSMAAFTPRRST-------PNAAATAS-------SSPHAHNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGS 5349          

HSP 2 Score: 451.825 bits (1161), Expect = 6.122e-126
Identity = 350/1292 (27.09%), Postives = 628/1292 (48.61%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDI--------EEKIYQFRN---QYADLYANLNSALEELNDDF------------DHNDFRID-FNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGV--ISNRQYTPIH-------------SMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTF-----NEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYE 4118
            DERDA+QK+TF  W+N HL K N+RV D+F DLRDG  LL+LLEVLS + L  +    RFH L+N    LDFLR + IKLVNI AED+VDGNPKLTLGL+W IIL FQ  DIV   K D++S ++ LL+W+R++   YP + + +F++SW+DG AF AL+H+ RPDL+D +    +  ++ LE AF+  +KE GV ++++PEDV +   DEKS++TY++SL+++ P+   I        + +++++R+   Q+        + L+E +  F            D   FR D  +  + E + L  +  Y+     F+ + +VD   E + +   I   W +  T  +++ +IL  E ++++R ++++  +  E   +  K+ ++E +I +    + +    +    + ++  E+   E  I +M      L    YP       +  ++ K++K+ +++ +L     ++ V  +S  +Y P+H             S ++  N  +  L +   W   K   +   ++ +DL  +          +KI ++F T        + K S DE  +             + Q  N L+  + EL    +K  +D  S   FL +++  + W+  KE  +I   W D + + L      ++NL+ ELE RE      +  G  L    H A+  I+  L  L+ +W W+L LT CL+ HL+    Y QFF E  +A+  + +    LNS+F +    GLD+GE L R ++D+ E +  + ETV  +   +Q+V  L+ R   +   ++  V+AIC+ K+       Q  +GE + L +NSG   WRV  ++ +    P  C L+     +A   A  L   F     LW K+ L+LR+ ++ +T+ +VK W  + F  + P  R  I   LN DA++L   L   + ++ ++ +    +++ N  F E         + R  + + S     +  E   ++  +L+D       M +EL   + +P+  D+D LE  +  H ++E  L   EP++  L    +    +T  LK  L+ +++LW++L  ++ +   +LK  E   + L++ + VI E+E  L  +++  P+  + ++ +  QL   QD I+     +  +    DQL       R         D+++L   ++ +  R+  + NQ+ +R+            L++ ++  ++W+ G  T   S +    + +E       + K+    +E    KP+I+ +N +    +   + Y+
Sbjct:  144 DERDAIQKKTFTKWVNKHLKKANRRVVDLFEDLRDGHNLLSLLEVLSGEHLPREKGKMRFHMLQNAQMALDFLRYKKIKLVNIRAEDIVDGNPKLTLGLIWTIILHFQISDIV-VGKEDNVSAREALLRWARRSTARYPGVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERS--FPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQI--YKELERYFETVGEVD--VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPH------VSELHKKVNKLHQRWAQLRTNFHTNLVQKLSGLKY-PVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELAL-------------YQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ-LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQS-DFGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPV--NRQGPVQAICAYKQQGQL---QIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKL---LSEGDPNDPQLRRLRREMDEVNRLFDEF--------EKRARAEEESKQASRIFTEECLAIKSKLED-------MARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHVISELENELA-RHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQL------GRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDGT-TERLSAMPTATSAYE-------LDKLLGAAIE---RKPKIENVNVAGGRLIREAKIYD 1365          

HSP 3 Score: 114.005 bits (284), Expect = 5.329e-24
Identity = 231/1074 (21.51%), Postives = 474/1074 (44.13%), Query Frame = 3
Query: 8433 LNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRS-RLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNV-----KSVEDLQKSLTDLKLLDN------EFAS----YNNDIRVLIGSKIKFIDK----INKLEEQRKKFSD-LVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQ-------KILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIK-NIGSLSLDPKYINEQERLIQTILAEISSRQPFLENV------LMNNAS------RNEPKLKELDDKIKQKLLVASNIEAK-VNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPL---SPTSITKQPTTAN--RQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQ--DLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEE-------IQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKID 11486
            ++E  NQ  ++  + + +E  SQQ  V T + +I + ++   D +       LE +   L++  ++    +N+R+ RLL            RL        KL+  +D  S+      +++ED ++SL+DL  L +      EF S    +  D+R +  +  KF+D+    +  L + R    + L  V  +S+ +S   QE++     +   Q      YK  L+++  + + +  L  +Q++     + + E L+       +I+S         +    +    L+ E++S+ +++   + +L N ++SL    +  E I+    PI    N +  +   L E  + +++  + +     ++++L  W+ + + + K N+   SL  + + EQ R  + +LA++ S Q  +++V      L+ +AS      + E  L ++  K  +KL   +N   + ++D    L  +   + +    +A   E L  R    L  E+   +++E+    +      E   +  K+L+S  +  D   +   ++ LE  W ++N  I+ R+K    +      Y  LK +++  L + E  ++   P+AIDL  ++ QH++++    ++    P I++   IG++YD+++           +  SP RK S       T PL   S  + +  PT           S    S  SS D   L+ E S    ++++I +RY  IG +L +R+ ++  L  +     +  K  +  L+    +L    V N    +  I+  R   +    + +L +  T  Q  D+LR +  VPG  +L+ + D +++K+ +L D  K  +         +   G +K  +++    KERML VLGP+ +      +Q+QQV  L +E    +  +K  + +G +++  ++ T  +   +E  L  +  K D+L   L DR  ++      SK+F   +N + + L  + + +D     + T  D +E       ++ +L+  + +L + E  + TL   + D  +  ++ ++V+ L +    +Q K+D
Sbjct: 1672 IDELRNQ--INALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDR----VNDRTVRLL-----------RRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVS-----LVSAQ------YKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPME-INQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKF-EKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKINDIGAQYDALI-----------RPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRRSSQDGFQLS-ELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT-TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDS----KERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGT-PDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLD----TLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLD 2693          

HSP 4 Score: 87.4261 bits (215), Expect = 5.987e-16
Identity = 343/1848 (18.56%), Postives = 764/1848 (41.34%), Query Frame = 3
Query: 12783 IIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSE--------QKVDPLKKQLEE----LIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLD---------------AEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND---DSSIDESIKKLKIIINKVDGVFSENVSID---TKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFE---SAMKDLKLNIVDPY---QTRDIWEESLNLVKEVKSHEETLKNLD----QVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDI-----FVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNF----EQKINEMSDQINNDY-------SELEECKI---DFTNLLSAWNEQK-ESINSTIND----SKKLIRQA-PGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYD--LDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-DKKKLIEDLRGEIDVHEKDIGKIS------QKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR--LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKR----FMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATH-LKYISQKHDIVL--IRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQ-SEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGS-IKHYINIIKSQWSDLLSWSEQRGLNLKDHL 18062
            ++  +DDR NSL        EF++  N              L + L N S N+             +K++ L++QLE     L D+  ++ +T+ + LG      +++S   + ++  Q ++ ++  +D K   + + + SL + + F EN S+ L                +  +P++++     Q+++H  +   +  R+  +  L   G DL   T   +   ++ +LD +  ++E L   A  ++ R    ++  K +    E  L WL TAE  LA+  T   +   ++E R+++ +  +++    S   E+ K L          F  +  ID    K ++  + DR+         +   +      L ++ D++   + +L   E   +A   L     DP    + + I EE  NL K ++S +   K++       G D   ++SE D  A   +++ L    D+       +    +++     +F   N ++  +   L  L  E + L+     R ++I++ + + V K+    +  LD+L  V   E++ E+  D+     F  +  + +E ++ + K    +G    + +  E+NL   ++ L  F     Q ++++ D +++++       SEL++ +    DF N    + E+K E +   ++      + L+R A  G    +++  ++++  +     + +  + ++LD A+  + +F  +   L  WL +TEE +   K  + D   +    QE K L     D++  +  +   G  ++      +  +I   + D  KR++ + +  + R  DLE+ + +    ++K+      L+N    +          EK+ + +   D  L+D  L K   F D     + + +    +    +++V + EK+  ++    GL    ++  + I  LL+ + +    L L    + ++   + +   E    +SV    +KL+E +   ++++E   G  S      + G +L++ ++N +E   ++   + L+R +  + +     + +      L+ +  E   +L EW +     L      P+E  P    + + +    D+ P    ++ INQ+G QL + S       + S + R N  +  +++ + ++  +L        E    +DE +EW    + +L    +   +   +   L +H+ I  D++  +  V  +   + ++++E   S  + AT R  L+ L++  + + +    +   LE AL  +  F    Q ++  +D++  ++         PD    Q  +       I    P L+   +      A ++      I + ++ D      ++  ++     R+  LE A++    F   +   +  L  T   +NQ  P+S +   I EQ+E + AL  D+   ++    + + A   +     K D  +  I+  +  +++ W  V + + +R  +LD     A+ F     +++  +    E L         P  I++Q    +E    +       +  RR G  L +     D  ++ + + +L   W ++     +RE+ L DA+  +  + + + NLL +L   E K +      G D++ V+  + +    + ++      +E +N  A+ L  + S E ++ I + L+ +   W  + +   E++++LE A     +F+   N L  + +K++  L Q    P +   +L+   ++   +   ++  ++  ++     G +++ +     E S  +  +  + ++W  LL  +  R   L++ L
Sbjct: 2582 LVGKLDDRANSLGGAADSSKEFDAAVN-------------RLREALQNISDNLDTLPTDGDHQENLRKIENLERQLEGQRPLLADV-EQSAATLCNILGDPASRADVNSRVAALEK--QYLA-LQKKLDTK---KAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQH-----QIDTHEPIYREVMAREHEVIMLINKGKDL---TDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADL-TPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGL-------GETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLA--DRMSELQGRLDD-------RCGELQSAATAVSQF---NEQMKSLGIDLNDLETEIEKLSPP--GREIKIVQVQIDDVGKI----QTKLDRL--VGRLEDA-ERAADVLVDAGFAADTTQTREQISTLRK---TLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQD-VSDEFKRMKPVGSELDQIRRQQEDFRN----FRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDR-LHDEILGKKPDFSD-----LADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGL----VDASDNIGALLAESRQGLRHLVL---SYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISN-DEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAAL-----APSE--PRQADVLRLEGELADMRPI---LDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQS-ENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDN----ARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGA-VGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGD--PQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEAL 4332          
BLAST of Dystonin vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304853)

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 654/2499 (26.17%), Postives = 1245/2499 (49.82%), Query Frame = 3
Query: 12297 KLESEIKTTQSDMHLIKPDMENTKLL---IASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE-----------QKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEES---LNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALV-----RENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTIND-----------SKKLIRQAPGSD-LKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF----PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILER---DTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHD------EIITNSKK-----KTPPLIPIFD------------------RSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQ-------PVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVA---------------------------SPGLQRKSRIP-TRQTSQQGSQASTRHQS 19451
            KL   +K  + ++  +   +++ K L   I++ A+ +  +A  L  E++ + +R   L   L  +   L S   A+ +   +++       +L  +I+       ++  ++ QI D+  ++ + + +   L + +   + L +           ++I T  K++ ++DN           + D +++L    K + EF   ++  +  I + +++     P  ++L  +    ++   F E+KV+PL   ++++   G     +  SG+    +E++++ +   ++ L + +++ +  +D+ L++  KF  +L  L +++ +    +  ++ PS +Y   K+QL   + L   L  RQ+S+  L   G ++  + +  +++ ++ +L++L  +++ L + AE +    + A++++K F D   P  +WLD  E+++   +  PT D  ++++RI+E+  L ++          L  +  ++  + S+  +++   K+  + +R++    +      +        +     V  ++D +   ES   +LK     P     + E+    L L + +  H   +++  + G +L +  S +++  +  K++ L   + +++      L   +N++P+ ++F  A+N+L   + S  A +     R+ D L  +    +M  + +  N V   +CQ          +   E +   +E I   + +RF  ++ ++ +KA ++  +  +AK    ++D+ +E     +  + E       D   +E        L+ A  ++  SIN  I+            SKK++R++P S+   +L+  +D +K+  ++  +    +   L++A+PL++ F  S+  L  WL + E+ + +  +  L PDQ+   + + + L  S  + KPLLD + K+G  L  +V    G  I   ++    RY  ++  ++ R   LE  +  +++ ++K++     L N  D++      S  P+K+ E++   D ++ DLDK Q     +Q    +     K  N  D +V +I  KL K+++    +Q+ T +    + ++LS+A  FW  L  +     ++   L+         + +  ++  ++++R EID  + ++ ++ + G  L+     P++ P+V++  E+L   ++ + +   ++  N+        +  E    L ++  +  ++   LG + ++   V  QI++ K  K++++P   ++E +N+   +LT+ + P     +   L+ +N  W  LL G+ +RQ QL+  LL LG+F  A++E + WI  T+++L  +K   GD   LE+ LA+ K++  D+   Q SV  +     ++I+ +  S+    TQ +L +L   W++L + A  +  ELE+AL+EA  +  + Q+I   + ++ + +   K  GGLP+TA EQL+RFM++Y       PK+     +  E     ++    S    ++  +  L ++WD V + A  +K +LE A++    FH  +  F+ WLT  EK L+   PVSR++ TI  Q+E H+ L++D+++HRE ML LDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R LD+GYKEA+ F D    ++  +    ++L++   + +  + P KI++ I K KE H  LG     YD T R G  L ++AP  D   +D+++  L+ +W  + +KSI+R++ L +ALLLSG + DA+  LL WL+  + +L+++     GD+ TVQ L   H  +E+ L+ R   ++ +      L  +   ++  +  QL E++S W  V     ++  RL+ A   A +      +L ++   +EH+LR    +P++EK  +   M+  H  F K+L + E +  +  ++  +I+  AYP+A   IK++++II+ +W ++  W+  R   L+ HL  L +    +++LL WL+  EGTLL  +  +L   +   +    +H+ F+ +   +Q + D      ++   ++K     KTP      D                  R + +   +G +   E  F +P+   L +KW+ VW +   R++ L DH+ YLK+VE  +NF+++DWR+R++ +MNH KSR+ D FR+ D D++G + R  FIDGI++        +KF T+ +EM+ VAD+FD+   G ID+++F+AALRPD +  + KPAN+++ IHDEVK+ +  CTC   +++ Q G+GKY+FGD++KLRLVRILRS VMVR+GGGW ALDEFL K+DPCR                      AKGRTN ELRE+     G   +MA F  + +T       P  A   S       SSP  H        P  S + P      R  ++IP SR S+S  S  TP  ++                           +PG  R    P +R  S+QGS+  +RH S
Sbjct: 2914 KLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGRLDN----------RVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT-DEEKIQQRIREHDRLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDA---SDNIGALLAESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQ----------LSPGEGA-ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREA------DLPAME------PKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIA--KAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDK-PEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSS--SNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGP-VHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDL--ERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAPDDEK--VSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRGSSHDLREQSPDGTLRRQSFKGSRDQGLNARKGSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILN--------TKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQ--ERKPANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR----------------------AKGRTNIELREQFILADGVSQSMAAFTPRRST-------PNAAATAS-------SSPHAHNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGS 5319          

HSP 2 Score: 318.161 bits (814), Expect = 1.366e-85
Identity = 281/1185 (23.71%), Postives = 548/1185 (46.24%), Query Frame = 3
Query:  726 QFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDI--------EEKIYQFRN---QYADLYANLNSALEELNDDF------------DHNDFRID-FNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGV--ISNRQYTPIH-------------SMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTF-----NEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYE 4118
            +  DIV   K D++S ++ LL+W+R++   YP + + +F++SW+DG AF AL+H+ RPDL+D +    +  ++ LE AF+  +KE GV ++++PEDV +   DEKS++TY++SL+++ P+   I        + +++++R+   Q+        + L+E +  F            D   FR D  +  + E + L  +  Y+     F+ + +VD   E + +   I   W +  T  +++ +IL  E ++++R ++++  +  E   +  K+ ++E +I +    + +    +    + ++  E+   E  I +M      L    YP       +  ++ K++K+ +++ +L     ++ V  +S  +Y P+H             S ++  N  +  L +   W   K   +   ++ +DL  +          +KI ++F T        + K S DE  +             + Q  N L+  + EL    +K  +D  S   FL +++  + W+  KE  +I   W D + + L      ++NL+ ELE RE      +  G  L    H A+  I+  L  L+ +W W+L LT CL+ HL+    Y QFF E  +A+  + +    LNS+F +    GLD+GE L R ++D+ E +  + ETV  +   +Q+V  L+ R   +   ++  V+AIC+ K+       Q  +GE + L +NSG   WRV  ++ +    P  C L+     +A   A  L   F     LW K+ L+LR+ ++ +T+ +VK W  + F  + P  R  I   LN DA++L   L   + ++ ++ +    +++ N  F E         + R  + + S     +  E   ++  +L+D       M +EL   + +P+  D+D LE  +  H ++E  L   EP++  L    +    +T  LK  L+ +++LW++L  ++ +   +LK  E   + L++ + VI E+E  L  +++  P+  + ++ +  QL   QD I+     +  +    DQL       R         D+++L   ++ +  R+  + NQ+ +R+            L++ ++  ++W+ G  T   S +    + +E       + K+    +E    KP+I+ +N +    +   + Y+
Sbjct:  210 EISDIV-VGKEDNVSAREALLRWARRSTARYPGVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERS--FPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQI--YKELERYFETVGEVD--VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPH------VSELHKKVNKLHQRWAQLRTNFHTNLVQKLSGLKY-PVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELAL-------------YQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ-LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQS-DFGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPV--NRQGPVQAICAYKQQGQL---QIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKL---LSEGDPNDPQLRRLRREMDEVNRLFDEF--------EKRARAEEESKQASRIFTEECLAIKSKLED-------MARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHVISELENELA-RHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQL------GRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDGT-TERLSAMPTATSAYE-------LDKLLGAAIE---RKPKIENVNVAGGRLIREAKIYD 1324          

HSP 3 Score: 113.235 bits (282), Expect = 1.040e-23
Identity = 231/1074 (21.51%), Postives = 474/1074 (44.13%), Query Frame = 3
Query: 8433 LNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRS-RLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNV-----KSVEDLQKSLTDLKLLDN------EFAS----YNNDIRVLIGSKIKFIDK----INKLEEQRKKFSD-LVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQ-------KILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIK-NIGSLSLDPKYINEQERLIQTILAEISSRQPFLENV------LMNNAS------RNEPKLKELDDKIKQKLLVASNIEAK-VNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPL---SPTSITKQPTTAN--RQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQ--DLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEE-------IQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKID 11486
            ++E  NQ  ++  + + +E  SQQ  V T + +I + ++   D +       LE +   L++  ++    +N+R+ RLL            RL        KL+  +D  S+      +++ED ++SL+DL  L +      EF S    +  D+R +  +  KF+D+    +  L + R    + L  V  +S+ +S   QE++     +   Q      YK  L+++  + + +  L  +Q++     + + E L+       +I+S         +    +    L+ E++S+ +++   + +L N ++SL    +  E I+    PI    N +  +   L E  + +++  + +     ++++L  W+ + + + K N+   SL  + + EQ R  + +LA++ S Q  +++V      L+ +AS      + E  L ++  K  +KL   +N   + ++D    L  +   + +    +A   E L  R    L  E+   +++E+    +      E   +  K+L+S  +  D   +   ++ LE  W ++N  I+ R+K    +      Y  LK +++  L + E  ++   P+AIDL  ++ QH++++    ++    P I++   IG++YD+++           +  SP RK S       T PL   S  + +  PT           S    S  SS D   L+ E S    ++++I +RY  IG +L +R+ ++  L  +     +  K  +  L+    +L    V N    +  I+  R   +    + +L +  T  Q  D+LR +  VPG  +L+ + D +++K+ +L D  K  +         +   G +K  +++    KERML VLGP+ +      +Q+QQV  L +E    +  +K  + +G +++  ++ T  +   +E  L  +  K D+L   L DR  ++      SK+F   +N + + L  + + +D     + T  D +E       ++ +L+  + +L + E  + TL   + D  +  ++ ++V+ L +    +Q K+D
Sbjct: 1631 IDELRNQ--INALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDR----VNDRTVRLL-----------RRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVS-----LVSAQ------YKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPME-INQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKF-EKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKINDIGAQYDALI-----------RPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRRSSQDGFQLS-ELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT-TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDS----KERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGT-PDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLD----TLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLD 2652          

HSP 4 Score: 86.2705 bits (212), Expect = 1.553e-15
Identity = 343/1848 (18.56%), Postives = 764/1848 (41.34%), Query Frame = 3
Query: 12783 IIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSE--------QKVDPLKKQLEE----LIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLD---------------AEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND---DSSIDESIKKLKIIINKVDGVFSENVSID---TKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFE---SAMKDLKLNIVDPY---QTRDIWEESLNLVKEVKSHEETLKNLD----QVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDI-----FVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNF----EQKINEMSDQINNDY-------SELEECKI---DFTNLLSAWNEQK-ESINSTIND----SKKLIRQA-PGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYD--LDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-DKKKLIEDLRGEIDVHEKDIGKIS------QKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR--LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKR----FMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATH-LKYISQKHDIVL--IRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQ-SEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGS-IKHYINIIKSQWSDLLSWSEQRGLNLKDHL 18062
            ++  +DDR NSL        EF++  N              L + L N S N+             +K++ L++QLE     L D+  ++ +T+ + LG      +++S   + ++  Q ++ ++  +D K   + + + SL + + F EN S+ L                +  +P++++     Q+++H  +   +  R+  +  L   G DL   T   +   ++ +LD +  ++E L   A  ++ R    ++  K +    E  L WL TAE  LA+  T   +   ++E R+++ +  +++    S   E+ K L          F  +  ID    K ++  + DR+         +   +      L ++ D++   + +L   E   +A   L     DP    + + I EE  NL K ++S +   K++       G D   ++SE D  A   +++ L    D+       +    +++     +F   N ++  +   L  L  E + L+     R ++I++ + + V K+    +  LD+L  V   E++ E+  D+     F  +  + +E ++ + K    +G    + +  E+NL   ++ L  F     Q ++++ D +++++       SEL++ +    DF N    + E+K E +   ++      + L+R A  G    +++  ++++  +     + +  + ++LD A+  + +F  +   L  WL +TEE +   K  + D   +    QE K L     D++  +  +   G  ++      +  +I   + D  KR++ + +  + R  DLE+ + +    ++K+      L+N    +          EK+ + +   D  L+D  L K   F D     + + +    +    +++V + EK+  ++    GL    ++  + I  LL+ + +    L L    + ++   + +   E    +SV    +KL+E +   ++++E   G  S      + G +L++ ++N +E   ++   + L+R +  + +     + +      L+ +  E   +L EW +     L      P+E  P    + + +    D+ P    ++ INQ+G QL + S       + S + R N  +  +++ + ++  +L        E    +DE +EW    + +L    +   +   +   L +H+ I  D++  +  V  +   + ++++E   S  + AT R  L+ L++  + + +    +   LE AL  +  F    Q ++  +D++  ++         PD    Q  +       I    P L+   +      A ++      I + ++ D      ++  ++     R+  LE A++    F   +   +  L  T   +NQ  P+S +   I EQ+E + AL  D+   ++    + + A   +     K D  +  I+  +  +++ W  V + + +R  +LD     A+ F     +++  +    E L         P  I++Q    +E    +       +  RR G  L +     D  ++ + + +L   W ++     +RE+ L DA+  +  + + + NLL +L   E K +      G D++ V+  + +    + ++      +E +N  A+ L  + S E ++ I + L+ +   W  + +   E++++LE A     +F+   N L  + +K++  L Q    P +   +L+   ++   +   ++  ++  ++     G +++ +     E S  +  +  + ++W  LL  +  R   L++ L
Sbjct: 2541 LVGKLDDRANSLGGAADSSKEFDAAVN-------------RLREALQNISDNLDTLPTDGDHQENLRKIENLERQLEGQRPLLADV-EQSAATLCNILGDPASRADVNSRVAALEK--QYLA-LQKKLDTK---KAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQH-----QIDTHEPIYREVMAREHEVIMLINKGKDL---TDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADL-TPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGL-------GETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLA--DRMSELQGRLDD-------RCGELQSAATAVSQF---NEQMKSLGIDLNDLETEIEKLSPP--GREIKIVQVQIDDVGKI----QTKLDRL--VGRLEDA-ERAADVLVDAGFAADTTQTREQISTLRK---TLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQD-VSDEFKRMKPVGSELDQIRRQQEDFRN----FRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDR-LHDEILGKKPDFSD-----LADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGL----VDASDNIGALLAESRQGLRHLVL---SYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISN-DEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAAL-----APSE--PRQADVLRLEGELADMRPI---LDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQS-ENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDN----ARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGA-VGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGD--PQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEAL 4291          
BLAST of Dystonin vs. Ensembl Fly
Match: shot (gene:FBgn0013733 transcript:FBtr0304847)

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 654/2499 (26.17%), Postives = 1245/2499 (49.82%), Query Frame = 3
Query: 12297 KLESEIKTTQSDMHLIKPDMENTKLL---IASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE-----------QKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEES---LNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALV-----RENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTIND-----------SKKLIRQAPGSD-LKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF----PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILER---DTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHD------EIITNSKK-----KTPPLIPIFD------------------RSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQ-------PVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVA---------------------------SPGLQRKSRIP-TRQTSQQGSQASTRHQS 19451
            KL   +K  + ++  +   +++ K L   I++ A+ +  +A  L  E++ + +R   L   L  +   L S   A+ +   +++       +L  +I+       ++  ++ QI D+  ++ + + +   L + +   + L +           ++I T  K++ ++DN           + D +++L    K + EF   ++  +  I + +++     P  ++L  +    ++   F E+KV+PL   ++++   G     +  SG+    +E++++ +   ++ L + +++ +  +D+ L++  KF  +L  L +++ +    +  ++ PS +Y   K+QL   + L   L  RQ+S+  L   G ++  + +  +++ ++ +L++L  +++ L + AE +    + A++++K F D   P  +WLD  E+++   +  PT D  ++++RI+E+  L ++          L  +  ++  + S+  +++   K+  + +R++    +      +        +     V  ++D +   ES   +LK     P     + E+    L L + +  H   +++  + G +L +  S +++  +  K++ L   + +++      L   +N++P+ ++F  A+N+L   + S  A +     R+ D L  +    +M  + +  N V   +CQ          +   E +   +E I   + +RF  ++ ++ +KA ++  +  +AK    ++D+ +E     +  + E       D   +E        L+ A  ++  SIN  I+            SKK++R++P S+   +L+  +D +K+  ++  +    +   L++A+PL++ F  S+  L  WL + E+ + +  +  L PDQ+   + + + L  S  + KPLLD + K+G  L  +V    G  I   ++    RY  ++  ++ R   LE  +  +++ ++K++     L N  D++      S  P+K+ E++   D ++ DLDK Q     +Q    +     K  N  D +V +I  KL K+++    +Q+ T +    + ++LS+A  FW  L  +     ++   L+         + +  ++  ++++R EID  + ++ ++ + G  L+     P++ P+V++  E+L   ++ + +   ++  N+        +  E    L ++  +  ++   LG + ++   V  QI++ K  K++++P   ++E +N+   +LT+ + P     +   L+ +N  W  LL G+ +RQ QL+  LL LG+F  A++E + WI  T+++L  +K   GD   LE+ LA+ K++  D+   Q SV  +     ++I+ +  S+    TQ +L +L   W++L + A  +  ELE+AL+EA  +  + Q+I   + ++ + +   K  GGLP+TA EQL+RFM++Y       PK+     +  E     ++    S    ++  +  L ++WD V + A  +K +LE A++    FH  +  F+ WLT  EK L+   PVSR++ TI  Q+E H+ L++D+++HRE ML LDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R LD+GYKEA+ F D    ++  +    ++L++   + +  + P KI++ I K KE H  LG     YD T R G  L ++AP  D   +D+++  L+ +W  + +KSI+R++ L +ALLLSG + DA+  LL WL+  + +L+++     GD+ TVQ L   H  +E+ L+ R   ++ +      L  +   ++  +  QL E++S W  V     ++  RL+ A   A +      +L ++   +EH+LR    +P++EK  +   M+  H  F K+L + E +  +  ++  +I+  AYP+A   IK++++II+ +W ++  W+  R   L+ HL  L +    +++LL WL+  EGTLL  +  +L   +   +    +H+ F+ +   +Q + D      ++   ++K     KTP      D                  R + +   +G +   E  F +P+   L +KW+ VW +   R++ L DH+ YLK+VE  +NF+++DWR+R++ +MNH KSR+ D FR+ D D++G + R  FIDGI++        +KF T+ +EM+ VAD+FD+   G ID+++F+AALRPD +  + KPAN+++ IHDEVK+ +  CTC   +++ Q G+GKY+FGD++KLRLVRILRS VMVR+GGGW ALDEFL K+DPCR                      AKGRTN ELRE+     G   +MA F  + +T       P  A   S       SSP  H        P  S + P      R  ++IP SR S+S  S  TP  ++                           +PG  R    P +R  S+QGS+  +RH S
Sbjct: 2914 KLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGRLDN----------RVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPT-DEEKIQQRIREHDRLHDEILGKKPDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDA---SDNIGALLAESRQGLRHLVLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQ----------LSPGEGA-ATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREA------DLPAME------PKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIA--KAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDK-PEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSS--SNLQHTLRTLKQRWDAVVSRASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDWLKKAKSRLNENGP-VHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDL--ERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNAPDDEK--VSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRGSSHDLREQSPDGTLRRQSFKGSRDQGLNARKGSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILN--------TKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQ--ERKPANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCR----------------------AKGRTNIELREQFILADGVSQSMAAFTPRRST-------PNAAATAS-------SSPHAHNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGS 5319          

HSP 2 Score: 318.161 bits (814), Expect = 1.366e-85
Identity = 281/1185 (23.71%), Postives = 548/1185 (46.24%), Query Frame = 3
Query:  726 QFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDI--------EEKIYQFRN---QYADLYANLNSALEELNDDF------------DHNDFRID-FNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGV--ISNRQYTPIH-------------SMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTF-----NEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYE 4118
            +  DIV   K D++S ++ LL+W+R++   YP + + +F++SW+DG AF AL+H+ RPDL+D +    +  ++ LE AF+  +KE GV ++++PEDV +   DEKS++TY++SL+++ P+   I        + +++++R+   Q+        + L+E +  F            D   FR D  +  + E + L  +  Y+     F+ + +VD   E + +   I   W +  T  +++ +IL  E ++++R ++++  +  E   +  K+ ++E +I +    + +    +    + ++  E+   E  I +M      L    YP       +  ++ K++K+ +++ +L     ++ V  +S  +Y P+H             S ++  N  +  L +   W   K   +   ++ +DL  +          +KI ++F T        + K S DE  +             + Q  N L+  + EL    +K  +D  S   FL +++  + W+  KE  +I   W D + + L      ++NL+ ELE RE      +  G  L    H A+  I+  L  L+ +W W+L LT CL+ HL+    Y QFF E  +A+  + +    LNS+F +    GLD+GE L R ++D+ E +  + ETV  +   +Q+V  L+ R   +   ++  V+AIC+ K+       Q  +GE + L +NSG   WRV  ++ +    P  C L+     +A   A  L   F     LW K+ L+LR+ ++ +T+ +VK W  + F  + P  R  I   LN DA++L   L   + ++ ++ +    +++ N  F E         + R  + + S     +  E   ++  +L+D       M +EL   + +P+  D+D LE  +  H ++E  L   EP++  L    +    +T  LK  L+ +++LW++L  ++ +   +LK  E   + L++ + VI E+E  L  +++  P+  + ++ +  QL   QD I+     +  +    DQL       R         D+++L   ++ +  R+  + NQ+ +R+            L++ ++  ++W+ G  T   S +    + +E       + K+    +E    KP+I+ +N +    +   + Y+
Sbjct:  210 EISDIV-VGKEDNVSAREALLRWARRSTARYPGVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERS--FPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQI--YKELERYFETVGEVD--VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPH------VSELHKKVNKLHQRWAQLRTNFHTNLVQKLSGLKY-PVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELAL-------------YQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ-LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQS-DFGLDQGETLLRGMQDLREELNAFGETVATLQRRAQTVVPLNKRRQPV--NRQGPVQAICAYKQQGQL---QIEKGETVTLLDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKL---LSEGDPNDPQLRRLRREMDEVNRLFDEF--------EKRARAEEESKQASRIFTEECLAIKSKLED-------MARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHVISELENELA-RHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQL------GRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDGT-TERLSAMPTATSAYE-------LDKLLGAAIE---RKPKIENVNVAGGRLIREAKIYD 1324          

HSP 3 Score: 113.235 bits (282), Expect = 1.040e-23
Identity = 231/1074 (21.51%), Postives = 474/1074 (44.13%), Query Frame = 3
Query: 8433 LNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRS-RLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNV-----KSVEDLQKSLTDLKLLDN------EFAS----YNNDIRVLIGSKIKFIDK----INKLEEQRKKFSD-LVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQ-------KILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIK-NIGSLSLDPKYINEQERLIQTILAEISSRQPFLENV------LMNNAS------RNEPKLKELDDKIKQKLLVASNIEAK-VNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPL---SPTSITKQPTTAN--RQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQ--DLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEE-------IQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKID 11486
            ++E  NQ  ++  + + +E  SQQ  V T + +I + ++   D +       LE +   L++  ++    +N+R+ RLL            RL        KL+  +D  S+      +++ED ++SL+DL  L +      EF S    +  D+R +  +  KF+D+    +  L + R    + L  V  +S+ +S   QE++     +   Q      YK  L+++  + + +  L  +Q++     + + E L+       +I+S         +    +    L+ E++S+ +++   + +L N ++SL    +  E I+    PI    N +  +   L E  + +++  + +     ++++L  W+ + + + K N+   SL  + + EQ R  + +LA++ S Q  +++V      L+ +AS      + E  L ++  K  +KL   +N   + ++D    L  +   + +    +A   E L  R    L  E+   +++E+    +      E   +  K+L+S  +  D   +   ++ LE  W ++N  I+ R+K    +      Y  LK +++  L + E  ++   P+AIDL  ++ QH++++    ++    P I++   IG++YD+++           +  SP RK S       T PL   S  + +  PT           S    S  SS D   L+ E S    ++++I +RY  IG +L +R+ ++  L  +     +  K  +  L+    +L    V N    +  I+  R   +    + +L +  T  Q  D+LR +  VPG  +L+ + D +++K+ +L D  K  +         +   G +K  +++    KERML VLGP+ +      +Q+QQV  L +E    +  +K  + +G +++  ++ T  +   +E  L  +  K D+L   L DR  ++      SK+F   +N + + L  + + +D     + T  D +E       ++ +L+  + +L + E  + TL   + D  +  ++ ++V+ L +    +Q K+D
Sbjct: 1631 IDELRNQ--INALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDR----VNDRTVRLL-----------RRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVS-----LVSAQ------YKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPME-INQLELPIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKF-EKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKINDIGAQYDALI-----------RPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRRSSQDGFQLS-ELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDT-TKAQVKDILRRKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDS----KERMLTVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGT-PDAQAVEIKLKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLD----TLPTDGDHQENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLD 2652          

HSP 4 Score: 86.2705 bits (212), Expect = 1.553e-15
Identity = 343/1848 (18.56%), Postives = 764/1848 (41.34%), Query Frame = 3
Query: 12783 IIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSE--------QKVDPLKKQLEE----LIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLD---------------AEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND---DSSIDESIKKLKIIINKVDGVFSENVSID---TKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFE---SAMKDLKLNIVDPY---QTRDIWEESLNLVKEVKSHEETLKNLD----QVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDI-----FVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNF----EQKINEMSDQINNDY-------SELEECKI---DFTNLLSAWNEQK-ESINSTIND----SKKLIRQA-PGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYD--LDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-DKKKLIEDLRGEIDVHEKDIGKIS------QKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR--LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKR----FMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATH-LKYISQKHDIVL--IRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQ-SEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGS-IKHYINIIKSQWSDLLSWSEQRGLNLKDHL 18062
            ++  +DDR NSL        EF++  N              L + L N S N+             +K++ L++QLE     L D+  ++ +T+ + LG      +++S   + ++  Q ++ ++  +D K   + + + SL + + F EN S+ L                +  +P++++     Q+++H  +   +  R+  +  L   G DL   T   +   ++ +LD +  ++E L   A  ++ R    ++  K +    E  L WL TAE  LA+  T   +   ++E R+++ +  +++    S   E+ K L          F  +  ID    K ++  + DR+         +   +      L ++ D++   + +L   E   +A   L     DP    + + I EE  NL K ++S +   K++       G D   ++SE D  A   +++ L    D+       +    +++     +F   N ++  +   L  L  E + L+     R ++I++ + + V K+    +  LD+L  V   E++ E+  D+     F  +  + +E ++ + K    +G    + +  E+NL   ++ L  F     Q ++++ D +++++       SEL++ +    DF N    + E+K E +   ++      + L+R A  G    +++  ++++  +     + +  + ++LD A+  + +F  +   L  WL +TEE +   K  + D   +    QE K L     D++  +  +   G  ++      +  +I   + D  KR++ + +  + R  DLE+ + +    ++K+      L+N    +          EK+ + +   D  L+D  L K   F D     + + +    +    +++V + EK+  ++    GL    ++  + I  LL+ + +    L L    + ++   + +   E    +SV    +KL+E +   ++++E   G  S      + G +L++ ++N +E   ++   + L+R +  + +     + +      L+ +  E   +L EW +     L      P+E  P    + + +    D+ P    ++ INQ+G QL + S       + S + R N  +  +++ + ++  +L        E    +DE +EW    + +L    +   +   +   L +H+ I  D++  +  V  +   + ++++E   S  + AT R  L+ L++  + + +    +   LE AL  +  F    Q ++  +D++  ++         PD    Q  +       I    P L+   +      A ++      I + ++ D      ++  ++     R+  LE A++    F   +   +  L  T   +NQ  P+S +   I EQ+E + AL  D+   ++    + + A   +     K D  +  I+  +  +++ W  V + + +R  +LD     A+ F     +++  +    E L         P  I++Q    +E    +       +  RR G  L +     D  ++ + + +L   W ++     +RE+ L DA+  +  + + + NLL +L   E K +      G D++ V+  + +    + ++      +E +N  A+ L  + S E ++ I + L+ +   W  + +   E++++LE A     +F+   N L  + +K++  L Q    P +   +L+   ++   +   ++  ++  ++     G +++ +     E S  +  +  + ++W  LL  +  R   L++ L
Sbjct: 2541 LVGKLDDRANSLGGAADSSKEFDAAVN-------------RLREALQNISDNLDTLPTDGDHQENLRKIENLERQLEGQRPLLADV-EQSAATLCNILGDPASRADVNSRVAALEK--QYLA-LQKKLDTK---KAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQH-----QIDTHEPIYREVMAREHEVIMLINKGKDL---TDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSETFLAWLRTAEDKLADL-TPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGL-------GETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTSEVDGLA--DRMSELQGRLDD-------RCGELQSAATAVSQF---NEQMKSLGIDLNDLETEIEKLSPP--GREIKIVQVQIDDVGKI----QTKLDRL--VGRLEDA-ERAADVLVDAGFAADTTQTREQISTLRK---TLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQD-VSDEFKRMKPVGSELDQIRRQQEDFRN----FRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDR-LHDEILGKKPDFSD-----LADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGL----VDASDNIGALLAESRQGLRHLVL---SYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISN-DEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAAL-----APSE--PRQADVLRLEGELADMRPI---LDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQS-ENTATLREKLDDLKEIVDTVAQLCSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDN----ARYAALRLELRERQQALESALQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHLGA-VGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGD--PQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQKASDRQHELEEAL 4291          
BLAST of Dystonin vs. Ensembl Zebrafish
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 645/2335 (27.62%), Postives = 1174/2335 (50.28%), Query Frame = 3
Query: 12489 YLNSKHKAMDEC---KSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE-----QKIETAEKS------MHKIDNLAAINEKIIESIDDRQNSL--ILQHKIVTEFESKKNDFIRKIDEANNDPEL-------AKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----------DSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQK-SHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQ--VGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEA---TQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT---PPL---IPIFDRS----KRMETNQGISKIQEPLFV---NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK---------------------------------------------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF 19145
            +++   K  D C   +S++      Q ++RE   +F     +LD +     DL  LR + + IE  ++ L+    N +      +K+  +E S         ++ L     K+++    R+  +   L H  + EF SK  +F   +  A    E         +++N   ++   F +  ++ L+ QL+EL  +G         G   K+++ +++ V   ++ L + V++    +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L  R+++++ +   G  +        K ++  E++ L  +++ LL  AE ++ + +    +++ F +  EP   WL   EK LAN +   T  + ++E++I ++K L+ +            S+ +S++ L  + +K      E V +  +N        F E Q+    +   L     N      D+V L    L    + + D+ +    P        E L L ++++  ++ ++     G +L + ++ ++   I  K++ +   + EI+  +       + ++ +A +   ++ +L++ L  + A   E D  T    +GE+  E+   ++  V++L  Q +  LD L  V +    L      E ++ +  E+ +R++   + + ++  +  +   K++  E+     ++  ++ E K++ + D   +     ++L+  K    +++      K++++  +   + ++     ++ ++LK  +  + ++    ++    +  QL+ A  LA +F  +++ L  WL +T     Q     ++ + L + ++E++ +     + KP +D + K+G  L ++ +  +G  I    E A + Y  +K  +K RA+ L++ I  +T+ ++K+D     LE I +R+      SV  EK+ E++     +  DL+KLQ   + L Q G E  +  R    DKD S + ++ KL ++      +Q+   E + K+++++ LA +FW D   LI      +TI  T   +++L    V+      +++ +E  R EID  ++++  +   G +L+     P++ P ++++ +E+   +E +  + ++++  ++       + ++    + +    +  +L  + P+ T+   V  QI++ KE K D      ++E +N Q G  L K    + +  ++  +  +   W  L   +  RQH+L+  LL+LG+F  A+DE + W+  TE  L   +   GD  ++E+ LA+H +++ D+   +++V  + R   ++++   SS G EA     +LE L + W+ + E    +   L+ AL +A  F+G+ +++ + + +   +L   K  GGLPDTA+EQL   +++  T        +  +E   +I   + +      E+D+  L  KW++V+   + RK +LE+A+     FH  +  FINWLT  E+ L    P S I+ TI+ Q++ H+    ++ SHR++++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV RS ER R LD   K AK+F +    L++ +  +   L+ +  I   P KI+ Q+T+HKEF   LG  +  YD+T R G  L+DK  +Q D++K+D ++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLE+A +QA EF    + L E+ +++E  LR     P++  EE +  +I  H  F K L    + ++     G  IL   +P++  +IKH+  IIK+++ ++ +W+ Q    L   LD L   + LL+ LL WL  AE TL   +   +   L E K    EH+ F+ +MT KQ D D++    K+K    PP+   IP+ D+     KR  T    +       +   NP++N L SKW+QVW + L+RR++L D ++ L+E++   NF+F+ WR+RYM WMNH KSRVMDFFRR D D DG+VTR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C   +++ Q G  KY+                                             FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S  +   AKGRTN ELREK   P+GT   MA F
Sbjct: 1362 HMSISKKVDDACSSLESKLLGIGQFQNSIREMFASFADLDDELDGMAPVGRDLEILRDQKSAIEAFVAKLQDLTRNTSNGRDSCRKMLESEASPDLLGLRRDLETLGKQCGKLMDRATARKEQVEETLGH--LEEFYSKTQEFTSNLSTAERQEESQGSVGLETEVINQQLESFKVFQKDVIESLQSQLQELNTLGQALIQNAPKGTSTKNLDHDLEEVNSRWNTLNKKVAERSAQLHEALLHCGRFQDALESLLSWLTDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKATVELIKTEGRKVTDLADTVDKEKIGREIECLGQRWDALLKKAENRHKQLENISVVAQQFHETLEPLTEWLTATEKRLANSEPIGTQTS-KLEEQISQHKALEEEVLGRGKVLYQAMSLGQSLRTLGCVDDK------ETVQVKLENTQRS----FLELQELCRQKDELLRQARANAQLFGEDEVALM-TWLDEVHAKLSDVSVQDYTPAVLEKQHAEQLALHEDIELRKQNIEQAILNGLELLKQTTGDEVVVIQGKLDGIKTRYSEINTMSSSVSKTLDKALSLATKLQSSHEELNVWLEKVEA---ELDMFTDPQPLGEQLTELQHRQSALVQQLKEQ-KPLLDALNEVSSALLELVPWRAREGLDRMITEDNERYRSASDALIQRVEQTRAAILKSQQFEQAAGAELQWFTDAEIKLSGLGDVSLEPEKTTAQLQAQKSFSMDIM----RHKDAVDDIVKTGEAIMNSKDEAEKQALKVKLQALLEKYTVVSQLNSERCLQLERAHSLACQFWETHDELWPWLQDTRATFTQLSQPAIEYEALRQQQEELRQMRELIAEHKPHIDKMNKTGPQLVEL-SPAEGTAIREKYETADRLYGQLKVDVKHRASTLDEAISKSTQFHDKIDPMLESLERISERLRQPPSISVEVEKIREQISENKALSVDLEKLQPSYETLKQRGEEMIA--RSQGADKDLSAKAVQDKLDQMVFLWTDIQALLEEREAKLLDVMDLAEKFWCDHCALI------VTIKDTQELLKELEEPGVDPSVVKQQQESVEGFREEIDGLQEELNVVQNLGAELMTACGEPDK-PVIKKSIDEVNSAWETLNKTWKERVEILEEAMQAAVQFQDSLQNMFDSVDIMEGKLDSMSPVGTDLETVKQQIEELKEFKGDAYQLQIEMERLNHQAGLLLKKVMDEDDRTSISEPMNELKMLWENLDKKIINRQHKLEGALLALGQFQHALDELLTWLTHTEELLGEQRKACGDPKAIEIELAKHHVLQNDVLAHKSTVEAVNRAGCDLME---SSAGEEARGLQNKLENLNQRWKNILEKTEQRRQLLDSALLQAQGFHGEIEDMQRWLKDSERQLLASKAVGGLPDTAREQLNTHLELCSTLEVKEEIYKHLLERGQQILAMTPEGQDSTTELDLRNLQDKWESVQAKVKERKVKLEEALAMATDFHNSLQDFINWLTQAEQTLTMVSPASLILETIMFQIDEHKVFVTEVNSHRDQIMELDKTGTHLKYFSQKQDVVLIKNLLLSVQSRWEKVVQRSVERGRLLDDARKRAKQFHESWSKLMEWLEESERALDTELEIANDPDKIKTQLTQHKEFQKALGSKHSVYDTTSRTGRALKDKTSLQDDNQKLDHMLSELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAE-DQPVHGDIDLVLNLIDSHKVFQKELGKRTGSVQALKRSARDLIESSHDDSSWVKVQMQELSTRWETVCSLSVSKQTRLEQALSQAEEFHSTVHILLEWLAEAEQSLRFHGALPDD--EEALRALIEQHKEFMKRLEEKRLALSKATSMGEAILSICHPDSITTIKHWNTIIKARFEEVTAWARQHQQRLSSALDELQATQELLEKLLNWLQWAETTLGEKDKDPMPQELEEVKALIAEHQTFLEEMTRKQPDVDKVTKTHKRKATADPPVQSHIPVLDKGRTPRKRSPTQTMYTAAASQAQIETKNPRVNLLVSKWQQVWLLALDRRRKLNDALDRLEELKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQDGKVTRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPLTDADKIEDEVTRQVAKCKCPKRFQVEQIGANKYRFYLGNQFGLVHCLHDPLIADETITNRDNQNLTPHLHVAVLESCILFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITQSPIAKGRTNVELREKFILPEGTTQVMASF 3648          
BLAST of Dystonin vs. Ensembl Zebrafish
Match: macf1a (microtubule actin crosslinking factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3606])

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 643/2462 (26.12%), Postives = 1206/2462 (48.98%), Query Frame = 3
Query: 12420 EPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSN--------------------LKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDF---IRKIDEANNDPELA----KLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFED----TLYGFESAMKDLKLNIVDPYQTRDIWEE---SLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALV--RENDSLTG-QVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWN----EQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKL-QIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLP---TETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXX-XXXXXXQSIGKAI---EIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPI-QDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIP--IFDR--SKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFK------------------------------PATLPIPT-------------KKPTTA--KIPSPRVSQPL---SSPRIHQPVSSPRIPQPV-TSPRIS-----QNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            E E E++  + +   SSL  +L       + + E +SR+    +R  +L +++D+      D DSL  Q   +       N +   L N                    L+ E E L+ Q  + AE+  +++         +IES ++R          V EF ++  D    + + +E  N   +     +++    +   A   ++VD ++ +L+ +  +G     +       + +E ++++    ++ L + V++    +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R+ +++ +   G  +    +   + ++Q +L  L  ++ NLL  A  +  + +    L+  F +  EP   WL   E+ L++ +   T  + ++ ++I  +K LQ + SS + ++ +L+ +   +  +   + + D     + L +R    +  H E  +  ++   +L   L    LF +     L       + L    V  YQ   + ++   +L L +E+ S ++T+    + G+ L + ++  +   I  K++ + + + E++  + K L   E ++ +A RF  +++ ++  L  + A +   E D+    Q  ++ ++ +  E   V   V +  + L  L    A E     ++ +  +  +R+++    +T++   + +   +++  EE +D  +  +   E+K+  +        S   +  +    +  A+N      K++++  +   + ++         +LK   D +  + E+  ++   +   L++A  L   F  +Y  L+ WL ETE  + Q     +D + L + + +++ L  S  + KP +D ++K G  L+++  + +G  +     +A++RY  IKE +K+RAT L++ +  + + ++K+D     LE    R+      +   EK+ E+L        +LDKL   F      G E  S   +  +D   +  +  +L ++ S    ++ +  E + K+ ++L LA +FW D+  +       T+  +   ++DL    V+      + +  E ++ E D   +++  +   G  LI       E P+V++  +E+   +E +  +  +++  +D   +   + ++    L   F  ++N +  L  +P   T+   V  QI++ K+ K ++  +  D+E ++  G   L K S    ++ +   L  +   W  L+D +  RQH+L+  LL+LG+F  A+ E   W+  T  +L   +    D  ++E+ LA+H ++R D+   +++V  +    +E+++   SS G E      +L++L +SW+ L      +   LE AL++A  F+G+ +E  + +    S+L   K +GGLP+TA+EQL++ M++     +      + ++     +  +  +  G      + ++ +L  KW ++    E R+ +LE+A+     F   +   INWLT  E+ LN  +P S I+ T+L Q++ H+    ++ +HRE++L L+K  + L++ S K D+VLI+NL+ S+  RW+K+V RS +R R+LD   K AK+F +  R L D +      L+ +  I   P KI+ Q+ KHKEF  +LG     YD+T R G  +RDKA +  D++K+D ++  ++ KW ++C KS+ER+  L +ALL SG + +A+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  LM    +D+++++ QL EL + W+ V  L+  K+ RL++A  QA EF      L E+ S++E  LR   + PEE   E +  ++  H  F + +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL WL  AE TL+  ++  L+  + + K    EH+ F+ +MT KQ D D+ +T + K+ P   P  + DR  +++ +  Q      +    NP++ QL S+W+QVW + L+R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF T+++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV       C C           A+GRTN ELREK   P+G    +A F+ +                              P+    PT              KP  A  K P+P   Q     S    H+  S+ ++ +P   S R S        P++       + RTP   + P  +  SR  +R +S++GS AS
Sbjct: 2973 EKEFEEVTEKTEQCCSSLESRL-------QGVGEVQSRVRDVFSRLADLDDELDSLSPVGRDADSLASQADAVRGFLSRLNALRSELENHGGECTTMLRREGSSPDLLALRRETEALSRQAGKLAERGQNRL--------ALIESAEER----------VREFYARLADLQALLGRAEEVLNTQAVVGTEVEVIKQQLQEFKAVEREQVDSIQPKLQHVNAVGQGLIQSAAKHTDTQALEHDLETTNLHWNSLNKRVAERIAQLQEALLHCGKFQDALEPLLSWLSDTEELIANQKPPSAEYRVVKAQIQEQKLLQRLLDDRRGTVEMIRAEGERIAATAETQDRDKIQKQLQSLGERWTNLLEKASARQKQLEELQVLALQFHEAVEPLSEWLSATERRLSSAEPMGTQTS-KITQQIVRHKALQEEVSSRENNVDRLESLSQSLHPL---SCAADQ----DWLGERVGAVRSGHTELRDWCVRREAMLEQALANAQLFGEEEVEVLNWLAEVAQRLAEVSVQSYQPEHLEQQHKHTLALNEEIVSRKKTVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKSRYAEMTAGSSKALRTLEQALQLATRFASSHDDINQWLDRVEAELNNAEPDTTPAYQDRQKELKCVSAEKRLVLDTVNEVGSALLDLVPWRAREG----LDRLVADANQRYRQADETITQRVQLVQAAIQRSQQYEEAVDAELTWVGETERKLASL-----GPLSLEPDVTVAQLQVQRAFNIDIIRHKDTVDQLLKTREDILESCSEQQRDALKVKTDSLSARYEAVNQSHAERFSALEQAQVLVARFWETYEELEPWLGETETLITQLPPPAIDTEALRQQQDQMRLLRESIAEHKPHIDKLLKIGPQLAELSAQ-EGATVRQRYNEAERRYMRIKEEVKSRATALDEAVSQSVQFHDKMDPLLETLEGAVQRLRQPPPVAAEVEKIREQLAEHRATGLELDKLLPSFSALCARGEELIS---RAPHDDPAAQAVRSRLLRLRSLWDEIRQRAEEREGKLQDVLDLAGKFWADMAALLS-----TLRDSQDIVKDLEDPGVDPSLIKQQIEAAEAIKAETDGLREELEIVRTLGADLIFACGE-TEKPEVKKTIDEMNGAWEGLNRTWRERMERLDEAMTASVQYQDA---LQGMFDYLDNAVIKLCDMPAVGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLSHQGELLLRKVSDQTDRDMIQEPLTELRHLWDNLVDKITVRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPISSDPKAIEIELAKHHVLRNDVLSHRSTVETVNSAGSELLE---SSPGDEINHLRDQLDELNRSWKNLLLKTDERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQAQLAQRGEHYHRLLDHGESILLARGGEDAGPGTTQTQQNLAMLQNKWASLNTKMEDRRGKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDVVLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKIQLAKHKEFQKSLGSKQPVYDTTVRSGKAMRDKATLPADTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAE-DQPVHGDLDLVSNLMDCHKVFQKELGKRTSSVQALKRSARELMETGRDDTAWVKVQLQELSNRWDTVCALSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEE--AETLQALLHTHRDFMQTVEEKRVDVNKAAGMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLTQDILQLKTLITEHQVFMEEMTRKQPDVDK-VTKTYKRKPAEHPSSLSDRKGARKHQQQQQQHHSVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTSKLEMTAVADIFDRDCDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVTVTPGYFC-CR----------ARGRTNLELREKFILPEGATQGLAAFRSRGRRSKPSSRTASPTRSSSSASHSAHSCASVPSAPATPTASSRSSQSQSRGYAKPWLAHSKTPTPTKCQSCPEHSQTPGHEGGSTTKLKRPTFHSSRGSLTGENGGTPTAAKPGRSETKRTPSSTSGPASRAGSRAGSRASSRRGSDAS 5351          

HSP 2 Score: 235.728 bits (600), Expect = 1.408e-60
Identity = 114/228 (50.00%), Postives = 162/228 (71.05%), Query Frame = 3
Query:  402 ADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            ADERD +QK+TF  W+N HL+K+ K + D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  +I  S +S DL+ K+ LL WS++A E YP +   NFS+SW DG+ F AL+H+ RPDLID++ +++ S ++NLE AF  A+  LGV ++++ EDV     DEKS++TYV+S+++  PK
Sbjct:   22 ADERDRVQKKTFTKWVNKHLIKVRKHITDLYEDLRDGHNLISLLEVLSGVTLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISEIYVSGESGDLTAKEKLLIWSQQATEGYPGLRCTNFSSSWSDGRLFNALLHRYRPDLIDMQVVAQQSNRENLEQAFEIAES-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPK 248          

HSP 3 Score: 96.6709 bits (239), Expect = 1.497e-18
Identity = 77/406 (18.97%), Postives = 185/406 (45.57%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDM--DFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILN 3026
             W++E   ++    + +DL  + +  +        ++D ++  K     E++   ++   + ++ + L+ ++ +L  + S      +S   F+    E + W+  +E++++ + W D+ +  ++ K+E++ ++  ELE ++  +         L + NH A   ++   A L+++WQWI  L  C++ HL+    Y QF  ++ + ++ + +L + +  ++       L   E L ++  +  E + +Y+ TV  ++  ++SV  L  R+          ++AIC  ++          +GE   L +NS    W+V +        P++CF +   + +A  TA  ++  +  +  LW +  L ++  V    L   +  + +W+ +      P  RQ+ ++ L+
Sbjct:  548 GWVEETQDLLERAEWGSDLPSVEQHLQDHHIIHTAVEDLLNSLKEARTYESRVSPNLRSSYSETLSKLENQYCKLLEHSSWRLRCLESLRAFVSHCTEELIWLNEREEEELAFDWSDS-NTNMAAKREQYADMRSELEEKQDVMRSLQDTADHLCLENHPAKQTVEAYSAALQTQWQWIKELCVCVEQHLKDNTAYFQFMSDSRDCESYLRQLQDTIKRQYTCDKNSRLGRLEDLLQDSMEEKEQLIEYRSTVASLVGRAKSVVQLRPRSADSNLGTTTPIRAICDYRQIEANSQITISKGEECVLEDNSQRTKWKVISPTGNEAMVPSVCFTVPPPNQEAIDTASRMEQMYQNVMSLWHQLHLNMKSVVSWHYLQKDIRNISSWSLDTMRLQPPAERQQALDNLD 952          

HSP 4 Score: 54.6842 bits (130), Expect = 5.939e-6
Identity = 77/317 (24.29%), Postives = 144/317 (45.43%), Query Frame = 3
Query: 9441 SINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQP-------FLENVLM---NNASRNEPKLKELDDKIKQKLLVASNIEAKVND-TRKLLG---SFEVAVKSCGDWIALTTEL---LSDRMFVRLDN--------EKFKEKL---DEIKEGYEMKQRDMEQARKICKEL---VSQSNCKDQ-----NSIEICMENL-EKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLL-ALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQA 10277
            + + L  WL+E +  +  +G LS+DP  +N Q++ +Q +L E  +RQP         E +L    +  SR+E  L+E+  ++       ++I A+ +D T +L G     + A  +   ++ L  EL   ++D +  RLD         E  + +L    EI+   E ++  + QA ++C EL   V++   +D+      S+   ++NL E+    L++L       LS  + + + + +L++ +  N  N    +S   P   D L  L  Q ED +  I +   S  +I       +E  S++   P G ++ A
Sbjct: 2445 AASQLGPWLREKELMMSVLGPLSIDPNMLNTQKQQVQFMLREFETRQPQFDQLTRAAEGILSLTGDERSRDEQDLEEVRREL-------ADISAQWDDLTSRLSGRSQQIDQAQGTSQHYLTLLRELSQSVAD-LGERLDAQASLSAQPEALRRRLQETGEIRSELEQRRGQLSQAEQLCTELSAIVAEPYLRDELHKRLESVSGPLKNLEERAADGLSQL----QAALSSTQQFQQMFDELRSWLDGNTGNQTTGMSETLPCQPDALKTLLTQQEDFQRAIAQQRGSYELIQ------AEGASLLASLPAGDERLA 2743          
BLAST of Dystonin vs. Ensembl Zebrafish
Match: macf1a (microtubule actin crosslinking factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3606])

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 640/2462 (26.00%), Postives = 1203/2462 (48.86%), Query Frame = 3
Query: 12420 EPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSN--------------------LKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDF---IRKIDEANNDPELA----KLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFED----TLYGFESAMKDLKLNIVDPYQTRDIWEE---SLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALV--RENDSLTG-QVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWN----EQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKL-QIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLP---TETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXX-XXXXXXQSIGKAI---EIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPI-QDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIP--IFDR--SKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFK------------------------------PATLPIPT-------------KKPTTA--KIPSPRVSQPL---SSPRIHQPVSSPRIPQPV-TSPRIS-----QNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            E E E++  + +   SSL  +L       + + E +SR+    +R  +L +++D+      D DSL  Q   +       N +   L N                    L+ E E L+ Q  + AE+  +++         +IES ++R          V EF ++  D    + + +E  N   +     +++    +   A   ++VD ++ +L+ +  +G     +       + +E ++++    ++ L + V++    +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R+ +++ +   G  +    +   + ++Q +L  L  ++ NLL  A  +  + +    L+  F +  EP   WL   E+ L++ +   T  + ++ ++I  +K LQ + SS + ++ +L+ +   +  +   + + D     + L +R    +  H E  +  ++   +L   L    LF +     L       + L    V  YQ   + ++   +L L +E+ S ++T+    + G+ L + ++  +   I  K++ + + + E++  + K L   E ++ +A RF  +++ ++  L  + A +   E D+    Q  ++ ++ +  E   V   V +  + L  L    A E     ++ +  +  +R+++    +T++   + +   +++  EE +D  +  +   E+K+  +        S   +  +    +  A+N      K++++  +   + ++         +LK   D +  + E+  ++   +   L++A  L   F  +Y  L+ WL ETE  + Q     +D + L + + +++ L  S  + KP +D ++K G  L+++  + +G  +     +A++RY  IKE +K+RAT L++ +  + + ++K+D     LE    R+      +   EK+ E+L        +LDKL   F      G E  S   +  +D   +  +  +L ++ S    ++ +  E + K+ ++L LA +FW D+  +       T+  +   ++DL    V+      + +  E ++ E D   +++  +   G  LI       E P+V++  +E+   +E +  +  +++  +D   +   + ++    L   F  ++N +  L  +P   T+   V  QI++ K+ K ++  +  D+E ++  G   L K S    ++ +   L  +   W  L+D +  RQH+L+  LL+LG+F  A+ E   W+  T  +L   +    D  ++E+ LA+H ++R D+   +++V  +    +E+++   SS G E      +L++L +SW+ L      +   LE AL++A  F+G+ +E  + +    S+L   K +GGLP+TA+EQL++ M++     +      + ++     +  +  +  G      + ++ +L  KW ++    E R+ +LE+A+     F   +   INWLT  E+ LN  +P S I+ T+L Q++ H+    ++ +HRE++L L+K  + L++ S K D+VLI+NL+ S+  RW+K+V RS +R R+LD   K AK+F +  R L D +      L+ +  I   P KI+ Q+ KHKEF  +LG     YD+T R G  +RDKA +  D++K+D ++  ++ KW ++C KS+ER+  L +ALL SG + +A+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  LM    +D+++++ QL EL + W+ V  L+  K+ RL++A  QA EF      L E+ S++E  LR   + PEE   E +  ++  H  F + +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL WL  AE TL+  ++  L+  + + K    EH+ F+ +MT KQ D D+ +T + K+ P   P  + DR  +++ +  Q      +    NP++ QL S+W+QVW + L+R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF T+++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    +A F+ +                              P+    PT              KP  A  K P+P   Q     S    H+  S+ ++ +P   S R S        P++       + RTP   + P  +  SR  +R +S++GS AS
Sbjct: 3341 EKEFEEVTEKTEQCCSSLESRL-------QGVGEVQSRVRDVFSRLADLDDELDSLSPVGRDADSLASQADAVRGFLSRLNALRSELENHGGECTTMLRREGSSPDLLALRRETEALSRQAGKLAERGQNRL--------ALIESAEER----------VREFYARLADLQALLGRAEEVLNTQAVVGTEVEVIKQQLQEFKAVEREQVDSIQPKLQHVNAVGQGLIQSAAKHTDTQALEHDLETTNLHWNSLNKRVAERIAQLQEALLHCGKFQDALEPLLSWLSDTEELIANQKPPSAEYRVVKAQIQEQKLLQRLLDDRRGTVEMIRAEGERIAATAETQDRDKIQKQLQSLGERWTNLLEKASARQKQLEELQVLALQFHEAVEPLSEWLSATERRLSSAEPMGTQTS-KITQQIVRHKALQEEVSSRENNVDRLESLSQSLHPL---SCAADQ----DWLGERVGAVRSGHTELRDWCVRREAMLEQALANAQLFGEEEVEVLNWLAEVAQRLAEVSVQSYQPEHLEQQHKHTLALNEEIVSRKKTVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKSRYAEMTAGSSKALRTLEQALQLATRFASSHDDINQWLDRVEAELNNAEPDTTPAYQDRQKELKCVSAEKRLVLDTVNEVGSALLDLVPWRAREG----LDRLVADANQRYRQADETITQRVQLVQAAIQRSQQYEEAVDAELTWVGETERKLASL-----GPLSLEPDVTVAQLQVQRAFNIDIIRHKDTVDQLLKTREDILESCSEQQRDALKVKTDSLSARYEAVNQSHAERFSALEQAQVLVARFWETYEELEPWLGETETLITQLPPPAIDTEALRQQQDQMRLLRESIAEHKPHIDKLLKIGPQLAELSAQ-EGATVRQRYNEAERRYMRIKEEVKSRATALDEAVSQSVQFHDKMDPLLETLEGAVQRLRQPPPVAAEVEKIREQLAEHRATGLELDKLLPSFSALCARGEELIS---RAPHDDPAAQAVRSRLLRLRSLWDEIRQRAEEREGKLQDVLDLAGKFWADMAALLS-----TLRDSQDIVKDLEDPGVDPSLIKQQIEAAEAIKAETDGLREELEIVRTLGADLIFACGE-TEKPEVKKTIDEMNGAWEGLNRTWRERMERLDEAMTASVQYQDA---LQGMFDYLDNAVIKLCDMPAVGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLSHQGELLLRKVSDQTDRDMIQEPLTELRHLWDNLVDKITVRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPISSDPKAIEIELAKHHVLRNDVLSHRSTVETVNSAGSELLE---SSPGDEINHLRDQLDELNRSWKNLLLKTDERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQAQLAQRGEHYHRLLDHGESILLARGGEDAGPGTTQTQQNLAMLQNKWASLNTKMEDRRGKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDVVLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKIQLAKHKEFQKSLGSKQPVYDTTVRSGKAMRDKATLPADTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAE-DQPVHGDLDLVSNLMDCHKVFQKELGKRTSSVQALKRSARELMETGRDDTAWVKVQLQELSNRWDTVCALSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEE--AETLQALLHTHRDFMQTVEEKRVDVNKAAGMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLTQDILQLKTLITEHQVFMEEMTRKQPDVDK-VTKTYKRKPAEHPSSLSDRKGARKHQQQQQQHHSVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTSKLEMTAVADIFDRDCDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNLELREKFILPEGATQGLAAFRSRGRRSKPSSRTASPTRSSSSASHSAHSCASVPSAPATPTASSRSSQSQSRGYAKPWLAHSKTPTPTKCQSCPEHSQTPGHEGGSTTKLKRPTFHSSRGSLTGENGGTPTAAKPGRSETKRTPSSTSGPASRAGSRAGSRASSRRGSDAS 5708          

HSP 2 Score: 251.906 bits (642), Expect = 1.704e-65
Identity = 121/239 (50.63%), Postives = 171/239 (71.55%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            LDP +R V+RVADERD +QK+TF  W+N HL+K+ K + D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  +I  S +S DL+ K+ LL WS++A E YP +   NFS+SW DG+ F AL+H+ RPDLID++ +++ S ++NLE AF  A+  LGV ++++ EDV     DEKS++TYV+S+++  PK
Sbjct:   63 LDPAERAVVRVADERDRVQKKTFTKWVNKHLIKVRKHITDLYEDLRDGHNLISLLEVLSGVTLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISEIYVSGESGDLTAKEKLLIWSQQATEGYPGLRCTNFSSSWSDGRLFNALLHRYRPDLIDMQVVAQQSNRENLEQAFEIAES-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPK 300          

HSP 3 Score: 95.1301 bits (235), Expect = 4.426e-18
Identity = 77/406 (18.97%), Postives = 186/406 (45.81%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDM--DFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILN 3026
             W++E   ++    + +DL  + +  +        ++D ++  K     E++   ++   + ++ + L+ ++ +L  + S      +S   F+    E + W+  +E++++ + W D+ +  ++ K+E++ ++  ELE ++  +         L + NH A   ++   A L+++WQWI  L  C++ HL+    Y QF  ++ + ++ + +L + +  ++       L   E L ++  +  E + +Y+ TV  ++  ++SV  L  R+          ++AIC  ++     ++    GE   L +NS    W+V +        P++CF +   + +A  TA  ++  +  +  LW +  L ++  V    L   +  + +W+ +      P  RQ+ ++ L+
Sbjct:  600 GWVEETQDLLERAEWGSDLPSVEQHLQDHHIIHTAVEDLLNSLKEARTYESRVSPNLRSSYSETLSKLENQYCKLLEHSSWRLRCLESLRAFVSHCTEELIWLNEREEEELAFDWSDS-NTNMAAKREQYADMRSELEEKQDVMRSLQDTADHLCLENHPAKQTVEAYSAALQTQWQWIKELCVCVEQHLKDNTAYFQFMSDSRDCESYLRQLQDTIKRQYTCDKNSRLGRLEDLLQDSMEEKEQLIEYRSTVASLVGRAKSVVQLRPRSADSNLGTTTPIRAICDYRQIEITISK----GEECVLEDNSQRTKWKVISPTGNEAMVPSVCFTVPPPNQEAIDTASRMEQMYQNVMSLWHQLHLNMKSVVSWHYLQKDIRNISSWSLDTMRLQPPAERQQALDNLD 1000          

HSP 4 Score: 55.0694 bits (131), Expect = 5.037e-6
Identity = 77/317 (24.29%), Postives = 144/317 (45.43%), Query Frame = 3
Query: 9441 SINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQP-------FLENVLM---NNASRNEPKLKELDDKIKQKLLVASNIEAKVND-TRKLLG---SFEVAVKSCGDWIALTTEL---LSDRMFVRLDN--------EKFKEKL---DEIKEGYEMKQRDMEQARKICKEL---VSQSNCKDQ-----NSIEICMENL-EKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLL-ALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQA 10277
            + + L  WL+E +  +  +G LS+DP  +N Q++ +Q +L E  +RQP         E +L    +  SR+E  L+E+  ++       ++I A+ +D T +L G     + A  +   ++ L  EL   ++D +  RLD         E  + +L    EI+   E ++  + QA ++C EL   V++   +D+      S+   ++NL E+    L++L       LS  + + + + +L++ +  N  N    +S   P   D L  L  Q ED +  I +   S  +I       +E  S++   P G ++ A
Sbjct: 2813 AASQLGPWLREKELMMSVLGPLSIDPNMLNTQKQQVQFMLREFETRQPQFDQLTRAAEGILSLTGDERSRDEQDLEEVRREL-------ADISAQWDDLTSRLSGRSQQIDQAQGTSQHYLTLLRELSQSVAD-LGERLDAQASLSAQPEALRRRLQETGEIRSELEQRRGQLSQAEQLCTELSAIVAEPYLRDELHKRLESVSGPLKNLEERAADGLSQL----QAALSSTQQFQQMFDELRSWLDGNTGNQTTGMSETLPCQPDALKTLLTQQEDFQRAIAQQRGSYELIQ------AEGASLLASLPAGDERLA 3111          
BLAST of Dystonin vs. Ensembl Zebrafish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 353.214 bits (905), Expect = 4.313e-96
Identity = 259/927 (27.94%), Postives = 452/927 (48.76%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI----YQFR-NQYADLYANLNSALEELNDDFDHNDFRIDFNQTR-LENNYL----TYLKQYES----FCHLFDDISKVDRNNENQ--RKFHTIST--LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMN-----EYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKF------EKLSPPTLSSGVISNRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLD----------GLNKIYEKFSTTFNEIKDSVDEFKMILESENKY-----QMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFI--EGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNWTPEDFCNLEP 2993
            LDP +R +LR+ADERD +QK+TF  W+N HL+K  + V D++ DLRDG  L++LLEVLS + L  +    RFH L+N+   LDFLR + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +SDD+S K+ LL WS++ ++ Y  I  +NF+TSW+DGK F A+IHK  P LID+  + + +  +NLE AF  A+KELGV ++++PEDV     DEKS++TYV+SL++  P+  D+++       + R  +Y  L   L   +      F+   F   + +   L   +L    T L   ES       LF       +  + +    +H I     W +      E+  +L  E ++++R ++I   + +E      ++ + ES        +L+T  + +N     ++   + ++L   +  I  +   VQ LK DG    A+Q YR +  ++ ++  ++  +         +    +   IS +    +   EL D V          W++E    I    +  DL           GL++  E F       +   DE ++   S+  Y     ++D+ + +  N  K++   L                F++ + + + W+  KE++++++ W +  +  +  K++ +  L+ ELE+RE  +N+  A G  L  + H     ++   A L+++W WIL L  C++THL+    Y QFF +  EAD  + ++ + +  ++           E L ++  +  E + ++K  +  +   ++SV  L  R  +     ++ ++A+C      DF   +    +G+   L NNS    W+V N   +    P+ICFL+  ++ +A ++   L++       LW K    LR     Q L+  + L+++W    F  ++P
Sbjct:   53 LDPAERAILRIADERDRVQKKTFTKWVNKHLIKTQRHVNDLYEDLRDGHNLISLLEVLSGETLPRERGRMRFHKLQNVQIALDFLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMSAKEKLLFWSQRMVDGYHGIRCDNFTTSWRDGKLFNAIIHKHEPRLIDMPKVYRQTNMENLEQAFTVAEKELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRVPDVQDGAKTNELELRWQEYYQLVTVLQQWIRHHVLIFEERRFPSSYEEVEILWRQFLKFKETELPPKESDKGRSKQLFQSFESAVQAGQIKVPPGYHPIDVEKEWGRLHVAILERERLLRIEFERLERLQQIVSKVQMESGVCEEQLNQTES--------LLQTDIRLLNAGKPAQHTVEVERDLDKADGMIRLLFNDVQMLK-DGRHLQAEQMYRRVYRLHERLVNLRSDYNLRLKSTATAATHTTVTSISQKSVQRVRP-EL-DEVTLRYAQDLLAWVEENQRRIDTAEWGIDLPTVESQLGSHRGLHQTIEDFRAKIERAR--ADENQLSPASKGTYREYLGKLDLQYTKLLNTSKSRLRNL-----------DQLYNFVNAATKELMWLNDKEEEEVNYDWSERNA-NMGAKKDNYSGLMRELELREKKVNDIQATGDRLIKDGHPGKKTVEAFTAGLQTQWSWILQLCCCIETHLKENTAYFQFFADVKEADERLKKMQDTMKKKYMCDRSTTATRLEDLLQDAVEEREQVNEFKNDIANLNKRAKSVIQLKPRDPTCPFRGKLPIQAVC------DFKQMEITMHKGDECALINNSQPSRWKVLNRSGDEAVVPSICFLVPPVNKEAVESVSGLEAGHQQTVILWQKLHADLRALLSWQYLMKDIQLIRSWNITMFKTMKP 948          
BLAST of Dystonin vs. Ensembl Zebrafish
Match: pleca (plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984])

HSP 1 Score: 350.903 bits (899), Expect = 2.234e-95
Identity = 260/937 (27.75%), Postives = 460/937 (49.09%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI----YQFR-NQYADLYANLNSALEELNDDFDHNDFR-------------IDFNQTRL------ENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTIST--LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIE---CATLTNKVEE-IESKIRKISY--PMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGV-----------------ISNRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLD----------GLNKIYEKFSTTFNEIKDSVDEFKMILESENKY-----QMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFI--EGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNW 2963
            LDP +R V+R+ADERD +QK+TF  W+N HL+K  + + D++ DLRDG  L++LLEVLS + L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +SDD++ K+ LL WS++ +E Y  +  +NF+TSW+DG+ F A+IHK RP+LID+  + + +  +NLE AF+ A+++LGV ++++PEDV     DEKS++TYV+S++++ P+  D+ + +     + R  +Y +L   L   +      F+   F              + F +T L      +N      K +E          KV  N      +H I     W +      E+  +L +E ++++R ++I   + +E   C    N+VE  +++ IR +S   P+         ++ + I  +L   EN I  +   VQ LK DG    A+Q YR +  ++ ++  ++ +F       L SGV                 +   Q +P       D V    +    +W++E    I    +  DL           GL++  E+F    +  +   DE ++   S+  Y     ++D+ + +     KT+   L                F+  + + + W+  KE++++++ W D  S  ++ K++ +  L+ +LE RE  +N     G  L  + H A   I+   A L+++W WIL L  C++THL+    Y QFF +  EA++ + ++ + +  ++     + +   E L ++  +  E + ++K  +  +   ++++  L  R  +   + ++ V+A+C      DF   +    +G+   L NNS    W+V +S       P+ICF++   + +A   +  LD     L  LW K  + ++     Q L+  + L+ +W
Sbjct:  212 LDPAERAVIRIADERDRVQKKTFTKWVNKHLVKAQRHITDLYEDLRDGHNLISLLEVLSGETLPREKGRMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHKHRPNLIDINKVYRQTNLENLEQAFSIAERDLGVTRLLDPEDVDVPHPDEKSIITYVSSMYDVMPRVPDVRDGVKANELELRWQEYYELVTMLLQWIRHHVIVFEERKFPSSYEEIEVLWRQFLKFKETELPAKETDKNRSKLIYKSFEGAVQAGQ--VKVPPN------YHPIDVEKEWGRLHVAILEREKLLRSEFERLERLQRIVSKVQMESGVCEEQLNQVETLLQTDIRLLSAGKPI---------QHASDIETDLNKAENMIRYLFNDVQLLK-DGRHLQAEQMYRRVYRLHERLVNLRSEFN----LRLKSGVTLSQVPMTQVPMTQISHVQTLQQSPQRVRPDLDEVTLKYIQDLLSWVEENQRRIEGAEWGEDLPSVESQLGSHRGLHQSIEEFKYKIDRAR--ADENQLTPVSKGAYREYLGKLDLQYAKLLTSSKTRLRSL-----------DQLHAFVVAATKELMWLNEKEEEEVNYDWSDRNS-NMTAKKDNYSGLMRDLEQREKRVNNVQMTGDKLLKDGHPARKTIEAFTAALQTQWSWILQLCCCIETHLKENTAYFQFFSDVKEAEDRMKKMEDTMKKKYVCDRSITVTRLEDLLQDAVEEKEQLNEFKTHLEGLNRRAKTIIQLKPRNPAQPIKGKLPVQAVC------DFKQMEITVHKGDECALVNNSQPYKWKVRDSSGNEAVVPSICFIVPPTNKEAVDVSSGLDGSQQRLMVLWQKLHVDMKSLLSWQYLMRDITLINSW 1106          
BLAST of Dystonin vs. Ensembl Xenopus
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:NCBI gene;Acc:100127846])

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 662/2461 (26.90%), Postives = 1218/2461 (49.49%), Query Frame = 3
Query: 12372 LIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKS--------MHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLN---NTSK----NIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINK----LFDRFSEYQK-SHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERN----MEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHP---EKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDK--KKLIE---DLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL--IPIFDRSKRMETNQGISKI----QEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK-----FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------------LPIPTKKPTTAKIPSPRVSQPLSSPRIHQ-------PVSSP---------RIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSR 19454
            LIA + Q S V+  + + +  ++ + ++++   + +    + +K + + +  S +    +   +L +++D+      D+DSL+ Q   +           ++L +LKS +E+   +  +  EK         M ++  L     K+ E   +RQ  L+   + V EF  K  +   +I  A     L  ++    +T K    N   F +++VD L+ +L ++  IG     +         +E + + +   ++ L + V++    +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R+++++ +   G  +          ++ ++L+ L  ++  LL  A+ +  + +  + L+K F +  EP   WL   EK LAN +   T    +++++IQ +K L+ D +  +  + +     NK+ G  +   S   + ++++    L  R+SE Q     +   L     N      D+V +  + L   E  +  + +    P   ++  ++ + L +++ + +   KN+DQ    G+ L + ++  +   I  K++ +   + EI+ S+ K L   E ++ +A +F   +++L         L R  D L+   G+      +   + +   ++K   + R  LD +  V +    L      E ++ +  +  ++++ + + + ++  +I +   +++  E+  D  +  ++  ++K+  +       DQ        +   +D           K+SI+  I+  ++++          L+     + +  E  +     +  +L+ A  L  +F  +Y  L  W+ E +    Q     +D + L + ++E++ L  S  + KP +D ++K G  LS++ N  +G  +      A+K Y  IKE ++ RA  L+D +    + ++K+      LE++  R+     P + P   EK+ E +      + +L+KLQ     L+   E    SR    D D +  +I +KL ++    + ++++  E + K +++L LA +FW D+  +       TI  T+  + DL +  ++    K+ IE    ++ E D   +++  I   G  LI       E P+V+++ +E+   +E ++ +  ++I  +    S   + ++    + +W      +L  + P+ T+   V  QI++ KE K ++  +  ++E +N  G   L K      ++ +   L  +   W  L + +  RQ +L+  LL+LG+F  A+ E + W+  T   L   +   GD   +E+ LA+H +++ D+   Q++V  + +   E+++   SS G +A+    RLE L + WE + +    +  +L+ AL++A  F G+ ++  +    + S+L   K +GGLP+TA+EQL+  M+++             +++   +      + G   E ++ IL +KW  + N  E RK++LE+A+     F   +  FINWLT  E++LN     S I+ T+L Q++ H+    ++  HRE ++ LDK+   LK++SQK D+VLI+NL+ S+  RWEKVV RS ER R+LD   K AK+F +  + L+D +      L+ +  I   P KI+ Q++KHKEF   LG     YD+T R G  L++KA +  D +K+D ++  ++ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S ED+++++ QL EL + W+ V KL+  K+ RLE+A  QA EF    + L E+ S++E  LR     P++   E + ++I  H  F + +   ++ +N     G EIL   +P+   +IKH+I II++++ ++L+W  Q    L+  L  L     LLD+LL W+  AE TL+      +   + + K   +EH+ F+ +MT KQ D D +    K+KT         D+++R  + Q  + +     +P   NP+INQL ++W+QVW + L R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF TTR+EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+     FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G+ +     S+SS+    A+GRTN ELREK   P+G    M PF     + KP++                   T  P++   P+     P    R ++         S+P           P P  +P     +  + V  S +S  T     S   +     P +  S+ GS+A +R  SR
Sbjct: 4457 LIADVPQDSDVSHLVYQAQ--QVQHDFEIVKEDVNECCANMETKLQGIGQFHSHVREMFSELADLDDELDSMGPVGRDIDSLKSQAEVIQKFL-------EALLSLKSSIESSECKCRDMLEKEGGPDLIVLMRELGTLNKQCSKLTERGKNRQGQLVATLRRVEEFNMKLKELNHQIVTAEGSSVLQGVVGTEVDTIKQQLDNFKVFQKEQVDSLQAKLHQVNGIGQGLIQSADKNCDVHGLEHDTEELNIKWNTLNKKVAERVTQLQEALLHCGKFQDALEPLLSWLTDTEDLIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRRTTVEMIQAEGVRIAEGADPADGDKISHQLEILAERWSLLLQKAQSRQKQLEDILVLAKQFHETTEPIFDWLSATEKKLANSEPIGTQTG-KIQQQIQRHKSLEGDITVHETDVHQ----ANKLGGSLAALCSNAEQERLSQKLEFLQARYSEVQDLCSRKGTLLGQALINARLFGEDEVEVL-NWLGDVEDRLNSVCVKDYKPEVLQNQHKQHMALNEDIINRK---KNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYSEITASSGKALKTLEQALQLAGKFQATHDELT------GWLRRAEDELSQSFGQSPSGDMIPQFQQQQKELKKEAMEYRIVLDTINEVGSALLELVPWRAREGLDKLVADANEQYRSISDTIGQRVDQIDAAIQRSQQYEQAADAELAWVAETKRKLLALGSICLEQDQTTAQLQVQKAFSVDIIR-------HKDSIDELISTEEEILATCGDEQKSVLQEKTKNLVQHYEDISHLNSERYARLERAQVLVGQFWETYEELIPWIDEMQVLFSQLPPPAVDHEMLRQQQEEMRQLRESVAEHKPHIDKLLKIGPHLSEL-NPEEGTAVQEKYRSAEKLYVGIKEEVRKRAMVLDDALAQAAQFHDKIGPMLETLESMASRL---RMPPLIPAEVEKIRECISENKNAVMELEKLQPAFQALKHRGEELI-SRSQGPDIDPAAKDIQDKLDQLVFFWEDIKARADERESKFLDVLELAEKFWLDMNTL-----LTTIKDTHEIVHDLESPGIDPSMIKQQIEAADSIKEETDGLHEELEFIRILGADLIFACGE-TEKPEVKKSIDEMNTAWENLKRTWAERIEKLRDAMSHAVQYQDSLQAMFDWLDNTVIKLCDMPPVGTDISTVKEQIEEMKEFKVEVYQQQIEMEKLNHQGELMLKKAIDDTDRDIIQGPLTELKHLWENLGEKIAHRQQKLEDSLLALGQFQHALAELMSWLTHTNELLNAQRPICGDPKVIEVELAKHHVLKNDVLAHQSTVQIVNKAGNELLE---SSAGDDASSLRTRLETLNQLWEIVLQKTEEREQQLDMALQQAQGFSGEIEDFIQWQTNIESQLSAAKPTGGLPETAREQLQAHMELFAEIKANEDLYRHLLDKGQLMLISRDDATGSITEQNVSILKRKWQAISNKVEERKAKLEEALTLATDFQNSLQDFINWLTQAEQSLNIAPSPSLILDTVLFQIDEHKVFVNEVNIHREHIIELDKIGNQLKFLSQKQDVVLIKNLLLSVQSRWEKVVQRSVERGRSLDDARKRAKQFHEAWKKLIDWLEEAENHLDSELEISNDPDKIKLQLSKHKEFQKTLGSKQPVYDTTVRTGRALKEKALLSGDVQKLDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE-DQPLHGDLDLVMNLMDAHKVFQKELGKRTSSVQALKRSARELLESSREDTTWVKVQLQELSTRWDTVCKLSVSKQTRLEQALKQAEEFHAAVHMLLEWLSEAEQTLRFRGALPDD--AESLQSLIDIHKEFMRKVEEKQIDVNTAVSMGEEILTMCHPDCITTIKHWITIIRARFEEVLTWGNQHQQRLQTALSELLANSELLDELLSWIQWAETTLIQRGQDPMPQNIDQVKALISEHQVFMEEMTQKQPDVDRVTKTYKRKTTDTNHASFNDKTRRKHSVQNATPVLPVLSQPETKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTTRLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRVVFLQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHPGN-KLKRTDSISSI----ARGRTNLELREKFILPEGVSQGMTPFRSRGRRSKPSSRTASPTRSSSSASQSNHSCTSVPSSPATPASGSKTPQHLSRCYEKPWLVNSKASTPIRCAEYPDFHTPSPEVTPAQGSKLKKAAVHTSRSS-LTGDTPTSSSAKSGRADPKKSASRAGSRAGSRASSR 6853          

HSP 2 Score: 227.254 bits (578), Expect = 8.460e-58
Identity = 121/279 (43.37%), Postives = 169/279 (60.57%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAIS--------------------------------RFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            LDP +R V+RVADERD +QK+TF  W+N HL+K+ K + D++ DLRDG  L++LLEVLS  +L  +   S                                RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  S +S D+S K+ LL W++K    Y  I   NFS+ W DGK F A+IH+ RPDL+D++ +     ++NLE AF  A+  LGV ++++ EDV     DEKS++TYV+S+++  PK  +  E I
Sbjct:   56 LDPAERAVVRVADERDRVQKKTFTKWVNKHLIKVRKHINDLYEDLRDGHNLISLLEVLSGIRLDPEAPRSLRLSRLPSRRLLLMREDLEEDPDDAPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYVSGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNAIIHRYRPDLVDMQKVELQGNRENLEQAFEIAES-LGVTRLLDSEDVDVASPDEKSVITYVSSIYDAFPKVPEGAEGI 333          

HSP 3 Score: 98.9821 bits (245), Expect = 4.326e-19
Identity = 82/368 (22.28%), Postives = 169/368 (45.92%), Query Frame = 3
Query: 1932 IKDSVDEFKMILESENKYQMDMD------FHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKE-------TVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEG--ELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLS------TMDLVKNWTPE 2972
            +  SV+E    L     Y++ M       + ++ + L+T++ +L    S    + +S  +F+ ++   I W+  KE++++ + W D     ++ K+E F  L+ ELE ++  I         L++ NH A   ++   A + S+WQW+  L  C++ HL+    Y QFF +  E++  +  L + +  ++        D    +NR + D+L+   D KE       +V  ++  S+++  L  R   +     + +KA+C      D+   +   G  E   L +N+    W+V ++       P++CFLI   + +A + A  ++  +  +  LW   +L +  + L+S       +++V++W  E
Sbjct:  647 VHTSVEELTSSLREARSYEVKMSHNFRSSYSETLSKLETQYCKLRETSSSRLHNLQSLHDFVSQATAQIIWLNQKEEEELAYDWSDGNP-NIAAKKEYFTELMQELEEKQDVIQALQETAELLSLENHPAKQTVEAYSAAVVSQWQWVKQLCLCVEQHLKENTAYFQFFNDVRESEVYLNNLQDSIKRKY------SCDRTTSINR-LEDILQDSMDEKEQLIQSRSSVASLVGRSKNIVQLKPRNPELTLANTLPIKAVC------DYRQIEITIGRNEECVLEDNTQRTKWKVISTTGNEAMVPSVCFLIPPPNQEAMEMASRVEQLYQKVMSLW--HQLHINTKSLISWNYLRKDVEVVQSWNAE 998          

HSP 4 Score: 75.8702 bits (185), Expect = 3.707e-12
Identity = 217/1086 (19.98%), Postives = 446/1086 (41.07%), Query Frame = 3
Query: 14382 RFKEVLNEVTKKATKIGSN---RTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKS-AVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILAN-IEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKIS----SSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFH--EMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQ---IQKTKE----LKNDIEP---KHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRAD-MNISQASVSKMERKAAEIIKE-----DVSSLGHEATQRLEQLRKSWEELKEHARAKHFEL----------EDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQ--LKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRF-EDMNRTL--LDDIASNL-EILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDS-SKRCGGDM 17507
            ++KEVL  +T K  + G N   +     Q + + Q ++  S    ++ +++ ++ +             N LSA       +   + D  +         LK ++  AVDRV +               L  A+  +++F   ++ L+ WL E +    ++   +   ++L    QE +    S        ++I+  G  L       + K  L N + + K  +N + +    R   L+D +    +    V+     LE+    + +  + ++ P +L+ +L     +  D+DK +  ++ +     + +     A + DD  +ILE+ AKI+    +  + L +++  ++E  + L  L + F N  K +E   H  E+   L        N  S+  ++ ++  L  +I ++ K++       + LI  V   ++   +    ++++ +FE V+    +   N++ +   I +      ++     ++++ L  +GP+  +   + +Q   IQK  E    LK+ IE    K RD+         L K   P++   +   L  +N   ++L +    RQ QL   L  + EF+  + E    I+  E S     +   ++++++  L   K+ + + ++  QA + ++      +I+      DV  L H+     E+L   W  L +    +  +L          +DAL+  L +  D +++  N     ++ ++ K         +EQ  L+R +D  RT  ++         E   I++ +  + G  I   +EIL ++W  +   A++R+ +LE  +   + FH       +WL+ TEK L    P+      I +Q++ H++L+ DIT H  ++   +K+   L  +    +   +   +  +  R+ +V    S +   L      A+ F ED    L  L D+   L  +  +D      P  ++ Q  +H   + ++       D   + G  L  +   ++   I E +  ++ ++  +   S +  K L  AL L+G ++     L  WLR  E +LS S  +   GDM
Sbjct: 4068 QYKEVLQRLTDKIKQAGKNLAAQPAVSTQPDAVKQQLQETSGIRSELEQLAKEVTDAQK--------LCNELSAL-----VMEPYLKDELQKRLDTVALPLKGMEDLAVDRVNR---------------LQTALSSSQQFQQMFDELRSWLDEKQLQHVKSHPVSAKLEKLQIQLQEQEEFQKSLSQYSGSYEMIVAEGESLLMSAQPGEEKTTLQNQLVNLKSNWNELGKQSSERHGKLKDCLQKAQKYVRHVEDMVPWLEDCEIHMKE-MEITLDPVQLEAQLLRAKALQTDIDKKRSLLEMMN----SAADLLIEAAEIDDR-DILEERAKINQRIDAITEELHNKSGSFEEMSLRLKELKDSFSNIDKKMEGAKHLLEIFTALGPQACSSKNLESMRSQQDMLLGLDSQI-LYLKNL------IQGLIADVPQDSDVSHLVYQAQQVQHDFEIVKEDVNECCANMETKLQGIGQFHSHVREMFSELADLDDELDSMGPVGRDIDSLKSQAEVIQKFLEALLSLKSSIESSECKCRDM---------LEKEGGPDLIVLMRE-LGTLNKQCSKLTERGKNRQGQLVATLRRVEEFNMKLKELNHQIVTAEGSSVLQGVVGTEVDTIKQQLDNFKVFQKEQVDSLQAKLHQVNGIGQGLIQSADKNCDVHGLEHDT----EELNIKWNTLNKKVAERVTQLQEALLHCGKFQDALEPLLSWLTDTEDLIANQKPPSAEYKVVKAQ------IQEQKLLQRLLDDRRTTVEM------IQAEGVRIAEGADPADGDKISHQLEILAERWSLLLQKAQSRQKQLEDILVLAKQFHETTEPIFDWLSATEKKLANSEPIGTQTGKIQQQIQRHKSLEGDITVHETDVHQANKLGGSLAALCSNAEQERLSQKLEFLQARYSEVQDLCSRKGTLLGQALINARLFGEDEVEVLNWLGDVEDRLNSVCVKDYK----PEVLQNQHKQHMALNEDIINRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYSEITASSGKALKTLEQALQLAGKFQATHDELTGWLRRAEDELSQSFGQSPSGDM 5082          
BLAST of Dystonin vs. Ensembl Xenopus
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:NCBI gene;Acc:100127846])

HSP 1 Score: 802.357 bits (2071), Expect = 0.000e+0
Identity = 653/2433 (26.84%), Postives = 1208/2433 (49.65%), Query Frame = 3
Query: 12372 LIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKS--------MHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLN---NTSK----NIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINK----LFDRFSEYQK-SHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERN----MEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHP---EKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDK--KKLIE---DLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL--IPIFDRSKRMETNQGISKI----QEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK-----FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------LPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            LIA + Q S V+  + + +  ++ + ++++   + +    + +K + + +  S +    +   +L +++D+      D+DSL+ Q   +           ++L +LKS +E+   +  +  EK         M ++  L     K+ E   +RQ  L+   + V EF  K  +   +I  A     L  ++    +T K    N   F +++VD L+ +L ++  IG     +         +E + + +   ++ L + V++    +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R+++++ +   G  +          ++ ++L+ L  ++  LL  A+ +  + +  + L+K F +  EP   WL   EK LAN +   T    +++++IQ +K L+ D +  +  + +     NK+ G  +   S   + ++++    L  R+SE Q     +   L     N      D+V +  + L   E  +  + +    P   ++  ++ + L +++ + +   KN+DQ    G+ L + ++  +   I  K++ +   + EI+ S+ K L   E ++ +A +F   +++L         L R  D L+   G+      +   + +   ++K   + R  LD +  V +    L      E ++ +  +  ++++ + + + ++  +I +   +++  E+  D  +  ++  ++K+  +       DQ        +   +D           K+SI+  I+  ++++          L+     + +  E  +     +  +L+ A  L  +F  +Y  L  W+ E +    Q     +D + L + ++E++ L  S  + KP +D ++K G  LS++ N  +G  +      A+K Y  IKE ++ RA  L+D +    + ++K+      LE++  R+     P + P   EK+ E +      + +L+KLQ     L+   E    SR    D D +  +I +KL ++    + ++++  E + K +++L LA +FW D+  +       TI  T+  + DL +  ++    K+ IE    ++ E D   +++  I   G  LI       E P+V+++ +E+   +E ++ +  ++I  +    S   + ++    + +W      +L  + P+ T+   V  QI++ KE K ++  +  ++E +N  G   L K      ++ +   L  +   W  L + +  RQ +L+  LL+LG+F  A+ E + W+  T   L   +   GD   +E+ LA+H +++ D+   Q++V  + +   E+++   SS G +A+    RLE L + WE + +    +  +L+ AL++A  F G+ ++  +    + S+L   K +GGLP+TA+EQL+  M+++             +++   +      + G   E ++ IL +KW  + N  E RK++LE+A+     F   +  FINWLT  E++LN     S I+ T+L Q++ H+    ++  HRE ++ LDK+   LK++SQK D+VLI+NL+ S+  RWEKVV RS ER R+LD   K AK+F +  + L+D +      L+ +  I   P KI+ Q++KHKEF   LG     YD+T R G  L++KA +  D +K+D ++  ++ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S ED+++++ QL EL + W+ V KL+  K+ RLE+A  QA EF    + L E+ S++E  LR     P++   E + ++I  H  F + +   ++ +N     G EIL   +P+   +IKH+I II++++ ++L+W  Q    L+  L  L     LLD+LL W+  AE TL+      +   + + K   +EH+ F+ +MT KQ D D +    K+KT         D+++R  + Q  + +     +P   NP+INQL ++W+QVW + L R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF TTR+EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+     FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    M PF     + KP++                 +   +PS   + P S  ++ Q     +     +   ++ + P+S  ++S      PK  AS   +  SR  +R +S++GS AS
Sbjct: 4763 LIADVPQDSDVSHLVYQAQ--QVQHDFEIVKEDVNECCANMETKLQGIGQFHSHVREMFSELADLDDELDSMGPVGRDIDSLKSQAEVIQKFL-------EALLSLKSSIESSECKCRDMLEKEGGPDLIVLMRELGTLNKQCSKLTERGKNRQGQLVATLRRVEEFNMKLKELNHQIVTAEGSSVLQGVVGTEVDTIKQQLDNFKVFQKEQVDSLQAKLHQVNGIGQGLIQSADKNCDVHGLEHDTEELNIKWNTLNKKVAERVTQLQEALLHCGKFQDALEPLLSWLTDTEDLIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRRTTVEMIQAEGVRIAEGADPADGDKISHQLEILAERWSLLLQKAQSRQKQLEDILVLAKQFHETTEPIFDWLSATEKKLANSEPIGTQTG-KIQQQIQRHKSLEGDITVHETDVHQ----ANKLGGSLAALCSNAEQERLSQKLEFLQARYSEVQDLCSRKGTLLGQALINARLFGEDEVEVL-NWLGDVEDRLNSVCVKDYKPEVLQNQHKQHMALNEDIINRK---KNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYSEITASSGKALKTLEQALQLAGKFQATHDELT------GWLRRAEDELSQSFGQSPSGDMIPQFQQQQKELKKEAMEYRIVLDTINEVGSALLELVPWRAREGLDKLVADANEQYRSISDTIGQRVDQIDAAIQRSQQYEQAADAELAWVAETKRKLLALGSICLEQDQTTAQLQVQKAFSVDIIR-------HKDSIDELISTEEEILATCGDEQKSVLQEKTKNLVQHYEDISHLNSERYARLERAQVLVGQFWETYEELIPWIDEMQVLFSQLPPPAVDHEMLRQQQEEMRQLRESVAEHKPHIDKLLKIGPHLSEL-NPEEGTAVQEKYRSAEKLYVGIKEEVRKRAMVLDDALAQAAQFHDKIGPMLETLESMASRL---RMPPLIPAEVEKIRECISENKNAVMELEKLQPAFQALKHRGEELI-SRSQGPDIDPAAKDIQDKLDQLVFFWEDIKARADERESKFLDVLELAEKFWLDMNTL-----LTTIKDTHEIVHDLESPGIDPSMIKQQIEAADSIKEETDGLHEELEFIRILGADLIFACGE-TEKPEVKKSIDEMNTAWENLKRTWAERIEKLRDAMSHAVQYQDSLQAMFDWLDNTVIKLCDMPPVGTDISTVKEQIEEMKEFKVEVYQQQIEMEKLNHQGELMLKKAIDDTDRDIIQGPLTELKHLWENLGEKIAHRQQKLEDSLLALGQFQHALAELMSWLTHTNELLNAQRPICGDPKVIEVELAKHHVLKNDVLAHQSTVQIVNKAGNELLE---SSAGDDASSLRTRLETLNQLWEIVLQKTEEREQQLDMALQQAQGFSGEIEDFIQWQTNIESQLSAAKPTGGLPETAREQLQAHMELFAEIKANEDLYRHLLDKGQLMLISRDDATGSITEQNVSILKRKWQAISNKVEERKAKLEEALTLATDFQNSLQDFINWLTQAEQSLNIAPSPSLILDTVLFQIDEHKVFVNEVNIHREHIIELDKIGNQLKFLSQKQDVVLIKNLLLSVQSRWEKVVQRSVERGRSLDDARKRAKQFHEAWKKLIDWLEEAENHLDSELEISNDPDKIKLQLSKHKEFQKTLGSKQPVYDTTVRTGRALKEKALLSGDVQKLDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE-DQPLHGDLDLVMNLMDAHKVFQKELGKRTSSVQALKRSARELLESSREDTTWVKVQLQELSTRWDTVCKLSVSKQTRLEQALKQAEEFHAAVHMLLEWLSEAEQTLRFRGALPDD--AESLQSLIDIHKEFMRKVEEKQIDVNTAVSMGEEILTMCHPDCITTIKHWITIIRARFEEVLTWGNQHQQRLQTALSELLANSELLDELLSWIQWAETTLIQRGQDPMPQNIDQVKALISEHQVFMEEMTQKQPDVDRVTKTYKRKTTDTNHASFNDKTRRKHSVQNATPVLPVLSQPETKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTTRLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRVVFLQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNLELREKFILPEGVSQGMTPFRSRGRRSKPSSRTASPTRSSSSASQSNHSCTSVPSSPAT-PASGSKVTQGSKLKKAAVHTSRSSLTGDTPTSSSAKS--GRADPKKSAS---RAGSRAGSRASSRRGSDAS 7109          

HSP 2 Score: 224.942 bits (572), Expect = 4.137e-57
Identity = 112/235 (47.66%), Postives = 158/235 (67.23%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            DERD +QK+TF  W+N HL+K+ K + D++ DLRDG  L++LLEVLS  +L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  S +S D+S K+ LL W++K    Y  I   NFS+ W DGK F A+IH+ RPDL+D++ +     ++NLE AF  A+  LGV ++++ EDV     DEKS++TYV+S+++  PK  +  E I
Sbjct:   22 DERDRVQKKTFTKWVNKHLIKVRKHINDLYEDLRDGHNLISLLEVLSGIRLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYVSGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNAIIHRYRPDLVDMQKVELQGNRENLEQAFEIAES-LGVTRLLDSEDVDVASPDEKSVITYVSSIYDAFPKVPEGAEGI 255          

HSP 3 Score: 98.9821 bits (245), Expect = 4.483e-19
Identity = 82/368 (22.28%), Postives = 169/368 (45.92%), Query Frame = 3
Query: 1932 IKDSVDEFKMILESENKYQMDMD------FHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKE-------TVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEG--ELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLS------TMDLVKNWTPE 2972
            +  SV+E    L     Y++ M       + ++ + L+T++ +L    S    + +S  +F+ ++   I W+  KE++++ + W D     ++ K+E F  L+ ELE ++  I         L++ NH A   ++   A + S+WQW+  L  C++ HL+    Y QFF +  E++  +  L + +  ++        D    +NR + D+L+   D KE       +V  ++  S+++  L  R   +     + +KA+C      D+   +   G  E   L +N+    W+V ++       P++CFLI   + +A + A  ++  +  +  LW   +L +  + L+S       +++V++W  E
Sbjct:  569 VHTSVEELTSSLREARSYEVKMSHNFRSSYSETLSKLETQYCKLRETSSSRLHNLQSLHDFVSQATAQIIWLNQKEEEELAYDWSDGNP-NIAAKKEYFTELMQELEEKQDVIQALQETAELLSLENHPAKQTVEAYSAAVVSQWQWVKQLCLCVEQHLKENTAYFQFFNDVRESEVYLNNLQDSIKRKY------SCDRTTSINR-LEDILQDSMDEKEQLIQSRSSVASLVGRSKNIVQLKPRNPELTLANTLPIKAVC------DYRQIEITIGRNEECVLEDNTQRTKWKVISTTGNEAMVPSVCFLIPPPNQEAMEMASRVEQLYQKVMSLW--HQLHINTKSLISWNYLRKDVEVVQSWNAE 920          
BLAST of Dystonin vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 794.653 bits (2051), Expect = 0.000e+0
Identity = 529/1591 (33.25%), Postives = 875/1591 (55.00%), Query Frame = 3
Query: 14754 QLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDS-KKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL-----IPIFDRS----KRMETNQGI-SKIQEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKY-------KFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVS------SPRIPQPVTSPRISQNIPSSRVSQSLASPRTP-----KVVASPGLQRKSRIP 19400
            QL+ A+ L  +F  +Y  L  WL+ETE  + Q  +  LD D L + +++I+ L     + KP +D + K+G  L  +    +G  I      A   Y+ IKE +K RA  L++ I  + + ++K+D     L+ I +R+      S   EK+ E+L     +  +L+KLQ   + L+   E    +R    DKD S ++++ KL ++    + +Q+ T E + +++++L LA +FW D   +   F +     T   I +L+   V+     ++++  E ++ EID  + ++  +   G +LI     P++ P V +  +EL   ++ +  + ++++  +D       + ++    L +W      ++  + P+ T+   V  QI + K+ K D   +  ++E +N Q    L K +  N K  V   L+ +   W  L D +  RQH+L+  LL+LG F  A+DE   W+  TE  L   K   GD  ++E+ LA+H +++ D+   +++V  +++   ++I+   SS G EA+    RLE L + W+ + +    +   L+ AL +A  F+ + +++ + + ++  +L   K  GGLP+TA+EQL   +++   F       ++ +++S ++ ++ +      I+ D+  L +KW++V      RK++LE+A+E    FH  +  FINWLT  E+ L    P S I+ T+L Q++ H+    ++ SHR++++ LDK  THLKY SQK D+V+I+NL+ S+  RWE VV RS ER R LD   K +K+F +    L++ +  +   L+ +  I   P KI+ Q+TKHKEF   LG  +  YD+T R G  L++KA + D  +K+D+++  ++ KW ++C KSIER+  L +ALL+SG + DA+  L+ WL  IEP+L++  +   GD++ V  L++ H + +K+L  R   I+ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLEEA +QA  F    ++L E+ + +E  LR   I P++  E+ +  +I  H  F + +     ++N     G  IL   +P++  +IKH+I II++++ ++L+W++Q    L   LD L  +K LL+ LL WL  +E TL   +  ++   L E K    EH+ F+ +MT KQ D D++    K+K         IP+ D+     KR  T     S  Q  L   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFI+GI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q G+ KY       KFGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++  L+ AKGRTN ELREK   P+G   +M PF+      P   +   +++  SP  S   SSP I    S      +P+ P  +T       + +S+ S    SP +P      +  +P    K R+P
Sbjct: 4729 QLERAVSLVNQFWETYEELWPWLIETENAISQLPVPALDYDTLKQQQEDIRQLRELIAEHKPHIDKMNKTGPQLLDLSPE-EGFFIQEKYVSADTLYSEIKEVVKKRAIYLDEAISQSAQFHDKIDPTLENLQRIAERLRQPPSISAECEKIKEQLSENKNVSVELEKLQPVYETLKKRGEEMI-ARSEGADKDISAKVVQDKLDQMVFVWEDIQALTEEREAQLLDVLELAEKFWCDHYALIATFKD-----TQDLIRELDGPGVDPSVVKEQQETAEVIKEEIDGFQDELDAVISLGSELISACGEPDK-PVVNKNIDELTSAWDTLNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDPLSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIE---SSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQMMERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFINWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDKTGTHLKYFSQKQDVVIIKNLLISVQSRWENVVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTDDIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAE-DQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILPDD--EDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPVLDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTQPLI-AKGRTNVELREKFMLPEGASQSMTPFR------PKGRRSRPSSRGASPNRSN--SSPNIQASPSLAASSITPKTPLHLTRNYGKPWLANSKTSTPCKSPESPDYQLSSLETTPIQGSKLRLP 6286          

HSP 2 Score: 241.506 bits (615), Expect = 3.733e-62
Identity = 131/280 (46.79%), Postives = 175/280 (62.50%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKL--------------------FTQN-------------AISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            LDP +R VLR+ADERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L                    + Q+                RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL WS++  E Y  I  ENF+T W+DG+ F A+IHK RPDLIDL +++  S   NLE AF  A+K LGV ++++PEDV     DEKS++TYVAS+++  PK  D  E I
Sbjct:  194 LDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVSDLYEDLRDGHNLISLLEVLSGDTLPRERDFLKTLRLVSSSEACEYDQHEDVEDEDKGPREKGRMRFHRLQNVQIALDYLKKRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKEKLLLWSQQTSEGYGGIRCENFTTCWRDGRLFNAIIHKYRPDLIDLDTVAVQSNITNLENAFYVAEK-LGVTRLLDPEDVDVSSPDEKSVITYVASMYDAFPKTPDGGEGI 472          

HSP 3 Score: 101.293 bits (251), Expect = 7.306e-20
Identity = 89/460 (19.35%), Postives = 208/460 (45.22%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDL---DGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSN 3182
            +WI+E    +    + +DL   +G  + ++ F     E + S+ E KM  E +       ++ +S   L++++++L  +         +   F+ ++   + W+  KE++++ + W +     +  K++   +L+ EL+ +E  I     +   + + NH A + I+   A ++++W WIL L HC++ H+   + Y ++F +A +A   +  L + +  ++       L + E L +E  +  E +  YK TV  ++  ++++  L  R      +  + ++AIC  K+        + + E + L +NS    W+V +        P++CF +   + +A  +A  ++  +  +  LW +  + ++  V    L++ ++ ++         L P   Q+++  L    +  + D + + I   ++I +    +N C   + EL  S+    Q  ++ N
Sbjct:  821 SWIEEMQVQLDRAEWGSDLSSIEGHLENHKNFDRAVEEFESSLKEAKMS-EPQITGIFKANYDESLYKLESQYSKLLNSSRNRQKHLDTLHSFVSRATRELIWLNEKEEEEVAYDWSERNQ-NIPAKRDYHGDLMRELDHKEEIIKSVQDIAEQMLLQNHPARSTIEAYRAAMQTQWNWILQLCHCVEQHIRQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEEKEQLLQYKSTVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQ---IEITIYKDDECI-LASNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDSANRIEQMYQSVLTLWHESHINMKSTVSWHYLMNEIEGIRASKVSTIKTLLPGEHQQVLSNLKSRFDEFLEDSQESKIFSMSDIAQLEREVNVCKLYYEELLKSAEREEQEESIYN 1274          

HSP 4 Score: 91.2781 bits (225), Expect = 7.814e-17
Identity = 200/1025 (19.51%), Postives = 452/1025 (44.10%), Query Frame = 3
Query: 10767 VPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMS--PTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESEN----------LSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMI------GKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQI-----LQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDI----NNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKH-YPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQ---------------PIDVS-KLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNA------TLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE--QKIETAEKSMHKID---NLAAINEKIIESIDDRQNSLILQHKIVTEFE------SKKNDFIRKIDEANNDPELAKL----LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESI 13646
             P   + K  LD+++  +  +   A +       + + + +F   +  ++  +  KE M +VLGP+    +    Q QQV  L+ E +  +   ++ R+ GQ I+      P+S EV  ++E L  ++ K ++L   L DR   I   +  S ++   +  +S++L+ +   +    TN++ S   + +  +L + K + K+  N          L + L   ++++    E+  ++  + +   +++ K  + V+ +       ++ HH        ED + W+Q K ++ N    E   I   L  NI +  I     +Q  +K + S  E +  E   + ++     K+  +  +L++L +  E I+  +    NNL    Q+A+     + N    I+ WI+  +HK+++    V L +I+S +  ++   K+++ +   +  L +                        ES L   + + +   E  K +  Q+    +N++  +  L K  T+ +E+ +  +  +KQ               P   S K  + ++T Q  +  ++P ++    ++ S+AQ   V+A      T L  + E +  ++ ++   + +K  +L +K + +   ++ I    ++   L +++D+      DL+ L+ Q  D++          K LS+L +  EN  +  +K+   E S   I    +L A+N++  + +D  ++       I++  E       +  D ++ ++E         +    +N+      AF +++++PL+ +++E+  +G     +       + +E +++ V   ++ L   V+     +   L+   +F  +LE+L  ++ +    + +++ PS E+   K+QL   +LL   L  R+ +++ + + G  +  +  +  K ++  +L  L  +++ LL  AE +N + D  + +++ F D  EP   WL + EK LA  +   T  A ++ ++I + K L++D ++ ++S+
Sbjct: 3388 APESSKWKEMLDKIDSLWQDINKMAAERQQTLEESSNDLNQFQTAEAQLKQWLTEKELMASVLGPLSIDPNMLKTQKQQVQILLKEFDARKQQYEQFRSAGQRILNRPCELPSSGEV--VKEQLASVACKWESLTGQLNDRCDRIEQAIVKSTNYQNNLKGLSEKLSAMSNTL---STNMVVSSHPDAVNQKLQTAKQLQKDLSNEKKNIEDTKVLCQELSNLVAEDYLKAELNRQMDTVVKPFVDLEEKAGYHVEQLQMAFASSQKFHHLS------EDLKSWIQTKTKEQN----EAAPISANL--NILESLITEQAEVQNALKDQLSTYEKVTAEAENLLQKTKGDEKAN-LQSQLSMLKSNWEAINKQVLERQNNLLDCQQKATKHKEFVEN----IQPWIEECQHKLSEFTVSVDLSAIESSVGQVKVLQKNVDKQRGMMETLNS----------------------ATESLLNCCQTDKEAIREQNKNMNSQVDELIDNLHIKRDTLEKFGTRLKEFQESVKDTEKQLAVAQEHLDAHNSLGPQGCSNKHLTIMQTQQKVLQNLEPQID----IVRSLAQQLVVDAFDAEGVTELVLQAESLHQKHHIIHQEVEEKCSFLETKLQGIGHFQNSIREMFSQFTELDDELDSMTPVGRDLNILQCQKQDISKFL-------KKLSDLITTNENANKTCKKMLATESSPDLIGIKRDLEALNKQCNKLLDRAKSREEQTENIISRTEDFYCTLKQFFDLLKGVEEHEESQGAVGMETDVINHQLNIFMAFQKEEIEPLQARIQEVNQLGQGLVQSAAKNTSTESLEHDLEEVNVRWNTLNNKVAQRAAQLQEALLHSGRFQDALESLLSWLTDTEDLVASQKPPSAEFKVVKAQLQEQKLLQRLLSDRKPTVEAIKREGEKIASSADQTDKEKILKQLSTLERRWDELLKKAEIRNRQLDDILVVAEQFHDSLEPLSEWLTSTEKKLAISEPIGTQTA-KLLQQISQQKALEDDITAHNKSL 4356          
BLAST of Dystonin vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 529/1591 (33.25%), Postives = 875/1591 (55.00%), Query Frame = 3
Query: 14754 QLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDS-KKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL-----IPIFDRS----KRMETNQGI-SKIQEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKY-------KFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVS------SPRIPQPVTSPRISQNIPSSRVSQSLASPRTP-----KVVASPGLQRKSRIP 19400
            QL+ A+ L  +F  +Y  L  WL+ETE  + Q  +  LD D L + +++I+ L     + KP +D + K+G  L  +    +G  I      A   Y+ IKE +K RA  L++ I  + + ++K+D     L+ I +R+      S   EK+ E+L     +  +L+KLQ   + L+   E    +R    DKD S ++++ KL ++    + +Q+ T E + +++++L LA +FW D   +   F +     T   I +L+   V+     ++++  E ++ EID  + ++  +   G +LI     P++ P V +  +EL   ++ +  + ++++  +D       + ++    L +W      ++  + P+ T+   V  QI + K+ K D   +  ++E +N Q    L K +  N K  V   L+ +   W  L D +  RQH+L+  LL+LG F  A+DE   W+  TE  L   K   GD  ++E+ LA+H +++ D+   +++V  +++   ++I+   SS G EA+    RLE L + W+ + +    +   L+ AL +A  F+ + +++ + + ++  +L   K  GGLP+TA+EQL   +++   F       ++ +++S ++ ++ +      I+ D+  L +KW++V      RK++LE+A+E    FH  +  FINWLT  E+ L    P S I+ T+L Q++ H+    ++ SHR++++ LDK  THLKY SQK D+V+I+NL+ S+  RWE VV RS ER R LD   K +K+F +    L++ +  +   L+ +  I   P KI+ Q+TKHKEF   LG  +  YD+T R G  L++KA + D  +K+D+++  ++ KW ++C KSIER+  L +ALL+SG + DA+  L+ WL  IEP+L++  +   GD++ V  L++ H + +K+L  R   I+ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLEEA +QA  F    ++L E+ + +E  LR   I P++  E+ +  +I  H  F + +     ++N     G  IL   +P++  +IKH+I II++++ ++L+W++Q    L   LD L  +K LL+ LL WL  +E TL   +  ++   L E K    EH+ F+ +MT KQ D D++    K+K         IP+ D+     KR  T     S  Q  L   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFI+GI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q G+ KY       KFGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++  L+ AKGRTN ELREK   P+G   +M PF+      P   +   +++  SP  S   SSP I    S      +P+ P  +T       + +S+ S    SP +P      +  +P    K R+P
Sbjct: 4528 QLERAVSLVNQFWETYEELWPWLIETENAISQLPVPALDYDTLKQQQEDIRQLRELIAEHKPHIDKMNKTGPQLLDLSPE-EGFFIQEKYVSADTLYSEIKEVVKKRAIYLDEAISQSAQFHDKIDPTLENLQRIAERLRQPPSISAECEKIKEQLSENKNVSVELEKLQPVYETLKKRGEEMI-ARSEGADKDISAKVVQDKLDQMVFVWEDIQALTEEREAQLLDVLELAEKFWCDHYALIATFKD-----TQDLIRELDGPGVDPSVVKEQQETAEVIKEEIDGFQDELDAVISLGSELISACGEPDK-PVVNKNIDELTSAWDTLNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDPLSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIE---SSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQMMERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFINWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDKTGTHLKYFSQKQDVVIIKNLLISVQSRWENVVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTDDIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAE-DQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILPDD--EDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPVLDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTQPLI-AKGRTNVELREKFMLPEGASQSMTPFR------PKGRRSRPSSRGASPNRSN--SSPNIQASPSLAASSITPKTPLHLTRNYGKPWLANSKTSTPCKSPESPDYQLSSLETTPIQGSKLRLP 6085          

HSP 2 Score: 124.02 bits (310), Expect = 9.694e-27
Identity = 66/136 (48.53%), Postives = 91/136 (66.91%), Query Frame = 3
Query:  705 WIIILF-FQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            +I  LF FQ  DI  + +S+D+S K+ LL WS++  E Y  I  ENF+T W+DG+ F A+IHK RPDLIDL +++  S   NLE AF  A+K LGV ++++PEDV     DEKS++TYVAS+++  PK  D  E I
Sbjct:  137 YICFLFNFQISDIHVTGESEDMSAKEKLLLWSQQTSEGYGGIRCENFTTCWRDGRLFNAIIHKYRPDLIDLDTVAVQSNITNLENAFYVAEK-LGVTRLLDPEDVDVSSPDEKSVITYVASMYDAFPKTPDGGEGI 271          

HSP 3 Score: 101.293 bits (251), Expect = 7.663e-20
Identity = 89/460 (19.35%), Postives = 208/460 (45.22%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDL---DGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSN 3182
            +WI+E    +    + +DL   +G  + ++ F     E + S+ E KM  E +       ++ +S   L++++++L  +         +   F+ ++   + W+  KE++++ + W +     +  K++   +L+ EL+ +E  I     +   + + NH A + I+   A ++++W WIL L HC++ H+   + Y ++F +A +A   +  L + +  ++       L + E L +E  +  E +  YK TV  ++  ++++  L  R      +  + ++AIC  K+        + + E + L +NS    W+V +        P++CF +   + +A  +A  ++  +  +  LW +  + ++  V    L++ ++ ++         L P   Q+++  L    +  + D + + I   ++I +    +N C   + EL  S+    Q  ++ N
Sbjct:  620 SWIEEMQVQLDRAEWGSDLSSIEGHLENHKNFDRAVEEFESSLKEAKMS-EPQITGIFKANYDESLYKLESQYSKLLNSSRNRQKHLDTLHSFVSRATRELIWLNEKEEEEVAYDWSERNQ-NIPAKRDYHGDLMRELDHKEEIIKSVQDIAEQMLLQNHPARSTIEAYRAAMQTQWNWILQLCHCVEQHIRQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEEKEQLLQYKSTVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQ---IEITIYKDDECI-LASNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDSANRIEQMYQSVLTLWHESHINMKSTVSWHYLMNEIEGIRASKVSTIKTLLPGEHQQVLSNLKSRFDEFLEDSQESKIFSMSDIAQLEREVNVCKLYYEELLKSAEREEQEESIYN 1073          

HSP 4 Score: 91.2781 bits (225), Expect = 8.477e-17
Identity = 200/1025 (19.51%), Postives = 452/1025 (44.10%), Query Frame = 3
Query: 10767 VPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMS--PTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESEN----------LSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMI------GKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQI-----LQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDI----NNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKH-YPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQ---------------PIDVS-KLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNA------TLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE--QKIETAEKSMHKID---NLAAINEKIIESIDDRQNSLILQHKIVTEFE------SKKNDFIRKIDEANNDPELAKL----LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESI 13646
             P   + K  LD+++  +  +   A +       + + + +F   +  ++  +  KE M +VLGP+    +    Q QQV  L+ E +  +   ++ R+ GQ I+      P+S EV  ++E L  ++ K ++L   L DR   I   +  S ++   +  +S++L+ +   +    TN++ S   + +  +L + K + K+  N          L + L   ++++    E+  ++  + +   +++ K  + V+ +       ++ HH        ED + W+Q K ++ N    E   I   L  NI +  I     +Q  +K + S  E +  E   + ++     K+  +  +L++L +  E I+  +    NNL    Q+A+     + N    I+ WI+  +HK+++    V L +I+S +  ++   K+++ +   +  L +                        ES L   + + +   E  K +  Q+    +N++  +  L K  T+ +E+ +  +  +KQ               P   S K  + ++T Q  +  ++P ++    ++ S+AQ   V+A      T L  + E +  ++ ++   + +K  +L +K + +   ++ I    ++   L +++D+      DL+ L+ Q  D++          K LS+L +  EN  +  +K+   E S   I    +L A+N++  + +D  ++       I++  E       +  D ++ ++E         +    +N+      AF +++++PL+ +++E+  +G     +       + +E +++ V   ++ L   V+     +   L+   +F  +LE+L  ++ +    + +++ PS E+   K+QL   +LL   L  R+ +++ + + G  +  +  +  K ++  +L  L  +++ LL  AE +N + D  + +++ F D  EP   WL + EK LA  +   T  A ++ ++I + K L++D ++ ++S+
Sbjct: 3187 APESSKWKEMLDKIDSLWQDINKMAAERQQTLEESSNDLNQFQTAEAQLKQWLTEKELMASVLGPLSIDPNMLKTQKQQVQILLKEFDARKQQYEQFRSAGQRILNRPCELPSSGEV--VKEQLASVACKWESLTGQLNDRCDRIEQAIVKSTNYQNNLKGLSEKLSAMSNTL---STNMVVSSHPDAVNQKLQTAKQLQKDLSNEKKNIEDTKVLCQELSNLVAEDYLKAELNRQMDTVVKPFVDLEEKAGYHVEQLQMAFASSQKFHHLS------EDLKSWIQTKTKEQN----EAAPISANL--NILESLITEQAEVQNALKDQLSTYEKVTAEAENLLQKTKGDEKAN-LQSQLSMLKSNWEAINKQVLERQNNLLDCQQKATKHKEFVEN----IQPWIEECQHKLSEFTVSVDLSAIESSVGQVKVLQKNVDKQRGMMETLNS----------------------ATESLLNCCQTDKEAIREQNKNMNSQVDELIDNLHIKRDTLEKFGTRLKEFQESVKDTEKQLAVAQEHLDAHNSLGPQGCSNKHLTIMQTQQKVLQNLEPQID----IVRSLAQQLVVDAFDAEGVTELVLQAESLHQKHHIIHQEVEEKCSFLETKLQGIGHFQNSIREMFSQFTELDDELDSMTPVGRDLNILQCQKQDISKFL-------KKLSDLITTNENANKTCKKMLATESSPDLIGIKRDLEALNKQCNKLLDRAKSREEQTENIISRTEDFYCTLKQFFDLLKGVEEHEESQGAVGMETDVINHQLNIFMAFQKEEIEPLQARIQEVNQLGQGLVQSAAKNTSTESLEHDLEEVNVRWNTLNNKVAQRAAQLQEALLHSGRFQDALESLLSWLTDTEDLVASQKPPSAEFKVVKAQLQEQKLLQRLLSDRKPTVEAIKREGEKIASSADQTDKEKILKQLSTLERRWDELLKKAEIRNRQLDDILVVAEQFHDSLEPLSEWLTSTEKKLAISEPIGTQTA-KLLQQISQQKALEDDITAHNKSL 4155          
BLAST of Dystonin vs. Ensembl Xenopus
Match: rab11fip2 (RAB11 family interacting protein 2 (class I) [Source:Xenbase;Acc:XB-GENE-5947669])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 525/1571 (33.42%), Postives = 868/1571 (55.25%), Query Frame = 3
Query: 14754 QLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDS-KKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL-----IPIFDRS----KRMETNQGI-SKIQEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKY-------KFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVS------SPRIPQPVTSPRISQNIPSSRVSQSLASPRTP 19355
            QL+ A+ L  +F  +Y  L  WL+ETE  + Q  +  LD D L + +++I+ L     + KP +D + K+G  L  +    +G  I      A   Y+ IKE +K RA  L++ I  + + ++K+D     L+ I +R+      S   EK+ E+L     +  +L+KLQ   + L+   E    +R    DKD S ++++ KL ++    + +Q+ T E + +++++L LA +FW D   +   F +     T   I +L+   V+     ++++  E ++ EID  + ++  +   G +LI     P++ P V +  +EL   ++ +  + ++++  +D       + ++    L +W      ++  + P+ T+   V  QI + K+ K D   +  ++E +N Q    L K +  N K  V   L+ +   W  L D +  RQH+L+  LL+LG F  A+DE   W+  TE  L   K   GD  ++E+ LA+H +++ D+   +++V  +++   ++I+   SS G EA+    RLE L + W+ + +    +   L+ AL +A  F+ + +++ + + ++  +L   K  GGLP+TA+EQL   +++   F       ++ +++S ++ ++ +      I+ D+  L +KW++V      RK++LE+A+E    FH  +  FINWLT  E+ L    P S I+ T+L Q++ H+    ++ SHR++++ LDK  THLKY SQK D+V+I+NL+ S+  RWE VV RS ER R LD   K +K+F +    L++ +  +   L+ +  I   P KI+ Q+TKHKEF   LG  +  YD+T R G  L++KA + D  +K+D+++  ++ KW ++C KSIER+  L +ALL+SG + DA+  L+ WL  IEP+L++  +   GD++ V  L++ H + +K+L  R   I+ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLEEA +QA  F    ++L E+ + +E  LR   I P++  E+ +  +I  H  F + +     ++N     G  IL   +P++  +IKH+I II++++ ++L+W++Q    L   LD L  +K LL+ LL WL  +E TL   +  ++   L E K    EH+ F+ +MT KQ D D++    K+K         IP+ D+     KR  T     S  Q  L   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFI+GI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q G+ KY       KFGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++  L+ AKGRTN ELREK   P+G   +M PF+      P   +   +++  SP  S   SSP I    S      +P+ P  +T       + +S+ S    SP +P
Sbjct: 4681 QLERAVSLVNQFWETYEELWPWLIETENAISQLPVPALDYDTLKQQQEDIRQLRELIAEHKPHIDKMNKTGPQLLDLSPE-EGFFIQEKYVSADTLYSEIKEVVKKRAIYLDEAISQSAQFHDKIDPTLENLQRIAERLRQPPSISAECEKIKEQLSENKNVSVELEKLQPVYETLKKRGEEMI-ARSEGADKDISAKVVQDKLDQMVFVWEDIQALTEEREAQLLDVLELAEKFWCDHYALIATFKD-----TQDLIRELDGPGVDPSVVKEQQETAEVIKEEIDGFQDELDAVISLGSELISACGEPDK-PVVNKNIDELTSAWDTLNKTWKERVEKLDEAMQAAVQYQDGLQALYDWVDIATLKVESMPPIGTDLVTVKQQIVELKQFKTDTYQQQIELERLNHQKELLLKKVTDENDKQAVEDPLSELKLLWNSLEDKIINRQHKLEGALLALGPFQHALDELTTWMTHTEGLLNEQKSVGGDPKAIEIELAKHHVLQNDVLAHKSTVETVKKAGNDLIE---SSAGEEASSLNSRLESLNQRWQIILDKTEKRMKLLDSALFQAQGFHSEIEDMHQWLTDIERQLLASKPVGGLPETAREQLSAHLELCSLFEVKEEIYKRLMQKSQQMMERCTDDPEANIDQDVINLKEKWESVDTKLSERKAKLEEALEVATGFHNSLQDFINWLTQAEQTLTIASPPSLILDTVLFQIDEHKVFVTEVNSHRDQIMELDKTGTHLKYFSQKQDVVIIKNLLISVQSRWENVVQRSLERGRMLDDARKRSKQFHEAFDKLMEWLEESERSLDSELEIANDPDKIKTQLTKHKEFQKTLGGKHTVYDTTTRSGRSLKEKATLTDDIQKLDDMLSEIRDKWDTVCGKSIERQNKLEEALLISGQFTDALQALIDWLYRIEPQLAE-DQPVHGDIDIVMNLIDNHKVFQKELGKRSSSIQALKRSARELIEGSRDDSSWVKAQMQELGTRWETVCNLSVSKQTRLEEALHQAESFHAAVHALLEWLADAEQALRFHGILPDD--EDSLRLLIEQHKEFMRRVEEKRSELNKGASMGEAILAICHPDSITTIKHWITIIRARFEEVLTWTKQHQQRLAVALDDLIAKKELLESLLAWLQWSEMTLNEKDKEDIPQDLDEVKALIEEHQIFMEEMTQKQPDVDKVTKTYKRKVESTTGQSQIPVLDKGRGGWKRSPTPSLYPSGTQTSLETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIEGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGENKYRVISLLFKFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTQPLI-AKGRTNVELREKFMLPEGASQSMTPFR------PKGRRSRPSSRGASPNRSN--SSPNIQASPSLAASSITPKTPLHLTRNYGKPWLANSKTSTPCKSPESP 6218          

HSP 2 Score: 258.455 bits (659), Expect = 2.648e-67
Identity = 130/247 (52.63%), Postives = 173/247 (70.04%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            LDP +R VLR+ADERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL WS++  E Y  I  ENF+T W+DG+ F A+IHK RPDLIDL +++  S   NLE AF  A+K LGV ++++PEDV     DEKS++TYVAS+++  PK  D  E I
Sbjct:  194 LDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVSDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKKRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKEKLLLWSQQTSEGYGGIRCENFTTCWRDGRLFNAIIHKYRPDLIDLDTVAVQSNITNLENAFYVAEK-LGVTRLLDPEDVDVSSPDEKSVITYVASMYDAFPKTPDGGEGI 439          

HSP 3 Score: 98.2117 bits (243), Expect = 6.424e-19
Identity = 89/460 (19.35%), Postives = 208/460 (45.22%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDL---DGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSN 3182
            +WI+E    +    + +DL   +G  + ++ F     E + S+ E KM  E +       ++ +S   L++++++L  +         +   F+ ++   + W+  KE++++ + W +     +  K++   +L+ EL+ +E  I     +   + + NH A + I+   A ++++W WIL L HC++ H+   + Y ++F +A +A   +  L + +  ++       L + E L +E  +  E +  YK TV  ++  ++++  L  R      +  + ++AIC  K+        + + E + L +NS    W+V +        P++CF +   + +A  +A  ++  +  +  LW +  + ++  V    L++ ++ ++         L P   Q+++  L    +  + D + + I   ++I +    +N C   + EL  S+    Q  ++ N
Sbjct:  788 SWIEEMQVQLDRAEWGSDLSSIEGHLENHKNFDRAVEEFESSLKEAKMS-EPQITGIFKANYDESLYKLESQYSKLLNSSRNRQKHLDTLHSFVSRATRELIWLNEKEEEEVAYDWSERNQ-NIPAKRDYHGDLMRELDHKEEIIKSVQDIAEQMLLQNHPARSTIEAYRAAMQTQWNWILQLCHCVEQHIRQNSAYFEYFNDAKDAAEYLKSLKDAILRKYSCDKSTSLHKLEDLLQESMEK-EQLLQYKSTVGSLVGKAKAIIQLKPRNPDNPLKASIPIRAICDYKQ---IEITIYKDDECI-LASNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDSANRIEQMYQSVLTLWHESHINMKSTVSWHYLMNEIEGIRASKVSTIKTLLPGEHQQVLSNLKSRFDEFLEDSQESKIFSMSDIAQLEREVNVCKLYYEELLKSAEREEQEESIYN 1240          

HSP 4 Score: 89.3521 bits (220), Expect = 3.104e-16
Identity = 195/987 (19.76%), Postives = 438/987 (44.38%), Query Frame = 3
Query: 10881 MKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMS--PTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESEN----------LSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMI------GKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQI-----LQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDI----NNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKH-YPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQ---------------PIDVS-KLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNA------TLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE--QKIETAEKSMHKID---NLAAINEKIIESIDDRQNSLILQHKIVTEFE------SKKNDFIRKIDEANNDPELAKL----LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESI 13646
            + +F   +  ++  +  KE M +VLGP+    +    Q QQV  L+ E +  +   ++ R+ GQ I+      P+S EV  ++E L  ++ K ++L   L DR   I   +  S ++   +  +S++L+ +   +    TN++ S   + +  +L + K + K+  N          L + L   ++++    E+  ++  + +   +++ K  + V+ +       ++ HH        ED + W+Q K ++ N    E   I   L  NI +  I     +Q  +K + S  E +  E   + ++     K+  +  +L++L +  E I+  +    NNL    Q+A+     + N    I+ WI+  +HK+++    V L +I+S +  ++   K+++ +   +  L +                        ES L   + + +   E  K +  Q+    +N++  +  L K  T+ +E+ +  +  +KQ               P   S K  + ++T Q  +  ++P ++    ++ S+AQ   V+A      T L  + E +  ++ ++   + +K  +L +K + +   ++ I    ++   L +++D+      DL+ L+ Q  D++          K LS+L +  EN  +  +K+   E S   I    +L A+N++  + +D  ++       I++  E       +  D ++ ++E         +    +N+      AF +++++PL+ +++E+  +G     +       + +E +++ V   ++ L   V+     +   L+   +F  +LE+L  ++ +    + +++ PS E+   K+QL   +LL   L  R+ +++ + + G  +  +  +  K ++  +L  L  +++ LL  AE +N + D  + +++ F D  EP   WL + EK LA  +   T  A ++ ++I + K L++D ++ ++S+
Sbjct: 3378 LNQFQTAEAQLKQWLTEKELMASVLGPLSIDPNMLKTQKQQVQILLKEFDARKQQYEQFRSAGQRILNRPCELPSSGEV--VKEQLASVACKWESLTGQLNDRCDRIEQAIVKSTNYQNNLKGLSEKLSAMSNTL---STNMVVSSHPDAVNQKLQTAKQLQKDLSNEKKNIEDTKVLCQELSNLVAEDYLKAELNRQMDTVVKPFVDLEEKAGYHVEQLQMAFASSQKFHHLS------EDLKSWIQTKTKEQN----EAAPISANL--NILESLITEQAEVQNALKDQLSTYEKVTAEAENLLQKTKGDEKAN-LQSQLSMLKSNWEAINKQVLERQNNLLDCQQKATKHKEFVEN----IQPWIEECQHKLSEFTVSVDLSAIESSVGQVKVLQKNVDKQRGMMETLNS----------------------ATESLLNCCQTDKEAIREQNKNMNSQVDELIDNLHIKRDTLEKFGTRLKEFQESVKDTEKQLAVAQEHLDAHNSLGPQGCSNKHLTIMQTQQKVLQNLEPQID----IVRSLAQQLVVDAFDAEGVTELVLQAESLHQKHHIIHQEVEEKCSFLETKLQGIGHFQNSIREMFSQFTELDDELDSMTPVGRDLNILQCQKQDISKFL-------KKLSDLITTNENANKTCKKMLATESSPDLIGIKRDLEALNKQCNKLLDRAKSREEQTENIISRTEDFYCTLKQFFDLLKGVEEHEESQGAVGMETDVINHQLNIFMAFQKEEIEPLQARIQEVNQLGQGLVQSAAKNTSTESLEHDLEEVNVRWNTLNNKVAQRAAQLQEALLHSGRFQDALESLLSWLTDTEDLVASQKPPSAEFKVVKAQLQEQKLLQRLLSDRKPTVEAIKREGEKIASSADQTDKEKILKQLSTLERRWDELLKKAEIRNRQLDDILVVAEQFHDSLEPLSEWLTSTEKKLAISEPIGTQTA-KLLQQISQQKALEDDITAHNKSL 4308          
BLAST of Dystonin vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 689/2469 (27.91%), Postives = 1246/2469 (50.47%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKS------EVENLAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSID-TKNKINKLFDRFSEYQ-KSHYXXXXXXXXXXXXXXXXXDQVNLFE--DTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETL----KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLAN----NKLDLVLPSLTALVRENDSLTG----QVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAF------ENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPL----IPIFDRSKRMETNQGISKIQEPLFV-----------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF--KFKPATLPIPTKKPTTAKIPSPRVSQ--------PLSSPRIHQPVS----SPRIP-QPVTSPRISQNIPSSRVSQSLASP------RTPKVVASPGLQ--------------------RKSRIPTRQTSQQGSQASTRHQSR 19454
            + E +   +  LS  + +K  +L +K          ++     Q  +RE    F +   +LD +     D   LR++   ++  L  L++            +  + T E S   I    +L A+++   K+++    R+  +    + + EF  K  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +  +    + +E ++DSV   +  L + V+   + +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L+ R+S+++ + + G  +  + +   + +L  +L  L++++E LL+ AE +N + +    +++ F +  EP   WL   EK LAN +   T  A ++E++I ++K L++D ++  + + +  + I +   V S     D  ++K++ L   + E Q KSH     L     N      D+V L    + ++G     K  KL++ D +    +W +      E+++ +E +    +++DQ    G +L + ++ ++   I  K+  +   + +I+  +       E+++ +A +    +    N LD V   L  L  E   L G    QV ER  E L+NE  S + LV       D L  V +         + E +E    E+ +R++ V + +T+K  +I +   +++  E+  D  +  ++  ++K+  + D   + +   ++L+  K    ++L      K+ I+  +    K++  +   + +S+K  +D+V K+ ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++  + +G  I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++G    +  D++KLQ   + L Q G E  +  R    +KD S   ++ KL ++      + +   E + K+++++ LA +FW D + L+      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + ++  ++       + ++    + +W     N+L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +    K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  T+  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +L  L + W+++ E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +    ++  +  +S    I+ D+  L +KW++VK+    +K++LE+A+     FH  +  FINWLT  E+ LN     S I+ TIL Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D ++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S +DSS++  Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR     P++  E+ +  +I  H  F K L     +++     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++   PP     IP+ D+ +      G  +     F            NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++ +   AKGRTN ELREK     G    MA F  + + +        P  +   S    Q          S+P+I  P++     P +    +++P  +   P   VS +  +P      R P  ++  G                         + P+R  S+ GS+A +R  SR
Sbjct: 5253 QAETLAEEHSELSQQVDEKCSFLETK----------LQGLGHFQNTIREMFSQFTECDDELDGMAPVGRDAETLRKQKACMQTFLKKLEALMASNDSANRTCKMMLATEETSPDLIGVKRDLEALSKQCNKLLDRAKTREEQVDGATEKLEEFHRKLEEFSTLLQKAEEHEESQGPVGTETETINQQLDVFKVFQKEEIEPLQVKQQDVNWLGQGLIQSAAANTCTQGLEHDLDSVNSRWKTLNKKVAQRTSQLQEALLHCGRFQDALESLLSWMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGT-QAPKLEEQISQHKVLEDDITNHSKQLHQ-AVSIGQSLKVLSSREDKDLVQSKLDSLQVWYFEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHG-----KLSKLSVQD-HSPEALWRQR----AELRALQEDILLRKQSVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSADVAKTLEHALQLAGQLQSMHKELCNWLDKVEVEL--LSYETQGLKGEAASQVQERQKE-LKNEVRSNKALV-------DSLNEVSSALLELVPWRAREGLEKTIAEDNERYRLVSDTITQKVEEIDAAILRSQQFEQAADAELSWITETQKKLMSLGDIRLEQDQTSAQLQVQKAFTMDIL----RHKDIIDELVTSGHKIMTTSSEEEKQSMKKKLDKVLKKYDAVCQINSERHLQLERAQSLVSQFWETYEELWPWLTETQRIISQLPAPALEYETLRRQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPK-EGIYIQEKYVAADTLYSQIKEDVKKRAVVLDEAISQSTQFHDKIDQILESLERIAERLRQPPSISAEVEKIKEQIGENKSVSVDMEKLQPLYETLRQRGEEMIA--RSEGTEKDVSARAVQDKLDQMVFIWGSIHTLVEEREAKLLDVMELAEKFWCDHMSLV------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDMVITLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRVDRLEEAMQAAVQYQDGLQGIFDWVDIAGNKLATMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEEADKHTVQDPLMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEALHLAMNFHNSLQDFINWLTQAEQTLNVASRPSLILDTILFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLADDNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPDD--EDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGR-----AGRKRFPASGFYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITATQPTLAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSASSHACQAASPPVPAAASTPKILHPLTRNYGKPWLANSKMSTPCKAAECPDFPVSSAEGTPIQGSKLRLPGYLSGKGFHSGEDSALITTAAARVRTQFAESRKTPSRPGSRAGSKAGSRASSR 7654          

HSP 2 Score: 255.758 bits (652), Expect = 1.443e-66
Identity = 127/247 (51.42%), Postives = 174/247 (70.45%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            LDP +R VLR+ADERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL W+++A E Y  +  ENF+T W+DGK F A+IHK RPDLID+ +++  S   NLE AF  A+K +GV ++++PEDV     DEKS++TYV+SL++  PK  +  E I
Sbjct:  197 LDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGVRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEK-IGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGI 442          

HSP 3 Score: 98.9821 bits (245), Expect = 3.411e-19
Identity = 91/467 (19.49%), Postives = 205/467 (43.90%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSN 3182
            NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + +    + L++++ +L       +    +   F+ ++   + W+  KE+ ++ + W +  S  ++ K+     L+ ELE +E SI     +   L + NH A   I+   A ++++W WIL L  C++ H++  + Y +FF +A EA + +  L + +  ++       + + E L +E  +  E ++ Y+  V  ++  +++V  L  R      +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + I   ++I++    ++ C   + EL  S+    Q  +V N
Sbjct:  791 NWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMT------APLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNS-SVARKKSYHAELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQENSAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEKEELLQ-YRSVVAGLMGRAKTVVQLKPRNPDNPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQSVLTLWHESHINMKSVVSWHYLVNEIDRIRASNVASIKTMLPGEHQQVLSNLQSRLEDFLEDSQESQIFSGSDISQLEKEVSVCRKYYQELLKSAEREEQEESVYN 1243          
BLAST of Dystonin vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 685/2465 (27.79%), Postives = 1235/2465 (50.10%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKS------EVENLAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSID-TKNKINKLFDRFSEYQ-KSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETL----KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLAN----NKLDLVLPSLTALVRENDSLTG----QVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAF------ENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPL----IPIFDRSKRMETNQGISKIQEPLFV-----------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF--KFKPATLPIPTKKPTTAKIPSPRVSQ--------PLSSPRIHQPVS----SPRIP-QPVTSPRISQNIPSSRVSQSLASP------RTPKVVASPGLQ--------------------RKSRIPTRQTSQQGSQASTRHQSR 19454
            + E +   +  LS  + +K  +L +K + +             Q  +RE    F +   +LD +     D   LR++   ++  L  L++            +  + T E S   I    +L A+++   K+++    R+  +    + + EF  K  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +  +    + +E ++DSV   +  L + V+   + +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L+ R+S+++ + + G  +  + +   + +L  +L  L++++E LL+ AE +N + +    +++ F +  EP   WL   EK LAN +   T  A ++E++I ++K L++D ++  + + +  + I +   V S     D  ++K++ L   + E Q KSH     L     N      D+V L     +  E   K  KL++ D +    +W +      E+++ +E +    +++DQ    G +L + ++ ++   I  K+  +   + +I+  +       E+++ +A +    +    N LD V   L  L  E   L G    QV ER  E L+NE  S + LV       D L  V +         + E +E    E+ +R++ V + +T+K  +I +   +++  E+  D  +  ++  ++K+  + D   + +   ++L+  K    ++L      K+ I+  +    K++  +   + +S+K  +D+V K+ ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++  + +G  I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++G    +  D++KLQ   + L Q G E  +  R    +KD S   ++ KL ++      + +   E + K+++++ LA +FW D + L+      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + ++  ++       + ++    + +W     N+L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +    K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  T+  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +L  L + W+++ E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +    ++  +  +S    I+ D+  L +KW++VK+    +K++LE+A+     FH  +  FINWLT  E+ LN     S I+ TIL Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D ++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S +DSS++  Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR     P++  E+ +  +I  H  F K L     +++     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++   PP     IP+ D+ +      G  +     F            NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELREK     G    MA F  + + +        P  +   S    Q          S+P+I  P++     P +    +++P  +   P   VS +  +P      R P  ++  G                         + P+R  S+ GS+A +R  SR
Sbjct: 2735 QAETLAEEHSELSQQVDEKCSFLETKLQGLGHF----------QNTIREMFSQFTECDDELDGMAPVGRDAETLRKQKACMQTFLKKLEALMASNDSANRTCKMMLATEETSPDLIGVKRDLEALSKQCNKLLDRAKTREEQVDGATEKLEEFHRKLEEFSTLLQKAEEHEESQGPVGTETETINQQLDVFKVFQKEEIEPLQVKQQDVNWLGQGLIQSAAANTCTQGLEHDLDSVNSRWKTLNKKVAQRTSQLQEALLHCGRFQDALESLLSWMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGT-QAPKLEEQISQHKVLEDDITNHSKQLHQ-AVSIGQSLKVLSSREDKDLVQSKLDSLQVWYFEIQEKSHSRSELLQQALCNAKIFGEDEVELMN---WLNEVHGKLSKLSVQD-HSPEALWRQR----AELRALQEDILLRKQSVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSADVAKTLEHALQLAGQLQSMHKELCNWLDKVEVEL--LSYETQGLKGEAASQVQERQKE-LKNEVRSNKALV-------DSLNEVSSALLELVPWRAREGLEKTIAEDNERYRLVSDTITQKVEEIDAAILRSQQFEQAADAELSWITETQKKLMSLGDIRLEQDQTSAQLQVQKAFTMDIL----RHKDIIDELVTSGHKIMTTSSEEEKQSMKKKLDKVLKKYDAVCQINSERHLQLERAQSLVSQFWETYEELWPWLTETQRIISQLPAPALEYETLRRQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPK-EGIYIQEKYVAADTLYSQIKEDVKKRAVVLDEAISQSTQFHDKIDQILESLERIAERLRQPPSISAEVEKIKEQIGENKSVSVDMEKLQPLYETLRQRGEEMIA--RSEGTEKDVSARAVQDKLDQMVFIWGSIHTLVEEREAKLLDVMELAEKFWCDHMSLV------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDMVITLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRVDRLEEAMQAAVQYQDGLQGIFDWVDIAGNKLATMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEEADKHTVQDPLMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEALHLAMNFHNSLQDFINWLTQAEQTLNVASRPSLILDTILFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLADDNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPDD--EDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGR-----AGRKRFPASGFYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------AKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSASSHACQAASPPVPAAASTPKILHPLTRNYGKPWLANSKMSTPCKAAECPDFPVSSAEGTPIQGSKLRLPGYLSGKGFHSGEDSALITTAAARVRTQFAESRKTPSRPGSRAGSKAGSRASSR 5112          

HSP 2 Score: 97.8265 bits (242), Expect = 6.047e-19
Identity = 93/476 (19.54%), Postives = 209/476 (43.91%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAV 3209
            NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + +    + L++++ +L       +    +   F+ ++   + W+  KE+ ++ + W +  S  ++ K+     L+ ELE +E SI     +   L + NH A   I+   A ++++W WIL L  C++ H++  + Y +FF +A EA + +  L + +  ++       + + E L +E  +  E ++ Y+  V  ++  +++V  L  R      +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + I   ++I++    ++ C   + EL  S+    Q  +V N   S V+ +
Sbjct:  287 NWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMT------APLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNS-SVARKKSYHAELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQENSAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEKEELLQ-YRSVVAGLMGRAKTVVQLKPRNPDNPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQSVLTLWHESHINMKSVVSWHYLVNEIDRIRASNVASIKTMLPGEHQQVLSNLQSRLEDFLEDSQESQIFSGSDISQLEKEVSVCRKYYQELLKSAEREEQEESVYNLYISEVRNI 748          
BLAST of Dystonin vs. Ensembl Mouse
Match: Macf1 (microtubule-actin crosslinking factor 1 [Source:MGI Symbol;Acc:MGI:108559])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 766/3002 (25.52%), Postives = 1433/3002 (47.73%), Query Frame = 3
Query: 10827 LKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRS---MSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDW--------EEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQ-------WLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQI-----LQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISP--VNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAK--------------LLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQ----NDDSSIDESIK---KLKIIINKVD-GVFSENVSIDTKNKINKLFDRFSEYQ-KSHYXXXXXXXXXXXXXXXXXDQVNLF------EDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVREND----SLTGQ--VGERNMEILENETNSVEKLVCQARNDLDKLKSVD------AFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNE---QKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSP------SRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF-PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPLIPIFDRSK---RMETNQGISKIQEPLFV-------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------LPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPV-TSPRIS-----QNIPSSRVSQSLASPRTPKVVAS-PGLQRKSRIPTRQTSQQGSQAS 19436
            L++SA  HL   +  +SQ++ +          ++ KE M+ VLGP+    +  NAQ QQV  ++ E E      ++L    Q I+     MSP++S+V    + L  +S+K   L   L  R   I   +  S  +  L+ D+S+++  + +++    + + T  +          EI+++L  + + +KE++ L + L   I ++    E+K ++  ++   + ++       D+   R +     L   +  +Q       WL  KQ Q      +    P +      Q Q+      Q ++       E I  E   +     P  + K + ++L  L +  E++     N     +       K       +  WID  K KM++   V L+ +  E  LL    K++ N+ ++   L  +++    +   +    +     +     +++    +E       L+E      E     K+   K+E  A+  L+  ++   Q      LE ++K  Q  +  ++P ++  +     + + +P   +A+ L  + E     +  +   ++   + + +K + + +   R+    ++  +L +++D       D DSL+ QI D+     +   +   + + ++E   + E++       + +   L A+N+   K+ E    RQ  L L    V        DF RK+   N+    A+              ++N    +   F + +VDPL+ +L+++  +G     +       + +E +MD +   ++ L + V+     +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R++++D L   G  +  + +   + ++  +L+ L  ++ +LL+ A  +  + +  + L+K F +  EP   +L   EK LAN +   T  A ++ ++I  +K L+    N  + + +++K    L  +    + G+ SE        K++ L  R+SE Q +   +   L     N      D+V +       ED L      +KD + +++          + L L +E+ + +   KN+DQ    G+ L + ++  +   I  K++ +   + +I++++ K L   E +  +A +F             LT  +RE +    +  GQ   GE+ +   +     ++K V + R  LD +  V           + E ++ +  +  +++K + + V ++  +I +   +++  E+  D  +  ++  ++K+  +       DQ        +   ID      + +E    +  I ST  + +K +          L+   + + +Q E+ +     +  +L+ A  L  +F  +Y  L  W  ET   + Q     +D +QL + ++E++ L  S  + KP +D I+K G  L ++ N  +GK +    + A+  Y  IK+ ++ RA  L++ +  + + ++K++     LEN+  R+     P + P ++D+      E + D     + ++KLQ   E           R    DKD +  EI +KL ++    + +++++ E + K +++L LA +FW D+  +       TI  T   + DL +  ++      + +  E ++ E D   +++  I   G  LI       E P+V+++ +E+   +E +  + ++++  ++       + ++    + +W      +L  + P+ T+   V  Q+ + KE K ++  +  ++E +N  G   L K +    ++ +   L  +   W  L + +  RQH+L+  LL+LG+F  A++E + W+  TE  L   +   GD   +E+ LA+H +++ D+   QA+V+ + +  +E+++   SS G +A+    RLE + + WE + +    +  +L+  L++A  F+ + ++    ++ + ++L   K +GGLP+TA+EQL   M+++     K  I  +   +    +  +     G   E  + +L +KW  V +  E RKS+LE+A+     F   + +FINWLTL E++LN   P S I++T+L Q+E H+    ++  HR++++ LD+    LK++SQK D+VLI+NL+ S+  RWEKVV RS ER R+LD   K AK+F +  + L+D +      L+ +  I   P KI+ Q++KHKEF   LG     YD+T R G  L++K  +  D++K+D ++  ++ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +      L+  S +D+++++ QL EL + W+ V KL+  K+ RLE+A  QA EF    + L E+ S++E  LR     P++   E + ++I  H  F K +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL W+  AE TL+  +   +   +   K    EH+ F+ +MT KQ D D +    K+K+  P   P  ++S+   R   NQ       P+ +       NP+INQL ++W+QVW + L R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF TT++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    M PF     + KP++                 +   +PS   +    +  I    S  + P P   S R S      N  S   + + A+   PK  AS PG +  SR  +R +S++GS AS
Sbjct: 2411 LEESAS-HLACFQAAESQLRPW----------LMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTGPGDMSPSASQV---HKDLQSISQKWVELTDKLNSRSSQIDQAIVKSTQYQDLLQDLSEKVKAIGQRLS-GQSAISTQPEAVKQQLEETSEIRSDLGQLDNEIKEAQTLCQELSLLIGEQYLKDELKKRLETVALPLQGLE-------DLAADRMNRLQAALASTQQFQQMFDELRTWLDEKQSQ------QAKNCPISAKLERLQCQLQENEEFQKNLNQHSGSYEVIVAEGEALLLSVPPGEEKKTLQNQLVELRSHWEDLSKKTANRQSRLKDCMQKAQKYQGHVEDLVPWIDECKSKMSE-LQVTLDPVQLESSLLR--SKAMLNEAEKRRSLLEILNSAADILINSSEIDEDEIRDEKAGLNQNMDAITEELQAKTSSLEEMTQRLKEFQESFKNIEKKVEG-AKHQLEIFDALGSQACSNKNLE-KLKAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASPLVHQAEVAQQEFLEVKQRVSSSCLTMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIQALRFDIEDSEAECRKMLEEEGTLDLLGLKR--ELEALNKQCGKLTERGKVRQEQLELTLGRV-------EDFYRKLKALNDAATAAEEGEALQWIVGTEVDVINQQLADFKLFQKDQVDPLQVKLQQVNGLGQGLIQSAGKNCDVQGLEHDMDEINTRWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLTDTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLESLERRWTDLLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTA-KIHQQIIRHKALEEEIENHATDVHQAVKIGQSLSSLTCPAEQGIMSE--------KLDSLQARYSEIQDRCCRKASLLEQALFNARLFGEDEVEVLNWLAEVEDKLSTV--FVKDYRQDVLQKQHA-----DHLALNEEIINRK---KNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITLTSSKALRTLEQARQLATKF-------HSTYEELTGWLREAEEELAASGGQSPTGEQ-IPQFQQRQKELKKEVMEHRLVLDTVNEVSHALLELVPWRAREGLDKLVSDANEQYKLISDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFSTCGEEQKAV----------LQEKTECLIQQYEAVSLLNSERYARLERAQVLVNQFWETYEELSPWAEETLALIAQLPPPAVDHEQLRQQQEEMRQLRESIAEHKPHIDKILKIGPQLKEL-NPEEGKMVEEKYQKAENMYAQIKDEVRQRALALDEAVSQSAQFHDKIEPMLETLENLSSRL---RMPPLIPAEVDK----IRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARSEEREIKFLDVLELAEKFWYDMAALL-----TTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGE-TEKPEVKKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVATVNKAGSELLE---SSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELNRMENQLSASKPTGGLPETAREQLDTHMELHSQLRAKEEIYNQLLDKGRLMLLSRGDSGSGSKTEQSVALLEQKWHAVSSKVEERKSKLEEALSLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNDHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLAGDTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE-DQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIEGSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDD--TEALQSLIDTHKEFMKKVEEKRVDVNTAVAMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALITEHQSFMEEMTRKQPDVDRVTKTYKRKSVEPTHAPFMEKSRSGSRKSLNQPTPP---PMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVISSSGSKLKRPTPAFHSSRTSLAGDTSNSSSPASTGAKANRADPKKSASRPGSRAGSRAGSRASSRRGSDAS 5278          

HSP 2 Score: 198.364 bits (503), Expect = 2.939e-49
Identity = 99/206 (48.06%), Postives = 140/206 (67.96%), Query Frame = 3
Query:  468 INKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            + K + D++ DLRDG  L++LLEVLS  KL  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  S +S D+S K+ LL W++K    Y  +   NFS+ W DGK F ALIH+ RPDL+D++ +   S ++NLE AF  A++ LGV ++++ EDV     DEKS++TYV+S+++  PK
Sbjct:    1 VRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGVKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQVQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPK 205          

HSP 3 Score: 111.309 bits (277), Expect = 5.347e-23
Identity = 161/837 (19.24%), Postives = 367/837 (43.85%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLN---KIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSK----NDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLS------TMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLK-CANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDL-QLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQ-----VCKHKEFETNLKNYEPQVNDLIL----FVK---NGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKD---VPTNLDQLISAVTTSRQNQKDVSYE---DIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTKRSRIQNAHDWVSCE 4238
            +W++E    +    + NDL  +    +  +   T+  E+  SV E ++      + +M  +FH S       L+T++ +L    S      +S  +F+ ++   + W+  KE++++   W D+ +  +S K+  F  L  ELE ++            L++ NH A   ++   A ++S+ QW+  L  C++ H++  A Y QFF +A + ++ +  L + +  ++       L   E L ++  D  E +   K +V  ++  S+++  L  R    + +  ++VKAIC  ++          + +   L +NS    W+V +        P++CFLI   + +A + A  ++  +  +  LW   +L +  + L+S       +D V+ W+ E   +L P    ++++ L       + D    A     +  +    +  C A F  L         M+++ N+          E+   V + +L ++  +  +  Q L  ++ SP     D    Q     + + +  + +L++    ++ + +    F++   +G S T  L+ +L  M++  + ++  + +++ KLK+ +V    + + + ++   E+ L +Q E+ PA        ++ LE+ + T+   + ++KD   V + LD+ I+      +  +  + E   D+++ +++   ++ R+  +  Q++ R S V          +     +  WI   +TT + ++  P    +S+ +   + +      EI + + ++D+  K +  +  +++ YE     Y+  +++Q     Q   G  KR R+ ++ D ++ E
Sbjct:  500 SWVEEMQMKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLY-----EGKMSQNFHTSYVETLGKLETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNGKEEEELACDWSDS-NPNISAKKTYFSELTMELEGKQDVFRSLQDTAEVLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENAAYFQFFSDARDLESFLRNLQDSIKRKYTCDRSTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGRSKTIVQLKPRNPDHVLKSTLSVKAICDYRQ----IEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCFLIPPPNKEAIEMASRVEQSYQKVMALW--HQLHINTKSLISWNYLRKDLDTVQTWSLEKLRSLAPGECHQVMKNLQAHYEDFLQDSHDSALFSVADRLRIEEEVEACKAHFQHL---------MKSLENED-------KEETLAKVYISELKNIRLLLEECEQRLLKQIQSPASSKTDRDARQDITLRIAEQEHTQEDLQHLRSDLDAISMKCNVFLQQSPSGSSATT-LRSELNLMVEKMDHVYGLSTVYLNKLKTIDVIVRSMQDAELLVKGYEIKL-SQEEAVPAD-------LSALESHRTTLQHWLSDVKDKNSVFSVLDEEITKAKKVAEQLRHPASEPNLDLERYQEKGSQLQERWHRVIAQLETRQSEVESIQEVLRDYRACHGTLIKWIE--ETTAQQEMMKPGQAEDSRVLSEQLSQQTELFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQ-----QKSPG--KRRRMISSSDAITQE 1290          

HSP 4 Score: 55.8398 bits (133), Expect = 3.392e-6
Identity = 116/614 (18.89%), Postives = 264/614 (43.00%), Query Frame = 3
Query: 16026 INDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSL--TNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRL-EQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDE---LGSKLEMFKFSGGLPDTAKEQ----LKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKY-ISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMN---RTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKI--DEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQ---TLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQF 17810
            +N  + +L + L +RQ  LQ +   + E  +     ++W+ + E  L   +  +      +++     +K   A++  +   + K++   A ++K   +S   E  +++ E L   WE+  E   A+  +LE++      F   + ++   + E   +   L        + +  K+Q    LK F    +   +LN   +  +    ++S  +SQ     +  D++ + +KW  + +   +R S++++AI     +   +      +    + L+ Q  +S     + +Q+E    ++ D+     E+     +   L   I +++    ++  + ++    + +   +++R   L       ++F+ M    RT LD+  S      ++  I     +++ Q+ +++EF  NL  H+ +Y+     G  L    P  + KK   +++V  L+  W+ L  K+  R+  L D +  +  Y+  + +L+ W+   + K+S+        ++ VQ   +LL   ++L  +   R  ++E +N+ A  L+  SE D   I D+ A L    + + +    K   LEE   +  EF+  + ++++    ++H+L  F
Sbjct: 2281 VNSKYEKLWEVLRERQESLQTVFSRMEEVQKEASSVLQWLESKEEVLKAMDATLSPTKTETVKAQAESNKAFLAELEQNSPKIQKVKEALAGLLKTYPNSQEAENWKKMQEDLNSRWEKATEVTVARQKQLEESASHLACFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTGPGDMSPSASQ-----VHKDLQSISQKWVELTDKLNSRSSQIDQAIVKSTQYQDLLQDLSEKVKAIGQRLSGQSAISTQPEAVKQQLEETSEIRSDLGQLDNEIKEAQTLCQELSLLIGEQYLKDELKKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDEKQSQQA---KNCPISAKLERLQCQLQENEEFQKNLNQHSGSYEVIVAEGEALLLSVPPGEEKKTLQNQLV-ELRSHWEDLSKKTANRQSRLKDCMQKAQKYQGHVEDLVPWIDECKSKMSE----LQVTLDPVQLESSLLRSKAML-NEAEKRRSLLEILNSAADILINSSEIDEDEIRDEKAGLNQNMDAITEELQAKTSSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIF 2880          
BLAST of Dystonin vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 564/1815 (31.07%), Postives = 968/1815 (53.33%), Query Frame = 3
Query: 14193 LVRENDSLTG----QVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAF------ENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPL----IPIFDRSKRMETNQGISKIQEPLFV-----------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSP------RIPQPVTSPRISQNIPSSRVSQSLASPRTP-----KVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            L  E   L G    QV ER  E L+NE  S + LV       D L  V +         + E +E    E+ +R++ V + +T+K  +I +   +++  E+  D  +  ++  ++K+  + D   + +   ++L+  K    ++L      K+ I+  +    K++  +   + +S+K  +D+V K+ ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++  + +G  I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++G    +  D++KLQ   + L Q G E  +  R    +KD S   ++ KL ++      + +   E + K+++++ LA +FW D + L+      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + ++  ++       + ++    + +W     N+L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +    K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  T+  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +L  L + W+++ E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +    ++  +  +S    I+ D+  L +KW++VK+    +K++LE+A+     FH  +  FINWLT  E+ LN     S I+ TIL Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D ++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S +DSS++  Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR     P++  E+ +  +I  H  F K L     +++     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++   PP     IP+ D+ +      G  +     F            NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++ +   AKGRTN ELREK     G    MA F     + +P++      + T+A   + + + P        P  +P      R+P  ++         S+ ++ + A  RT      K  + PG +  S+  +R +S++GS AS
Sbjct: 3551 LSYETQGLKGEAASQVQERQKE-LKNEVRSNKALV-------DSLNEVSSALLELVPWRAREGLEKTIAEDNERYRLVSDTITQKVEEIDAAILRSQQFEQAADAELSWITETQKKLMSLGDIRLEQDQTSAQLQVQKAFTMDIL----RHKDIIDELVTSGHKIMTTSSEEEKQSMKKKLDKVLKKYDAVCQINSERHLQLERAQSLVSQFWETYEELWPWLTETQRIISQLPAPALEYETLRRQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPK-EGIYIQEKYVAADTLYSQIKEDVKKRAVVLDEAISQSTQFHDKIDQILESLERIAERLRQPPSISAEVEKIKEQIGENKSVSVDMEKLQPLYETLRQRGEEMIA--RSEGTEKDVSARAVQDKLDQMVFIWGSIHTLVEEREAKLLDVMELAEKFWCDHMSLV------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDMVITLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRVDRLEEAMQAAVQYQDGLQGIFDWVDIAGNKLATMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEEADKHTVQDPLMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEALHLAMNFHNSLQDFINWLTQAEQTLNVASRPSLILDTILFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLADDNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPDD--EDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGR-----AGRKRFPASGFYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITATQPTLAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSASSHACQAASPPVPAAASTPKGTPIQGSKLRLPGYLSGKGFHSGEDSALITTAAARVRTQFAESRKTPSRPGSRAGSKAGSRASSRRGSDAS 5322          

HSP 2 Score: 239.58 bits (610), Expect = 1.153e-61
Identity = 119/239 (49.79%), Postives = 166/239 (69.46%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            L   + ++ R  DERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL W+++A E Y  +  ENF+T W+DGK F A+IHK RPDLID+ +++  S   NLE AF  A+K +GV ++++PEDV     DEKS++TYV+SL++  PK
Sbjct:   19 LQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGVRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEK-IGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPK 256          

HSP 3 Score: 98.5969 bits (244), Expect = 3.493e-19
Identity = 93/476 (19.54%), Postives = 209/476 (43.91%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAV 3209
            NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + +    + L++++ +L       +    +   F+ ++   + W+  KE+ ++ + W +  S  ++ K+     L+ ELE +E SI     +   L + NH A   I+   A ++++W WIL L  C++ H++  + Y +FF +A EA + +  L + +  ++       + + E L +E  +  E ++ Y+  V  ++  +++V  L  R      +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + I   ++I++    ++ C   + EL  S+    Q  +V N   S V+ +
Sbjct:  613 NWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMTAP------LKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNS-SVARKKSYHAELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQENSAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEKEELLQ-YRSVVAGLMGRAKTVVQLKPRNPDNPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQSVLTLWHESHINMKSVVSWHYLVNEIDRIRASNVASIKTMLPGEHQQVLSNLQSRLEDFLEDSQESQIFSGSDISQLEKEVSVCRKYYQELLKSAEREEQEESVYNLYISEVRNI 1074          

HSP 4 Score: 78.5666 bits (192), Expect = 4.322e-13
Identity = 87/430 (20.23%), Postives = 197/430 (45.81%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKS------EVENLAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----DSSIDESI 13646
            + E +   +  LS  + +K  +L +K + +             Q  +RE    F +   +LD +     D   LR++   ++  L  L++            +  + T E S   I    +L A+++   K+++    R+  +    + + EF  K  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +  +    + +E ++DSV   +  L + V+   + +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L+ R+S+++ + + G  +  + +   + +L  +L  L++++E LL+ AE +N + +    +++ F +  EP   WL   EK LAN +   T  A ++E++I ++K LQ D      S+D+++
Sbjct: 3061 QAETLAEEHSELSQQVDEKCSFLETKLQGLGHF----------QNTIREMFSQFTECDDELDGMAPVGRDAETLRKQKACMQTFLKKLEALMASNDSANRTCKMMLATEETSPDLIGVKRDLEALSKQCNKLLDRAKTREEQVDGATEKLEEFHRKLEEFSTLLQKAEEHEESQGPVGTETETINQQLDVFKVFQKEEIEPLQVKQQDVNWLGQGLIQSAAANTCTQGLEHDLDSVNSRWKTLNKKVAQRTSQLQEALLHCGRFQDALESLLSWMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGT-QAPKLEEQISQHKALQEDILLRKQSVDQAL 3479          

HSP 5 Score: 61.2326 bits (147), Expect = 6.438e-8
Identity = 54/233 (23.18%), Postives = 110/233 (47.21%), Query Frame = 3
Query: 15852 PLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKF-SGGLPDTAKEQLK 16547
            P   E + V  QIQ+ K L+  +E +   +E+I + G ++   + P  + ++   L+ ++  W  LL     R  QL+ I +   EFH  ++   EW+ A E  L N +        LE  ++QHK ++ D+ + + SV +      E++K+           +LE ++  ++++ + +      LE AL+ A       +E+   +D++  ++E+  + + GL   A  Q++
Sbjct: 3337 PPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGTQAPKLEEQISQHKALQEDILLRKQSVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSADVAKTLEHALQLAGQLQSMHKELCNWLDKV--EVELLSYETQGLKGEAASQVQ 3567          
BLAST of Dystonin vs. Ensembl Mouse
Match: Dst (dystonin [Source:MGI Symbol;Acc:MGI:104627])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 565/1815 (31.13%), Postives = 968/1815 (53.33%), Query Frame = 3
Query: 14193 LVRENDSLTG----QVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPL----IPIFDRSKRMETNQGISKIQEPLFV-----------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSP------RIPQPVTSPRISQNIPSSRVSQSLASPRTP-----KVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            L  E   L G    QV ER  E L+NE  S + LV       D L  V +    L      E +E    E+ +R++ V + +T+K  +I +   +++  E+  D  +  ++  ++K+  + D   + +   ++L+  K    ++L      K+ I+  +    K++  +   + +S+K  +D+V K+ ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++  + +G  I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++G    +  D++KLQ   + L Q G E  +  R    +KD S   ++ KL ++      + +   E + K+++++ LA +FW D + L+      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + ++  ++       + ++    + +W     N+L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +    K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  T+  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +L  L + W+++ E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +    ++  +  +S    I+ D+  L +KW++VK+    +K++LE+A+     FH  +  FINWLT  E+ LN     S I+ TIL Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D ++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S +DSS++  Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR     P++  E+ +  +I  H  F K L     +++     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++   PP     IP+ D+ +      G  +     F            NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++ +   AKGRTN ELREK     G    MA F     + +P++      + T+A   + + + P        P  +P      R+P  ++         S+ ++ + A  RT      K  + PG +  S+  +R +S++GS AS
Sbjct: 5565 LSYETQGLKGEAASQVQERQKE-LKNEVRSNKALV-------DSLNEVSSALLELVPWRAREGLEKTIAEDNERYRLVSDTITQKVEEIDAAILRSQQFEQAADAELSWITETQKKLMSLGDIRLEQDQTSAQLQVQKAFTMDIL----RHKDIIDELVTSGHKIMTTSSEEEKQSMKKKLDKVLKKYDAVCQINSERHLQLERAQSLVSQFWETYEELWPWLTETQRIISQLPAPALEYETLRRQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPK-EGIYIQEKYVAADTLYSQIKEDVKKRAVVLDEAISQSTQFHDKIDQILESLERIAERLRQPPSISAEVEKIKEQIGENKSVSVDMEKLQPLYETLRQRGEEMIA--RSEGTEKDVSARAVQDKLDQMVFIWGSIHTLVEEREAKLLDVMELAEKFWCDHMSLV------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDMVITLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRVDRLEEAMQAAVQYQDGLQGIFDWVDIAGNKLATMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEEADKHTVQDPLMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEALHLAMNFHNSLQDFINWLTQAEQTLNVASRPSLILDTILFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLADDNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPDD--EDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGR-----AGRKRFPASGFYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITATQPTLAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSASSHACQAASPPVPAAASTPKGTPIQGSKLRLPGYLSGKGFHSGEDSALITTAAARVRTQFAESRKTPSRPGSRAGSKAGSRASSRRGSDAS 7336          

HSP 2 Score: 239.58 bits (610), Expect = 1.156e-61
Identity = 121/247 (48.99%), Postives = 169/247 (68.42%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            L   + ++ R  DERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL W+++A E Y  +  ENF+T W+DGK F A+IHK RPDLID+ +++  S   NLE AF  A+K +GV ++++PEDV     DEKS++TYV+SL++  PK  +  E I
Sbjct:   19 LQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGVRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEK-IGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGI 264          

HSP 3 Score: 98.9821 bits (245), Expect = 2.715e-19
Identity = 91/467 (19.49%), Postives = 205/467 (43.90%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSN 3182
            NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + +    + L++++ +L       +    +   F+ ++   + W+  KE+ ++ + W +  S  ++ K+     L+ ELE +E SI     +   L + NH A   I+   A ++++W WIL L  C++ H++  + Y +FF +A EA + +  L + +  ++       + + E L +E  +  E ++ Y+  V  ++  +++V  L  R      +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + I   ++I++    ++ C   + EL  S+    Q  +V N
Sbjct:  613 NWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMT------APLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNS-SVARKKSYHAELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQENSAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEKEELLQ-YRSVVAGLMGRAKTVVQLKPRNPDNPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQSVLTLWHESHINMKSVVSWHYLVNEIDRIRASNVASIKTMLPGEHQQVLSNLQSRLEDFLEDSQESQIFSGSDISQLEKEVSVCRKYYQELLKSAEREEQEESVYN 1065          

HSP 4 Score: 79.337 bits (194), Expect = 2.555e-13
Identity = 87/430 (20.23%), Postives = 197/430 (45.81%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKS------EVENLAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----DSSIDESI 13646
            + E +   +  LS  + +K  +L +K          ++     Q  +RE    F +   +LD +     D   LR++   ++  L  L++            +  + T E S   I    +L A+++   K+++    R+  +    + + EF  K  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +  +    + +E ++DSV   +  L + V+   + +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L+ R+S+++ + + G  +  + +   + +L  +L  L++++E LL+ AE +N + +    +++ F +  EP   WL   EK LAN +   T  A ++E++I ++K LQ D      S+D+++
Sbjct: 5075 QAETLAEEHSELSQQVDEKCSFLETK----------LQGLGHFQNTIREMFSQFTECDDELDGMAPVGRDAETLRKQKACMQTFLKKLEALMASNDSANRTCKMMLATEETSPDLIGVKRDLEALSKQCNKLLDRAKTREEQVDGATEKLEEFHRKLEEFSTLLQKAEEHEESQGPVGTETETINQQLDVFKVFQKEEIEPLQVKQQDVNWLGQGLIQSAAANTCTQGLEHDLDSVNSRWKTLNKKVAQRTSQLQEALLHCGRFQDALESLLSWMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGT-QAPKLEEQISQHKALQEDILLRKQSVDQAL 5493          

HSP 5 Score: 61.2326 bits (147), Expect = 7.975e-8
Identity = 55/246 (22.36%), Postives = 113/246 (45.93%), Query Frame = 3
Query: 15813 WFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKF-SGGLPDTAKEQLK 16547
            W  +    +    P   E + V  QIQ+ K L+  +E +   +E+I + G ++   + P  + ++   L+ ++  W  LL     R  QL+ I +   EFH  ++   EW+ A E  L N +        LE  ++QHK ++ D+ + + SV +      E++K+           +LE ++  ++++ + +      LE AL+ A       +E+   +D++  ++E+  + + GL   A  Q++
Sbjct: 5338 WMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGTQAPKLEEQISQHKALQEDILLRKQSVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSADVAKTLEHALQLAGQLQSMHKELCNWLDKV--EVELLSYETQGLKGEAASQVQ 5581          
BLAST of Dystonin vs. UniProt/SwissProt
Match: sp|Q03001|DYST_HUMAN (Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4)

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 686/2444 (28.07%), Postives = 1243/2444 (50.86%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVEN------LAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----------DSSIDESIKKLK------IIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETL----KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNS-----VEKLVCQARNDLDKLKSVDAFENSL---------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTP------PLIPIFDRSKRMETNQGISKI-----QEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF--KFKPATLPIPTKKPTTAKIPSPRVSQPLSS--PRIHQPVSSP------RIPQPVTSPRISQNIPSSRVSQSLASPRT-----PKVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            ++E I   +  LS  + +K  +L +K          ++     Q  +RE    F +   +LDS+     D   L+++   I+  L  L++ + +        +  + T E S   +    +L A+++   K+++    R+  +    K + EF SK  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +       + +E ++D V   +  L + V+     +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L  R+S+++ + + G  +    +   K ++  +L  L++++E LLN AE +N + +    +++ F +  EP   WL T EK L N +   T  A ++E++I ++K L++D            SI +S+K L       ++ +K+D  FS+   I+ +             +KSH     L     N      D+V L     +  E   K  KL++ D Y T  +W++      E++  +E +    +N+DQ    G +L + ++ ++   I  K+  +   + +I+  +       E ++ +A R    + +L   L          D +  ++     ++L+ E  S      ++L  +A+N+   L S++   ++L         E +E +  E+ +R++ V + +T+K  +I +   +++  ++  D  +  ++  E+K+  + D   + +   ++L+  K     +L      K+ I+  +    K++      + +S+K  +D+V K  ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++ +  +G +I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++     +  D++KLQ   + L Q G E  +  R    DKD S + ++ KL ++    + + +   E + K+++++ LA +FW D + LI      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + +I  ++       + ++    + +W      +L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +  + K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  TE  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +LE L + W+ + E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +++  ++  +  +S    I+ D+  L +KW++V+     RK++LE+A+     FH  +  FINWLT  E+ LN     S I+ T+L Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D+++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H   +K+L  R   ++ +   A  L+  S +DSS+++ Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR   + P++  E+ +  +I  H  F K L     ++N     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++          IP+ D+ +        S +     Q  +   NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++ +   AKGRTN ELREK     G    MA F  + + +        P  +   S + +Q  S   P    P  +P      R+P  ++         S  ++ + A  RT      K  + PG +  S+  +R +S++GS AS
Sbjct: 5144 QVETIAQEHSTLSQQVDEKCSFLETK----------LQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGT-QASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLD--FSQVWYIEIQ-------------EKSHSRSELLQQALCNAKIFGEDEVELMN---WLNEVHDKLSKLSVQD-YSTEGLWKQQ----SELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWL----------DKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEIL----RHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLEL-SPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIA--RSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLI------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDD--EDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDAS 7513          

HSP 2 Score: 239.58 bits (610), Expect = 7.047e-61
Identity = 120/239 (50.21%), Postives = 166/239 (69.46%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            L   + ++ R  DERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL W+++A E Y  I  ENF+T W+DGK F A+IHK RPDLID+ +++  S   NLE AF  A+K +GV ++++PEDV     DEKS++TYV+SL++  PK
Sbjct:   19 LQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEK-IGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPK 256          

HSP 3 Score: 104.375 bits (259), Expect = 5.352e-20
Identity = 102/525 (19.43%), Postives = 227/525 (43.24%), Query Frame = 3
Query: 1725 PTLSSGVISNRQYTPIHSMELGDNVLYSSL---------------NKWKNWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAV 3209
            P  SSGV  N   T +  M++   +L SSL                   NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + + +  + L++++ +L       +    +   F+ ++   + W+  KE++++ + W +  +  ++ K++    L+ EL+ +E +I     +   L + NH A   I+   A ++++W WIL L  C++ H++    Y +FF +A EA + +  L + +  ++       + + E L +E  +  E +  YK T+  ++  ++++  L  R +    +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + +   ++I +    +N C   + EL  S+    Q  +V N   S V+ +
Sbjct:  565 PNFSSGVEPNSLQT-LKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMT------APLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSE-RNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNI 1075          
BLAST of Dystonin vs. UniProt/SwissProt
Match: sp|D3ZHV2|MACF1_RAT (Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1)

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 664/2407 (27.59%), Postives = 1193/2407 (49.56%), Query Frame = 3
Query: 12522 CKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPEL-------AKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQ----NDDSSIDESIK---KLKIIINKVD-GVFSENVSIDTKNKINKLFDRFSEYQ-KSHYXXXXXXXXXXXXXXXXXDQVNLF------EDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRE-NDSLTGQVGE----RNMEILENETNSVEKLVCQARNDLDKLKSVD------AFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNE---QKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINT---ELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSP------SRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF-PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPLIPIFDRSK---RMETNQGISKIQEPLFV-------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------LPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPV-----TSPRISQNIPSSRVSQSLASPRT-PKVVAS-PGLQRKSRIPTRQTSQQGSQAS 19436
            C+ R E+F ++  +L +++D       D DSL+ QI D+     +   +   + + ++E   + E++       + +   L A+N+   K+ E    RQ  L L    V +F SK          A     L         ++N    +   F +++VDPL+ +L+++  +G     +       + +E +M+ V   ++ L + V+     +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R++++D L   G  +    +   + ++  +L+ L  ++  LL+ A  +  + +  + L+K F +  EP   +L   EK LAN +   T  A ++ ++I  +K L+    N  + + +++K    L  +I   + G+ SE        K++ L  R+SE Q +   +   L     N      D+V +       ED L      +KD + +++          + L L +E+ + +   KN+DQ    G+ L + ++  +   I  K++ +   + +I+V++ K L   E +  +A +F             LT  +RE  + L    G+      +   +     ++K V + R  LD +  V           + E ++ +  +  +++K V + V ++  +I +   +++  E+  D  +  ++  ++K+  +       DQ        +   ID      + +E    +  I ST  + +K +          L+   + + +Q E+ +     +  +L+ A  L  +F  +Y  L  W  ET   + Q     +D +QL + ++E++ L  S  + KP +D I+K G  L ++ N  +GK +    + A+  Y  IK+ ++ RA  L++ +  +    E ++K++     LEN+  R+     P + P ++D+      E + D     + ++KLQ   E           R    DKD +  EI +KL ++    + +++++ E + K +++L LA +FW D+  +       TI  T   + DL +  ++      + +  E ++ E D   +++  I   G  LI       E P+V+++ +E+   +E +  + ++++  ++       + ++    + +W      RL  + P+ T+   V  Q+ + KE K ++  +  ++E +N  G   L K +    ++ +   L  +   W  L + +  RQH+L+  LL+LG+F  A++E + W+  TE  L   +   GD   +E+ LA+H +++ D+   QA+V  + +   E+++   SS G +A+    RLE + + WE + +    +  +L+  L++A  F+ + +E    ++ + S+L   K +GGLP+TA+EQL   M+++     K  I  +   +    +  +     G   E  + +L +KW  V +  E RKS+LE+A+     F   + +FINWLTL E++LN   P S I++T+L Q+E H+    ++ +HR++++ LD+    LK++SQK D+VLI+NL+ S+  RWEKVV RS ER R+LD   K AK+F +  + L+D +      L+ +  I   P KI+ Q++KHKEF   LG     YD+T R G  L++K  +  D++K+D ++  ++ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +      L+  S +D+++++ QL EL + W+ V KL+  K+ RLE+A  QA EF    + L E+ S++E  LR     P++   E + ++I  H  F K +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL W+  AE TL+  +   +   +   K    EH+ F+ +MT KQ D D +    K+K   P   P  ++S+   R   NQ       P+ +       NP+INQL ++W+QVW + L R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF TT++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    M PF     + KP++                 +   +PS   +    +  I    S  + P P      TS     +  SS  S    + R  PK  AS PG +  SR  +R +S++GS AS
Sbjct: 3064 CRVR-EMF-SQLADLDDELDGMGAIGRDTDSLQSQIEDIRLFLNKIQALRLDIEDSEAECRKMLEEEGTLDLLGLKR--ELEALNKQCGKLTERGKARQEQLELTLGRVEDFYSKLKALNDAATAAEEGEALQWIVGTEVDVINQQLADFKMFQKEQVDPLQVKLQQVNGLGQGLIQSAGKTCDVQGLEHDMEEVNTRWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLTDTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQAAELADREKITGQLESLECRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTA-KIHQQIIRHKALEEEIENHAADVQQAVKIGQSLSSLICPAEQGIMSE--------KLDSLQARYSEIQDRCCRKASLLEQALFNARLFGEDEVEVLNWLAEVEDKLSAV--FVKDYRQDVLQKQHA-----DHLALNEEIINRK---KNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQARQLATKF-------HSTYEELTGWLREVEEELAASGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSHALLELVPWRAREGLDKLVSDANEQYKLVSDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFSTCGEEQKAV----------LQEKTECLIQQYEAVSLLNSERYARLERAQVLVNQFWETYEELSPWAEETLALIAQLPPPAVDHEQLRQQQEEMRQLRESIAEHKPHIDKILKIGPQLKEL-NPEEGKMVEEKYQKAENMYAQIKDEVRQRALALDEAVSQSAQIAEFHDKIEPMLETLENLSSRL---RMPPLIPAEVDK----IRECISDNKSATMELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARSEEREIKFLDVLELAEKFWYDMAALL-----TTIKDTQEIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGE-TEKPEVKKSIDEMNNAWENLNRTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIRLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMGWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLE---SSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEEFLLELNRMESQLSASKPTGGLPETAREQLDAHMELHSQLRAKEEIYNQLLDKGRLMLLSRGDSGSGSKTEQSVALLEQKWHVVSSKVEERKSKLEEALSLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLADDAQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE-DQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIESSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDD--TEALQSLIDTHKEFMKKVEEKRVDVNAAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALITEHQSFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKSRSGSRKSLNQPTPP---PMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVISSTGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDAS 5375          

HSP 2 Score: 248.825 bits (634), Expect = 1.052e-63
Identity = 122/239 (51.05%), Postives = 167/239 (69.87%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK 1085
            LDP +R V+RVADERD +QK+TF  W+N HLMK+ K + D++ DLRDG  L++LLEVLS  KL  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  S +S D+S K+ LL W++K    Y  I   NFS+ W DGK F ALIH+ RPDL+D++ +   S ++NLE AF  A++ LGV ++++ EDV     DEKS++TYV+S+++  PK
Sbjct:   62 LDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPK 299          

HSP 3 Score: 101.293 bits (251), Expect = 4.402e-19
Identity = 161/832 (19.35%), Postives = 358/832 (43.03%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLNKIYE---KFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSK----NDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLS------TMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLK-CANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKA-VNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLIL----FVK---NGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKD---VPTNLDQLIS---AVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTKRSRIQNAHDWVSCE 4238
            +W++E    +    + NDL  +   +E      T+  E+  SV E ++      + +M  +FH S       L+T++ +L    S      +S  +F+ K+   + W+  KE++++   W D+ +  +S K+  F  L  ELE ++            L++ NH A   ++   A ++S+ QW+  L  C++ H++  A Y QFF +A + ++ +  L + +  ++       L   E L ++  D  E +   K +V  ++  S+++  L  R    + +  ++VKAIC  ++          + +   L +NS    W+V +        P++C LI   + +A   A  ++  +  +  LW   +L +  + L+S       +D V+ W  E   +  P    ++++ L       + D    A     +  +    +  C   F +L         M ++ N+      A V      ++ L+L++      K +Q  S   +         +  ++ + +  + +LK+    ++ + +    F++   +G S T  L+ +L  M++  + ++  + + + KLK+ +V    + + + ++   E+ L +Q E+ PA        ++ LE+ + T+   + ++KD   V + LD+ IS   AV     ++      D+++ +++   ++ R+  +  Q++ R S V          +     +  WI   +TT + ++  P    +S+ +   + +      EI + + ++D+  K +  +   ++ YE     Y+  +++Q     Q   G  KR R+ ++ D ++ E
Sbjct:  594 SWVEEMQMKLERAEWGNDLPSVELQWETQQHIHTSVEELGSSVKEARLY-----EGKMSQNFHTSYVETLGKLETQYCKLKETSSFRMRHLQSLHKFVSKATAELIWLNGKEEEELACDWSDS-NPNISAKKAYFSELTMELEGKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHIKENAAYFQFFSDARDLESFLRNLQDSIKRKYTCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGRSKTIVQLKPRNPDHVLKSTLSVKAICDYRQ----IEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCLLIPPPNTEAIDVASRVEQSYQKVMALW--HQLHINTKSLISWNYLRKDIDAVQTWNLEKLRSSAPGECHQVMKNLQAHYEDFLQDSHDSALFSVADRLRIEEEVEACKTHFQQL---------MESMENEDKEETLAKVYISELKNIRLRLEECEQRLLKQIQ--SSASSKTDRDARQDVALRIAEQEHVQEDLKHLRSDLDAVSVKCTTFLQQSPSGSSATT-LRSELNLMVEKMDHVYGLSIVCLNKLKTIDVIVRSIQDAELLVKGYEIKL-SQEEAVPAD-------LSALESHRTTLQHWLSDVKDKNSVFSVLDEEISKAKAVAEQLHHRAAEPNLDLERYQEKGSQLQERWHRVIAQLETRQSEVESIQEVLRDYRACHGTLIKWIE--ETTAQQEMMKPGQAEDSRVLSEQLSQQTELFAEIERNQTKLDQCQKLSQQYSTTVKDYELQLMTYKAFVESQ-----QKSPG--KRRRMISSSDAITQE 1384          

HSP 4 Score: 69.3218 bits (168), Expect = 1.673e-9
Identity = 170/892 (19.06%), Postives = 378/892 (42.38%), Query Frame = 3
Query: 15327 DKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNT--RSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEE---LKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTET----RPVLTQIQKTKELKNDIEPKHRDIELINQLGYQL---------------TKGSHPNIKNQVNST---------------LARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEI--IKEDVSSL--GHEATQRLEQLRK-------SWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGL---PDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEI--DMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKY-ISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMN---RTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKI--DEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQ---TLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQF 17810
            D + +  + ++LA++S     LQ Q  E +  +  LL  A  F    + +  K  +   H  N  +   N   + +    + I++L  E++  ++++G +    + L+  + +     D+ Q +E+   LK++F  ++ + +++  +    Q  + +  ++     +W KE    +    P P ET    + +  QI+  K L +D   K   +E IN  G  L               T    P++ + V S                ++ +N  + +L D L +RQ  LQ +L  + E  +     ++W+ + E  L  +           +   + + ++A    ++A ++++E+ + +I  +KE ++ L   +  +Q  E  RK        WE+  E   A+  +LE++      F   + ++   + E   K  M    G L   P+    Q ++   + + F     + E+  E +  I          A ++  D++ + +KW  + +   +R +++++AI     +   +      +    + L+ Q  +S     + +Q+E    ++ D+    +EM     +   L   I +++    ++  + ++    + +   +++R   L       ++F+ M    RT LD+  S      ++  I     +++ Q+ +++EF  NL  H+ +Y+     G  L    P  + KK   +++V  L+  W+ L  K+++R+  L D +  +  Y+  + +L+ W++  + K+S+        ++ VQ   +LL   ++L  +   R  ++E +N+ A  L+  SE D   I D+ A L    + + +    K   LEE   +  EF+  + ++++    ++H+L  F
Sbjct: 2117 DGNSAAVLQDRLAELSQRFHRLQLQQQEKESGLKKLLPQAETF----EQLSSKLQQFVEH-KNRLLASGNQPDQDIAHFSQHIQELTLEMEDQKENLGTL----EHLVTALGSCGFALDLSQHQEKIQNLKKDFTELQKTVQEREKDASNCQEQLDEFRKLIRTFQKWLKETEGNV----P-PAETFVSAKELEKQIEHLKGLLDDWAGKGVLVEEINTKGTALESLIMDITAPDSQAKTGSVLPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNSKYDKLGDALRERQESLQTVLSRMEEVQKEASSVLQWLESKEEVLKGM--------DASLSPTKTETVKAQAESNKAFLAELEQNSPKIQKVKEALAGLLEAYPNSQEAENWRKMQEDLNSRWEKATEVTVARQKQLEESASHLACFQAAESQLRPWLME---KELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLTEAAQGILTGPGDVSPSASQVHKDLQSISQKWVELTDKLNSRSTQIDQAIVKSTQYQDLLQDLSEKVKAVGQRLSGQSAISTQPDAVKQQLEETSEIRSDLGQLDDEMKEAQTLCQELSLLIGEQYLKDELKKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDEKQSQQA---KNCPISAKLERLQSQLQENEEFQKNLNQHSGSYEVIVAEGESLLLSVPPGEEKKTLQNQLV-ELKSHWEDLNKKTVDRQSRLKDCMQKAQKYQWHVEDLVPWIKDCKSKMSE----LQVTLDPVQLESSLLRSKAML-NEAEKRRSLLEILNSAADILINSSEIDEDEIRDEKAGLNQNMDAITEELQAKTGSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIF 2974          
BLAST of Dystonin vs. UniProt/SwissProt
Match: sp|Q91ZU6|DYST_MOUSE (Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2)

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 565/1815 (31.13%), Postives = 968/1815 (53.33%), Query Frame = 3
Query: 14193 LVRENDSLTG----QVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDL-----NTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSK-KIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPL----IPIFDRSKRMETNQGISKIQEPLFV-----------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGD--CECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSP------RIPQPVTSPRISQNIPSSRVSQSLASPRTP-----KVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            L  E   L G    QV ER  E L+NE  S + LV       D L  V +    L      E +E    E+ +R++ V + +T+K  +I +   +++  E+  D  +  ++  ++K+  + D   + +   ++L+  K    ++L      K+ I+  +    K++  +   + +S+K  +D+V K+ ++  +    +  QL+ A  L  +F  +Y  L  WL ET+  + Q     L+ + L + ++E + L     + KP +D + K+G  L ++  + +G  I      A   Y+ IKE +K RA  L++ I  +T+ ++K+DQ    LE I +R+      S   EK+ E++G    +  D++KLQ   + L Q G E  +  R    +KD S   ++ KL ++      + +   E + K+++++ LA +FW D + L+      +TI  T   I DL     +   V  +++  E +R EID  ++++  +   G +LI     P++ P V+++ +EL   ++++  + + ++  ++       + ++    + +W     N+L  + P+ T+   V  QI++ K+ K++   +  ++E +N Q    L K +    K+ V   L  +   W  L + +  RQH+L+  LL+LG+F  A+DE + W+  T+  L+  K   GD  ++E+ LA+H +++ D+   Q++V  + +   ++I+   SS G EA+    +L  L + W+++ E    +  +L+ AL++A  F+G+ +++ + + +    L   K  GGLP+TAKEQL   M++   F       +  +    ++  +  +S    I+ D+  L +KW++VK+    +K++LE+A+     FH  +  FINWLT  E+ LN     S I+ TIL Q++ H+    ++ SHRE+++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV R  ER R+LD   K AK+F +    L++ +  + + L+ +  I   P KI+ Q+ +HKEF  +LG  +  YD+T R G  L++K  + D   K+D ++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  S +DSS++  Q+ EL + W  V  L+  K+ RLE A  QA EF  + ++L E+ +++E  LR     P++  E+ +  +I  H  F K L     +++     G  +L   +P++  +IKH+I II++++ ++L+W++Q    L   L  L  ++ LL+ LL WL  AE TL   +   +   + E K    EH+ F+ +MT KQ D D++    K++   PP     IP+ D+ +      G  +     F            NP++N L SKW+QVW + L RR++L D ++ L+E+    NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C+  +++ Q GD KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV H G        + S+++ +   AKGRTN ELREK     G    MA F     + +P++      + T+A   + + + P        P  +P      R+P  ++         S+ ++ + A  RT      K  + PG +  S+  +R +S++GS AS
Sbjct: 5565 LSYETQGLKGEAASQVQERQKE-LKNEVRSNKALV-------DSLNEVSSALLELVPWRAREGLEKTIAEDNERYRLVSDTITQKVEEIDAAILRSQQFEQAADAELSWITETQKKLMSLGDIRLEQDQTSAQLQVQKAFTMDIL----RHKDIIDELVTSGHKIMTTSSEEEKQSMKKKLDKVLKKYDAVCQINSERHLQLERAQSLVSQFWETYEELWPWLTETQRIISQLPAPALEYETLRRQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPK-EGIYIQEKYVAADTLYSQIKEDVKKRAVVLDEAISQSTQFHDKIDQILESLERIAERLRQPPSISAEVEKIKEQIGENKSVSVDMEKLQPLYETLRQRGEEMIA--RSEGTEKDVSARAVQDKLDQMVFIWGSIHTLVEEREAKLLDVMELAEKFWCDHMSLV------VTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDMVITLGSELIAACGEPDK-PIVKKSIDELNSAWDSLNKAWKDRVDRLEEAMQAAVQYQDGLQGIFDWVDIAGNKLATMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEEADKHTVQDPLMELKLIWDSLDERIVSRQHKLEGALLALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIE---SSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNAHMEVCTAFAIKEETYKSLMLRGQQMLARCPRSAETNIDQDITNLKEKWESVKSKLNEKKTKLEEALHLAMNFHNSLQDFINWLTQAEQTLNVASRPSLILDTILFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLADDNLKLDNMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAE-DQPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRLESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPDD--EDALRTLIEQHKEFMKRLEEKRAELSKATGMGDALLAVCHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQELLETLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTYKRRATDPPSLQSHIPVLDKGR-----AGRKRFPASGFYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITATQPTLAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSASSHACQAASPPVPAAASTPKGTPIQGSKLRLPGYLSGKGFHSGEDSALITTAAARVRTQFAESRKTPSRPGSRAGSKAGSRASSRRGSDAS 7336          

HSP 2 Score: 239.58 bits (610), Expect = 8.089e-61
Identity = 121/247 (48.99%), Postives = 169/247 (68.42%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            L   + ++ R  DERD +QK+TF  WIN HLMK+ K V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LD+L+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL W+++A E Y  +  ENF+T W+DGK F A+IHK RPDLID+ +++  S   NLE AF  A+K +GV ++++PEDV     DEKS++TYV+SL++  PK  +  E I
Sbjct:   19 LQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGVRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEK-IGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGI 264          

HSP 3 Score: 98.9821 bits (245), Expect = 1.899e-18
Identity = 91/467 (19.49%), Postives = 205/467 (43.90%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGL----------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSN 3182
            NW+DE    +    + +DL  +          ++  E+F ++  E K  + E +M         + + +    + L++++ +L       +    +   F+ ++   + W+  KE+ ++ + W +  S  ++ K+     L+ ELE +E SI     +   L + NH A   I+   A ++++W WIL L  C++ H++  + Y +FF +A EA + +  L + +  ++       + + E L +E  +  E ++ Y+  V  ++  +++V  L  R      +  + +KAIC  ++        + + E + L NNS    W+V +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L++ +D ++         + P   Q+++  L       + D + + I   ++I++    ++ C   + EL  S+    Q  +V N
Sbjct:  613 NWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAK--ISEIQMT------APLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEESEVAYDWSERNS-SVARKKSYHAELMRELEQKEESIKAVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIQENSAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEKEELLQ-YRSVVAGLMGRAKTVVQLKPRNPDNPLKTSIPIKAICDYRQ---IEITIYKDDECV-LANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQSVLTLWHESHINMKSVVSWHYLVNEIDRIRASNVASIKTMLPGEHQQVLSNLQSRLEDFLEDSQESQIFSGSDISQLEKEVSVCRKYYQELLKSAEREEQEESVYN 1065          

HSP 4 Score: 79.337 bits (194), Expect = 1.788e-12
Identity = 87/430 (20.23%), Postives = 197/430 (45.81%), Query Frame = 3
Query: 12426 EMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKS------EVENLAEQKIETAEKSMHKID---NLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG-------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQND----DSSIDESI 13646
            + E +   +  LS  + +K  +L +K          ++     Q  +RE    F +   +LD +     D   LR++   ++  L  L++            +  + T E S   I    +L A+++   K+++    R+  +    + + EF  K  +F   + +A    E    +   ++ I         F +++++PL+ + +++  +G     +  +    + +E ++DSV   +  L + V+   + +   L+   +F  +LE+L  ++ +    +  ++ PS E+   K+Q+   +LL   L+ R+S+++ + + G  +  + +   + +L  +L  L++++E LL+ AE +N + +    +++ F +  EP   WL   EK LAN +   T  A ++E++I ++K LQ D      S+D+++
Sbjct: 5075 QAETLAEEHSELSQQVDEKCSFLETK----------LQGLGHFQNTIREMFSQFTECDDELDGMAPVGRDAETLRKQKACMQTFLKKLEALMASNDSANRTCKMMLATEETSPDLIGVKRDLEALSKQCNKLLDRAKTREEQVDGATEKLEEFHRKLEEFSTLLQKAEEHEESQGPVGTETETINQQLDVFKVFQKEEIEPLQVKQQDVNWLGQGLIQSAAANTCTQGLEHDLDSVNSRWKTLNKKVAQRTSQLQEALLHCGRFQDALESLLSWMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGT-QAPKLEEQISQHKALQEDILLRKQSVDQAL 5493          

HSP 5 Score: 61.2326 bits (147), Expect = 5.578e-7
Identity = 55/246 (22.36%), Postives = 113/246 (45.93%), Query Frame = 3
Query: 15813 WFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKF-SGGLPDTAKEQLK 16547
            W  +    +    P   E + V  QIQ+ K L+  +E +   +E+I + G ++   + P  + ++   L+ ++  W  LL     R  QL+ I +   EFH  ++   EW+ A E  L N +        LE  ++QHK ++ D+ + + SV +      E++K+           +LE ++  ++++ + +      LE AL+ A       +E+   +D++  ++E+  + + GL   A  Q++
Sbjct: 5338 WMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLEDRKSTVEVIKREGEKIAASAEPADRVKLTRQLSLLDSRWEALLSRAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGTQAPKLEEQISQHKALQEDILLRKQSVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSADVAKTLEHALQLAGQLQSMHKELCNWLDKV--EVELLSYETQGLKGEAASQVQ 5581          
BLAST of Dystonin vs. UniProt/SwissProt
Match: sp|Q9UPN3|MACF1_HUMAN (Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4)

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 603/2132 (28.28%), Postives = 1071/2132 (50.23%), Query Frame = 3
Query: 13305 QSSLDELNKAGSDLLINT-KEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQN--DD--SSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPY--QTRDIWEESLNLVKEVKSHEETL---KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVREND----SLTGQ--VGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNE---QKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNE---KVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSP------SRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF-PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPI-QDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPLIPIFDRSKRMETNQGISKIQEPLFV--------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------------LPIPTKKPTTAKIPSPRVSQ-PLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRT-PKVVAS-PGLQRKSRIPTRQTSQQGSQAS 19436
            Q  L ++N  G  L+ +  K+     L+++++E+NA++  L      +  +   A+     F+D  EP L WL   E+ +AN    P+ +   ++ +IQE K LQ   DD  +++D        ++    G  +++  +  + KI    +           K     K    +     Q +   + +  F S  +  KL   +P   QT  I ++   +++    +EE +   KN+DQ    G+ L + ++  +   I  K++ +   + +I+V++ K L   E +  +A +F             LT  +RE +    +  GQ   GE+ +   +     ++K V + R  LD +  V      L      E ++ +  +  +++K V + + ++  +I +   +++  E+  D  +  ++  ++K+  +       DQ        +   ID      + +E    +  I  T  + +K +          L+   + + +Q E+ +     +  +L+ A  L  +F  +Y  L  W+ ET   + Q     +D +QL + ++E++ L  S  + KP +D ++K G  L ++ N  +G+ +    + A+  Y  IKE ++ RA  L++ +  +T++ E   K++     LEN+  R+     P + P ++D+      E + D     + ++KLQ   E           R    DKD +  EI +KL ++    + ++++  E + K +++L LA +FW D+  +       TI  T   + DL +  ++      + +  E ++ E D   +++  I   G  LI       E P+V ++ +E+   +E +  + ++++  ++       + ++    + +W      +L  + P+ T+   V  Q+ + KE K ++  +  ++E +N  G   L K +    ++ +   L  +   W  L + +  RQH+L+  LL+LG+F  A++E + W+  TE  L   +   GD   +E+ LA+H +++ D+   QA+V  + +   E+++   SS G +A+    RLE + + WE + +    +  +L+  L++A  F+ + ++    +  + S+L   K +GGLP+TA+EQL   M++Y     K     +   +    +  +     G   E  + +L +KW  V +  E RKS+LE+A+     F   + +FINWLTL E++LN   P S I++T+L Q+E H+    ++ +HR++++ LD+    LK++SQK D+VLI+NL+ S+  RWEKVV RS ER R+LD   K AK+F +  + L+D +      L+ +  I   P KI+ Q++KHKEF   LG     YD+T R G  L++K  + +DS+K+D  +  ++ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +      L+  S +D+++++ QL EL + W+ V KL+  K+ RLE+A  QA  F    + L E+ S++E  LR     P++   E + ++I  H  F K +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL W+  AE TL+  +   +   +   K    EH+ F+ +MT KQ D D +    K+K   P   P  ++S R    + +S+   P           NP+INQL ++W+QVW + L R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF TT++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    M PF     + KP++                   T  P++   P+      P S  ++ +P  +P      TS     +  SS  S    + R  PK  AS PG +  SR  +R +S++GS AS
Sbjct: 5288 QMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELIAN-QKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVD--------MLQAEGGRIAQSAELADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEK-KLANSEPVGTQTAKIQQQ---IIRHKALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQARQLATKF-------QSTYEELTGWLREVEEELATSGGQSPTGEQ-IPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTV----------LQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEETRALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKEL-NPEEGEMVEEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEFHDKIEPMLETLENLSSRL---RMPPLIPAEVDK----IRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALL-----TTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGE-TEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLE---SSAGDDASSLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE-DQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPDD--TEALQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKS-RSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSSGSKLKRP--TPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDAS 7333          

HSP 2 Score: 248.825 bits (634), Expect = 1.167e-63
Identity = 124/247 (50.20%), Postives = 170/247 (68.83%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            LDP +R V+RVADERD +QK+TF  W+N HLMK+ K + D++ DLRDG  L++LLEVLS  KL  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  S +S D+S K+ LL W++K    Y  I   NFS+ W DGK F ALIH+ RPDL+D++ +   S ++NLE AF  A++ LGV ++++ EDV     DEKS++TYV+S+++  PK  +  E I
Sbjct:   62 LDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGI 307          

HSP 3 Score: 106.301 bits (264), Expect = 1.186e-20
Identity = 161/832 (19.35%), Postives = 362/832 (43.51%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLN---KIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKND----LKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLS------TMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANI-DENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVN------DLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKD---VPTNLDQLISAVTTSRQNQKDVSYE---DIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGL--QTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTKRSRIQNAHDWVSCE 4238
            +W++E    +    + NDL  +    +  +   T+  E+  SV E ++      + +M  +FH S  +    L+T++ +L    S      +S  +F+ ++   + W+  KE++++ + W D  S  +S K+  F  L  ELE ++            L++ NH A   ++   A ++S+ QW+  L  C++ H++    Y QFF +A E ++ +  L + +  ++       L   E L ++  D  E +   K +V  ++  S+++  L  R+   + +  ++VKA+C  ++          + +   L +NS    W+V +        P++CFLI   +  A + A  ++  +  +  LW   +L +  + L+S       +DLV+ W  E   +  P    +I++ L       + D + + +    +  +    +  C ARF  L  S     +  TV+    S +K        ++ L+L++      K +Q  S+  +            ++ + +  + +L+     ++      D  L      S    L+ +L  +++  + ++  + +++ KLK+ +V    + + + ++   E+ L +Q E   A        ++ LEA   T+   + ++KD   V + LD+ I+      +    ++ E   D+++ +++   ++ R+  +  Q++ R S + E   + LG   + +A    +I    +TT + ++  P    +S+ +   + +      EI + + ++D+  K +  +  +++ YE     Y+  +++Q     Q   G  KR R+ ++ D ++ E
Sbjct:  594 SWVEEMQMKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLY-----EGKMSQNFHTSYAETLGKLETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNS-NISAKRNYFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGRSKTIVQLKPRSPDHVLKNTISVKAVCDYRQ----IEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALW--HQLHVNTKSLISWNYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEEEVEACKARFQHLMKSMENEDKEETVAKMYISELK--------NIRLRLEEYEQRVVKRIQ--SLASSRTDRDAWQDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHVYGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKL-SQEEVVLAD-------LSALEAHWSTLRHWLSDVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVIAQLEIRQSEL-ESIQEVLG---DYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQTALFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQ-----QKSPG--KRRRMLSSSDAITQE 1384          

HSP 4 Score: 103.219 bits (256), Expect = 9.756e-20
Identity = 266/1427 (18.64%), Postives = 596/1427 (41.77%), Query Frame = 3
Query: 12831 KIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEE---LIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDI----ENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKII------INKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDL--KQISSENDSAA--INCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVR--ENDSLTGQVGERNMEILEN---ETNSVEK-------------LVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCM-EVLSNFEQKINEMS------DQINNDYSELEECKIDFTNL---LSAWNEQKESI--NSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQ----PSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIED---LRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLT-KGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEII---KEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDT--------VKNLAETRKSRLEKAI-ETVETFHLDMGKFINWLTLTEKNLNQ--QRPVSRIVSTILEQVEAHRALKRDIT 16904
            ++ T+F+S   +    + E   +   +   + T + I  F +Q+   LKK++ E   ++D  N+    ++  + ++  E  +D +    +   ++VSD      + +D  + + Q+++ + +    +V    R L A     +E  ++ +QL   +     + + + S+DEL    S++     E +K+ LQ + + L  +YE +  L   +  R +RA  L   F + YE    W++     +A    SP +D  ++ ++ +E + L+   +     I KL  I      +N  +G   E    +   K   ++ +  E  +     L+  +     +  + D++    +TL    S ++   L   +  + R+   ++ +   E++  + + + L + GE+L  +   ++ D AA  I  K++ +  ++++I   A ++   F + + +AE+F      L   +     +V   E+  +   + ++ +E  E    ET+ + +               C      +  KS+D   N+ E +   + E  ++ ++ +               +A +Q ++  Q M + L N   K+  M       + + +  +E++E K++       +   N Q E +   +T    + +IR+ P ++LK L           E+  + +  +Q +L+ A+    +F  +   L  WL  TEE +   +  + DP  +     +   L N     +  ++ + K+G+ L +        ++ + +E   + + ++ +  + R   L+  +      + +++    +L  +  +++ S      P    E+LD  + ++ ++    +     +DK ++ + +   S  + +  + SV +LE+   + S      S+  E K K+   L+LA EF N L   ++  + +T+   +  I    +  +N     IE+      E++ H   I ++ Q G QL + ++   +   ++     ++  +E V     ++  ++D  +    +  E   KL +W ++  + L     +  +   +  Q+ K KE +  +  K    +   + G  L  K   P    ++++ L  + D W  +     +RQH+L+  LL  G+F  A+   ++W+   E  L   +  HGD++ +   +  HK+ + ++     +V  ++R   E+I   ++D + +  +    L++L   W+ + + + +K   LE ALK+A +F   +  +   ++ L    +  +F G LPD   E L+  +D ++ F K      +        +    + I      D    +K W T        V   A+  + RLE A+ E V    L + + + W+   E  L Q  Q P+ + +  +   +  H+    ++T
Sbjct: 5562 QLATKFQSTYEELTGWLREVEEELATSGGQSPTGEQIPQF-QQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREG-LDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTVLQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEETRALIAQL-PSPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGEMVE----EKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAM---------------QAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIRE-PLTELKHL----------WENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDS-GSGSKTEQSVALLEQKWHVVS------SKMEERKSKLEEALNLATEFQNSL---QEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQL-KFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQ----LQELSTRWDTVCKLSVSKQSRLEQALKQAEVF---RDTVHMLLEWLSEAEQTLRFRGALPDDT-EALQSLIDTHKEFMK----KVEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAEL-LEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMT 6931          
BLAST of Dystonin vs. UniProt/SwissProt
Match: sp|Q9QXZ0|MACF1_MOUSE (Microtubule-actin cross-linking factor 1 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 601/2144 (28.03%), Postives = 1075/2144 (50.14%), Query Frame = 3
Query: 13287 DRLKKRQSSLDELNKAGSDLLINTKEPKKSQ-LQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQN--DD--SSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPY--QTRDIWEESLNLVKEVKSHEETL---KNLDQV---GEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERN-----MEILENETNSVEKLVCQARNDLDKLKSVDAFENSL------EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNE---QKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSP------SRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLG-YQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTF-PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT--PPLIPIFDRSK---RMETNQGISKIQEPLFV-------NPKINQLHSKWKQVWFMILNRRKRL---LDHIEYL-KEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------LPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVT-SPRIS-----QNIPSSRVSQSLASPRTPKVVAS-PGLQRKSRIPTRQTSQQGSQAS 19436
            D++   Q  L ++N  G  L+ +  +    Q L++++DE+N ++  L      +  +   A+     F+D  EP L WL   E+ +AN    P+ +   ++ +IQE K LQ   DD  +++D        ++    G  +++  +  + KI    +           K     K    +     Q +   + +  F S   + KL   +P   QT  I ++   +++    +EE +   KN+DQ    G+ L + ++  +   I  K++ +   + +I++++ K L   E +  +A +F             LT  +RE +      G ++     +   +     ++K V + R  LD +  V      L      E ++ +  +  +++K + + V ++  +I +   +++  E+  D  +  ++  ++K+  +       DQ        +   ID      + +E    +  I ST  + +K +          L+   + + +Q E+ +     +  +L+ A  L  +F  +Y  L  W  ET   + Q     +D +QL + ++E++ L  S  + KP +D I+K G  L ++ N  +GK +    + A+  Y  IK+ ++ RA  L++ +  + + ++K++     LEN+  R+     P + P ++D+      E + D     + ++KLQ   E           R    DKD +  EI +KL ++    + +++++ E + K +++L LA +FW D+  +       TI  T   + DL +  ++      + +  E ++ E D   +++  I   G  LI       E P+V+++ +E+   +E +  + ++++  ++       + ++    + +W      +L  + P+ T+   V  Q+ + KE K ++  +  ++E +N  G   L K +    ++ +   L  +   W  L + +  RQH+L+  LL+LG+F  A++E + W+  TE  L   +   GD   +E+ LA+H +++ D+   QA+V+ + +  +E+++   SS G +A+    RLE + + WE + +    +  +L+  L++A  F+ + ++    ++ + ++L   K +GGLP+TA+EQL   M+++     K  I  +   +    +  +     G   E  + +L +KW  V +  E RKS+LE+A+     F   + +FINWLTL E++LN   P S I++T+L Q+E H+    ++  HR++++ LD+    LK++SQK D+VLI+NL+ S+  RWEKVV RS ER R+LD   K AK+F +  + L+D +      L+ +  I   P KI+ Q++KHKEF   LG     YD+T R G  L++K  +  D++K+D ++  ++ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +      L+  S +D+++++ QL EL + W+ V KL+  K+ RLE+A  QA EF    + L E+ S++E  LR     P++   E + ++I  H  F K +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL W+  AE TL+  +   +   +   K    EH+ F+ +MT KQ D D +    K+K+  P   P  ++S+   R   NQ       P+ +       NP+INQL ++W+QVW + L R+++L   LD +E L  E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF TT++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    M PF     + KP++                 +   +PS   +    +  I    S  + P P   S R S      N  S   + + A+   PK  AS PG +  SR  +R +S++GS AS
Sbjct: 5241 DQVDPLQVKLQQVNGLGQGLIQSAGKNCDVQGLEHDMDEINTRWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLTDTEELIAN-QKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVD--------MLQAEGGRIAQSAELADREKITGQLESLERRWTDLLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTAN-KLANSEPVGTQTAKIHQQ---IIRHKALNEEIINRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITLTSSKALRTLEQARQLATKF-------HSTYEELTGWLREAEEELAASGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSHALLELVPWRAREGLDKLVSDANEQYKLISDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFSTCGEEQKAV----------LQEKTECLIQQYEAVSLLNSERYARLERAQVLVNQFWETYEELSPWAEETLALIAQLPPPAVDHEQLRQQQEEMRQLRESIAEHKPHIDKILKIGPQLKEL-NPEEGKMVEEKYQKAENMYAQIKDEVRQRALALDEAVSQSAQFHDKIEPMLETLENLSSRL---RMPPLIPAEVDK----IRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARSEEREIKFLDVLELAEKFWYDMAALL-----TTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGE-TEKPEVKKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVATVNKAGSELLE---SSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELNRMENQLSASKPTGGLPETAREQLDTHMELHSQLRAKEEIYNQLLDKGRLMLLSRGDSGSGSKTEQSVALLEQKWHAVSSKVEERKSKLEEALSLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNDHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLAGDTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE-DQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIEGSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDD--TEALQSLIDTHKEFMKKVEEKRVDVNTAVAMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALITEHQSFMEEMTRKQPDVDRVTKTYKRKSVEPTHAPFMEKSRSGSRKSLNQPTPP---PMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELCPELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVISSSGSKLKRPTPAFHSSRTSLAGDTSNSSSPASTGAKANRADPKKSASRPGSRAGSRAGSRASSRRGSDAS 7299          

HSP 2 Score: 248.44 bits (633), Expect = 1.474e-63
Identity = 123/247 (49.80%), Postives = 170/247 (68.83%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI 1109
            LDP +R V+RVADERD +QK+TF  W+N HLMK+ K + D++ DLRDG  L++LLEVLS  KL  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  S +S D+S K+ LL W++K    Y  +   NFS+ W DGK F ALIH+ RPDL+D++ +   S ++NLE AF  A++ LGV ++++ EDV     DEKS++TYV+S+++  PK  +  E I
Sbjct:   62 LDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVTAGYTGVKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQVQSNRENLEQAFEVAER-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGI 307          

HSP 3 Score: 112.464 bits (280), Expect = 1.970e-22
Identity = 161/837 (19.24%), Postives = 366/837 (43.73%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLN---KIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSK----NDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLS------TMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLK-CANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDL-QLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQ-----VCKHKEFETNLKNYEPQVNDLIL----FVK---NGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKD---VPTNLDQLISAVTTSRQNQKDVSYE---DIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQNQIGGSNQDYFGYTKRSRIQNAHDWVSCE 4238
            +W++E    +    + NDL  +    +  +   T+  E+  SV E ++      + +M  +FH S       L+T++ +L    S      +S  +F+ ++   + W+  KE++++   W D+    +S K+  F  L  ELE ++            L++ NH A   ++   A ++S+ QW+  L  C++ H++  A Y QFF +A + ++ +  L + +  ++       L   E L ++  D  E +   K +V  ++  S+++  L  R    + +  ++VKAIC  ++          + +   L +NS    W+V +        P++CFLI   + +A + A  ++  +  +  LW   +L +  + L+S       +D V+ W+ E   +L P    ++++ L       + D    A     +  +    +  C A F  L         M+++ N+          E+   V + +L ++  +  +  Q L  ++ SP     D    Q     + + +  + +L++    ++ + +    F++   +G S T  L+ +L  M++  + ++  + +++ KLK+ +V    + + + ++   E+ L +Q E+ PA        ++ LE+ + T+   + ++KD   V + LD+ I+      +  +  + E   D+++ +++   ++ R+  +  Q++ R S V          +     +  WI   +TT + ++  P    +S+ +   + +      EI + + ++D+  K +  +  +++ YE     Y+  +++Q     Q   G  KR R+ ++ D ++ E
Sbjct:  594 SWVEEMQMKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLY-----EGKMSQNFHTSYVETLGKLETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNGKEEEELACDWSDSNP-NISAKKTYFSELTMELEGKQDVFRSLQDTAEVLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENAAYFQFFSDARDLESFLRNLQDSIKRKYTCDRSTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGRSKTIVQLKPRNPDHVLKSTLSVKAICDYRQ----IEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCFLIPPPNKEAIEMASRVEQSYQKVMALW--HQLHINTKSLISWNYLRKDLDTVQTWSLEKLRSLAPGECHQVMKNLQAHYEDFLQDSHDSALFSVADRLRIEEEVEACKAHFQHL---------MKSLENED-------KEETLAKVYISELKNIRLLLEECEQRLLKQIQSPASSKTDRDARQDITLRIAEQEHTQEDLQHLRSDLDAISMKCNVFLQQSPSGSSATT-LRSELNLMVEKMDHVYGLSTVYLNKLKTIDVIVRSMQDAELLVKGYEIKL-SQEEAVPAD-------LSALESHRTTLQHWLSDVKDKNSVFSVLDEEITKAKKVAEQLRHPASEPNLDLERYQEKGSQLQERWHRVIAQLETRQSEVESIQEVLRDYRACHGTLIKWI--EETTAQQEMMKPGQAEDSRVLSEQLSQQTELFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQ-----QKSPG--KRRRMISSSDAITQE 1384          

HSP 4 Score: 90.5077 bits (223), Expect = 8.570e-16
Identity = 269/1429 (18.82%), Postives = 599/1429 (41.92%), Query Frame = 3
Query: 12831 KIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEE---LIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENH----VDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFD--TSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSID------TKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDL--KQISSENDSAA--INCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVR--ENDSLTGQVGERNMEILEN---ETNSVEK-------------LVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCM-EVLSNFEQKINEMS------DQINNDYSELEECKIDFTNL---LSAWNEQKESI--NSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDL-DKLQIF---VDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIED---LRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQ-VNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEII---KEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDT--------VKNLAETRKSRLEKAI-ETVETFHLDMGKFINWLTLTEKNLNQ--QRPVSRIVSTILEQVEAHRALKRDIT 16904
            ++ T+F S   +    + EA  +   +   + T + I  F +Q+   LKK++ E   ++D  N+    ++  + ++  E  +D +    +   +++SD        +D  + + Q+++ + +    +V    R L A     +E  ++ +QL   +     + + + S+DEL     ++     E +K+ LQ + + L  +YE +  L   +  R +RA  L   F + YE    W   AE+ LA       P VD  ++ ++ +E + L+       ESI + K  I+K+  +  +   ++       + K  K  + +++ +    ++   L +  +    + D++    +TL    S ++   L   +  + R+   ++ +   E++  + + + L + GE+L  +   ++ D AA  I  K++ +  ++++I   + ++   F + + +AE+F      L   +     +V   E+  +   + ++ +E  E    ET+ + +               C      +  KS+D   N+ E +   + E  ++ ++ +               +A +Q ++  Q M + L N   K+  M       + + +  +E++E K++       +   N Q E +   +T    + +IR+ P ++LK L           E+  + +  +Q +L+ A+    +F  +   L  WL  TEE +   +  + DP  +     +   L N     +  +  + K+G  L +        ++ + +E   + + ++ +  + R   L+  +      + +++    +L  + ++++ S      PE   E+L    E+   L  K +I+   +DK ++ + +   S  + +  + SV +LE+          + S+  E K K+   LSLA EF N L   ++  + +T+   +  I    +  +N     IE+      E++ H   I ++ Q G QL + ++   +   ++     ++  +E V     ++  ++D  +    +  E   KL +W ++  + L     +  +   +  Q+ K KE +  +  K    +   + G  L + +      Q +++ L  + D W  +     +RQH+L+  LL  G+F  A+   ++W+   E  L   +  HGD++ +   +  HK+ + ++     +V  ++R   E+I   ++D + +  +    L++L   W+ + + + +K   LE ALK+A  F   +  +   ++ L    +  +F G LPD   E L+  +D ++ F K      +        +    ++I      D    +K W T        V   A+  + RLE A+ E V    L + + + W+   E  L Q  Q P+ + +  +   +  H++   ++T
Sbjct: 5521 QLATKFHSTYEELTGWLREAEEELAASGGQSPTGEQIPQF-QQRQKELKKEVMEHRLVLDTVNEVSHALLELVPWRAREG-LDKLVSDANEQYKLISDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFSTCGEEQKAVLQEKTECLIQQYEAVSLLNSERYARLERAQVLVNQFWETYEELSPW---AEETLALIAQLPPPAVDHEQLRQQQEEMRQLR-------ESIAEHKPHIDKILKIGPQLKELNPEEGKMVEEKYQKAENMYAQIKDEVRQRALALDEAVSQSAQFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARSEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVKKSIDEMNNAWENLNKTWKERLEKLEDAM---------------QAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIRE-PLTELKHL----------WENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVATVNKAGSELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELNRMENQLSASKPTGGLPETAREQLDTHMELHSQLRAKEEIYNQLLDKGRLMLLSRGDS-GSGSKTEQSVALLEQ------KWHAVSSKVEERKSKLEEALSLATEFQNSL---QEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNDHRDQIIELDQTGNQL-KFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLAGDTQKLDNLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIEGSRDDTTWVKGQ----LQELSTRWDTVCKLSVSKQSRLEQALKQAEEF---RDTVHMLLEWLSEAEQTLRFRGALPDDT-EALQSLIDTHKEFMK----KVEEKRVDVNTAVAMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAEL-LEELLAWIQWAETTLIQRDQEPIPQNIDRVKALITEHQSFMEEMT 6887          

HSP 5 Score: 70.8626 bits (172), Expect = 6.768e-10
Identity = 92/480 (19.17%), Postives = 210/480 (43.75%), Query Frame = 3
Query: 12312 IKTTQSDMHLIKPDMENTKLLIASIAQISP--VNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINE---KIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAK--------------LLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQ----NDDSSIDESIKKLKIIINKVDG 13682
            +K  Q  +  ++P ++  +     + + +P   +A+ L  + E     +  +   ++   + + +K + + +   R+    ++  +L +++D       D DSL+ QI D+     +   +   + + ++E   + E++       + +   L A+N+   K+ E    RQ  L L    V        DF RK+   N+    A+              ++N    +   F + +VDPL+ +L+++  +G     +       + +E +MD +   ++ L + V+     +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R++++D L   G  +  + +   + ++  +L+ L  ++ +LL+ A  +  + +  + L+K F +  EP   +L      LAN +   T  A ++ ++I  +K L     N   ++D++IK  + ++ +  G
Sbjct: 5016 LKAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASPLVHQAEVAQQEFLEVKQRVSSSCLTMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIQALRFDIEDSEAECRKMLEEEGTLDLLGLKR--ELEALNKQCGKLTERGKVRQEQLELTLGRV-------EDFYRKLKALNDAATAAEEGEALQWIVGTEVDVINQQLADFKLFQKDQVDPLQVKLQQVNGLGQGLIQSAGKNCDVQGLEHDMDEINTRWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLTDTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLESLERRWTDLLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTANKLANSEPVGTQTA-KIHQQIIRHKALNEEIINRKKNVDQAIKNGQALLKQTTG 5485          

HSP 6 Score: 56.9954 bits (136), Expect = 8.954e-6
Identity = 135/780 (17.31%), Postives = 317/780 (40.64%), Query Frame = 3
Query: 15207 LDEELGVFDEILYDLDKLQ-------IFVDKLQ---IGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYK---EKIMNLLSLANEFWNDLKLIEDKFHEMT----IHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILV----KKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYI---SQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKL 17474
            LD+EL     I  D D LQ       +F++K+Q     IE+     +   +++ ++++L    ++ + NK     T   K   E++   L    +F+  LK + D          +     T  D+  + + D K   +D   ++D  +  + +++  G+ LI+      +   +E   +E+   +  +     Q+I  +        K ++    L  W  +    +    P   E + V  QIQ+ K L+  ++ +   ++++   G ++ + +    + ++   L  +   W  LL     RQ QL+ IL+   +FH   +   +++  T N L N +        +   + +HK +  ++   + +V +  +    ++K+          ++L+ ++  + ++   +      LE A + A  F+   +E++  + E   +L     SGG   T  EQ+ +F    +   K  ++    ++   E+S    + +       ++ LV    +++  + +    R   ++ AI+  + +       + W+  T++ L    P+         Q++  +A   DI  H++ M   D++ +H   I     +    +++     +  ++E V   +SER   L+       +F +    L       L ++ +         ++R+Q  + ++   ++  H    D   ++G QL++  P ++ K ++E     +  +  + ++  +R  AL++A+  S  + D +  +L  L  +  +L
Sbjct: 5102 LDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIQALRFDIEDSEAECRKMLEEEGTLDLLGLKRELEALNKQCGKLTERGKVRQEQLELTLGRVEDFYRKLKALNDAATAAEEGEALQWIVGTEVDVINQQLADFKLFQKD---QVDPLQVKLQQVNGLGQGLIQSAGKNCDVQGLEHDMDEINTRWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLTDTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLESLERRWTDLLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTANKLANSEPVGTQTAKIHQQIIRHKALNEEIINRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITLTSSKALRTLEQARQLATKFHSTYEELTGWLREAEEELAA---SGGQSPTG-EQIPQFQQRQKELKKEVMEHRLVLDTVNEVSHALLELVPWRAREGLDKLVSDANEQYKLISDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSM---DELFSHRGEIFSTCGEEQKAVLQEKTECLIQQYEAVSLLNSERYARLERAQVLVNQFWETYEELSPWAEETLALIAQLPPPAVDHEQLRQQQEEMRQLRESIAEHKPHIDKILKIGPQLKELNP-EEGKMVEEKYQKAENMYAQIKDEVRQRALALDEAVSQSAQFHDKIEPMLETLENLSSRL 5870          
BLAST of Dystonin vs. TrEMBL
Match: A0A1E1XFA6 (Putative ca2+-binding actin-bundling protein (Fragment) OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 842/3341 (25.20%), Postives = 1588/3341 (47.53%), Query Frame = 3
Query: 9471 EIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYE----------MKQRDM-----EQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAAL---LNKC-------LSFDQEY---------KEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSM----SPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEE-------IQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLS-LEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLEC-TGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNA--TLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQK-IETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYG---FESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKL----DLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETE-ENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQIT-NIDRQQSLITKLEEMR------MKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWL-RAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALM-IQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEI--ITNSKKKTP-----------PLIPIFDRSKRMETNQGISKIQ---------EPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETY-----QVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKK 19184
            E  QR ++    SL  + ++EQ    + + +EI  ++P ++   +N+++R+ P    L  K++ KL   +N   K+ D     G     V SC D             F  + N +F+E L  + +  E          M QR++     E   +  + L ++ +  D   +   ++ LE+ W  L EL++ R ++   R      Y  L+ +++  L   E  L    PLA+D   L  Q  +I+  + E       ++   ++G  YD++            ++ S  R P++     + +P +  + T                        D   + Q+ SE       +  RY  +G +L +R+ +  +L   L  C       ++F +           +E +D+  S+L EL   E++   L                    +        +LLR R   PG   L+++LD L  ++  L+ + +  L L       +K+F +    + N +V+K++M  VLGP+ T      AQ QQV  + DE+   E  ++ L   GQE++  +     PT      + E LD + +    +   L++RE  + +  G S +F   +  + D L  + +  ++    +  + D E        ++  L++ +  L E+E  ++ L E +SD  +  E++ ++ +  +    +  KI++    +      +    +  +  ++WL  +  QL+LL  L++      L   + + +     +  K+ +V  + ++   M    S   +++Q+  +L  L    + +  +  +     Q+A  +  K N   NK   W+   + +++       +  + E +  E  T K+  ++H Q  D    +    +             +  + S  + L     E+   L ++  ++    E    L   L +LE K   +    E+A + P  + +L+   +        ++  ++  +    +    +P +   + +  +++ +V R+Q L++ L  +   L +    + +  ++++        L E++++    + D+ ++  QI  + + +   +     + N + E + L  Q   + A+ +  ++++L     ++ E    R  SL      + +F    +   R++  A  +     P  A +  L +  +    F +  V+PL ++++ +   GN    +   G+    +E+++D +   +++L + V + E  ++  L++  KF  +L  +  ++E+    +  +  PS +Y   K+QL   + L   L  RQ S+  L   GS+++ +     KS +Q +L +L+ +++ L   A+ +    +R + +++SF++   P + WL+  E+ L    T PT DA  + +R QE++ L  D      + + L     ++  +  ++ +    + + +L DR   Y +   +   L                 FED L      ES +   ++  V   + ++ ++E   L +EV  H++ +  L   G++L + +S ND+  +  +++ L   + +++  A ++L     ++P+A+ F  A+ +L    D     L AL  E  +LT Q  E  M+ LE E   + + V +  N L       +       VE +     +RF  +  ++ ++A ++  +R ++     +L+  ++     E+++ + +  I  +   L     +   L    + QK  +   ++ +KK+ R+ P  D  +++   + ++  S    +A   +   L++A+PLA+  + +++ L  WL E E E           P  + + ++  +AL  +  + KPLLD + K+G  L+++        +   +    +RYN +++ ++ +   LE+ +   ++  +K+D   + L +  D++ ++   S HPE++ E++     ++ DL K    ++ +Q          K   D++ SV +I +KL +++   + +Q         + + L++A  FW +L  +     ++  +L +     +  ++++ +++++ +++ E+D    ++ +  Q G+ L++    P+          E+KR+ E + S+ E   T    R+Q+LI  L++          L E+      +   LGP+  +   V  QI + ++ K +++P   ++E +N+   +L++ +       +   L  IN  W  LL GL +RQ +L+  LL LG+F  A+ E + W+  TE +L   +   GD   +E+ LA+HK++  D+   Q+SV  + R   ++I+ D  S     TQ +L  L + W+ L++ A  +  +LE AL+EA  F  + Q++   + ++  +L   K  GGLP+TA+EQL RFM++Y        ++E  +++  E ++ +  S G  ++  +  L ++WD V   A  RK +LE A++    FH  + +F+ WLT  EK+L   RPVSRI+  +L Q+E H++ ++D+ +HRE ML LDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R LD+GYKEAK F D    L   +    + L+     G  P KIR  + +H+EF   LG     YD+  R G  LR++ P  D   +  +   L+ KW +LCNKS++R++ L +ALL SG +KDA+  L+ WL RA+    +D  +   GD++TV  L+ +H   + +L+ R   +E +   A  L+   S +D++ I  Q++ L+S W +V+KL++ K+R+LEEA  QA +  +  + L E+ S +E +LR     P  E E      +  H  F + +   E           EIL   +P+A   I+H++ II+S+W ++  W+ QR   L +HL  L +   LL++LL WL AAE +L+  E++ L   +   +    +H RF+ DM+ +Q D D I     SK++ P           P     DR      +Q   +           EP   +P+  +L  KW+ VW + + R++RLL+H++YL+E+E++KNF+F++WRRR++ WMN+ KSRVMD FR+ D D+DG+VT+++FIDGI+         SKF T+R+EME VADIFD+   G+ID+++++  LRPDR+       Q KP  E E I DEV++Q++KCTC + +K+ Q G+GKY+FG+++KLRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELRE+    +G   +M PFK K  +   P  K
Sbjct: 1593 EATQRGQSAKLASLVRERLDEQIHEHRVLRSEIDGQRPAIDA--LNSSARDLPGNARLAKKVEAKLKDINNRFEKILDKSTRRGELLDEVSSCLD------------QFNSMAN-RFEEWLASVLQAVEGEEQPRLEHAMNQRNLRKDEFEDLLRAGRALCAKRDVTDTGPVRDKVKQLEQQWKELGELLSERERQGRQRSEQGAAYETLRQQVLSWLQTTEGRLEALGPLALDRDILRRQAAEIKPLVKEHAEYASTMDRVNELGRSYDAL------------RVDSRSRPPARKGGSPHKEPYANGASTH-----------------------DLSPVQQQLSE-------MNHRYHLLGVRLSDRQQEADSLSEELRTCTEAIRTLVTFLKSRSVPRDLPSSRELADQQLSQLREL-QTELQERQLE-------------------VDRARLQAHELLRRRPQAPGADALQTQLDELLSRWQGLQGALRSRLLL----IQLLKEFQDTHDLLNNWLVQKDKMFQVLGPIATEPRLVAAQTQQVLCMRDELTSQEPLLRRLTTCGQELLNQLDDKDGPTGRR---LREQLDSIRRHWAEMVSRLEERERALGAATGASAEFQAALARLLDSLQGVGDDFER----LSEAGDCEAQLRHLAALEERLEAQRPPLAEAEARAENLCELLSDAASRSEVRARLGSAQKLYNGLSRKINNRKAELESSLKEDRGFFSNCDSIQEWL--RSIQLSLLPDLKISADTDILHKQVTEFEPAYKSLLDKEHEVHLVLSKGADMVTRMSRKQEAQQLRTRLDGLRRSWDQLRKEATDRHTRLQRAFENCKKFNATFNKFGPWLQSAEGRLSSLVLTNYQRTEVERQAKELQTFKNDLSRHSQEYDTVRNLGETFLAGCDVDKEGVKKDLDTLRSRWEKLNQSVSERSRQLDEVTGKLCEFQEKAGELGHGLQRLEDKLASHDALGEAA-RNPRLLDRLQGMAREADE----LRRGLDRLRAFTDTWLASAPADCDTSHVRGQLDALVRRHQQLANDLQDRCGQLEAAGTVVAQYHAKVKTAQQDLSGLEEELESMGPIARDIKTVRTQIDQVKSFQGRLSSAAHEVDNAEHECQELISQGYTQDAKGARSQVESLRRQLSRLEERARGRHTSLEAMLAKLEKFYEDLHSTQRRVGSALGEEHTFRPVAADVESLRSQQEQFKQFRKNHVEPLGREVDGVNRAGNALIQSASPGVNTTVLERDIDKLNDEWNQLKEKVGERERLLEGALLQSGKFQEALAGVARWLEDTEELVANQRPPSADYKVLKAQLQEQKFLNKLLLDRQGSMGSLQAMGSEVMRHLSPADKSHVQAQLHDLSQRFDRLTRGAQERTAALERTLPVARSFQEQLSPLVEWLEQTERRLTAMSTLPT-DADRLAQRAQEHRDLHRDVLGHKRAFEALTETAQQLMSLVGDDEAQAVVDSLQELTDR---YARLVGDSERLEQLLAEARAGAGAFALAFEDLLVWIGEMESRLARYQVLSVYVEKLQEQFDELNELSEEVSDHQKQVDELSVSGQELMRHASGNDAIQLKDRLDSLQLRYSDLAQRASERLRQAREALPVAQSFHSAHERLIRWMDDAETQLRAL--EAAALTAQ--ESTMQRLEQELQEM-RGVLEVVNHLGPQLCQRSPGEGAGVVESMVSRANRRFDAICEQIQRRAERLELSRQRSLEVTGDLEDLLDWFHEVERQLAD-AQPIVAEPDTLATMLREQKALSEEVSSQKGRVRDVLSAAKKVAREWPAEDQAAVRDRAEELRALSIRVAEACAERLAALEQALPLAEHLLEAHSELVAWLDEAESEAERLAAPAAPHPAHIQRQQERNRALLQALAEHKPLLDRLNKAGTALAKLCRPPDAHKVQRLLSSDNERYNALRKLLRDQQNLLEEAMQSTSQFADKLDGMLSALASTADQLNNAEPISAHPERIQEQISDNQAVVSDLGKKSPALEAVQKAAREVIA--KAGGDQEPSVRDIRQKLERLNGLWEAVQQAARTRGHSLESALAVAERFWEELNAVMRALRDLQENLDSQEPPAVEPQAIHQQQEVLHEIKQEMDQTRPEVDQCRQAGQDLMQLCGEPDRP--------EVKRHIEDLDSAWENVTTLYAKREQNLIDALDKAMGFHDTLQSLLEFLDTAEQKYANLGPVAADIDAVKAQIGQLRDFKREVDPHMVEVESLNRQAKELSEQTSSEQARALRQPLDEINRRWTALLRGLVERQRELENALLRLGQFQHALGELLVWMARTERALDECRPVAGDAQVIEVELAKHKVLMNDIQAHQSSVDTLNRAGHQLIEADRHSEDASVTQTKLADLNRRWKALQDKAAQRQQQLEAALREAQAFNQEIQDLLMWLSDIDGQLASSKPVGGLPETAREQLNRFMELYNELDSNRHRVESVLQQGQEYTRAAEGSTG--LQHSLRTLKQRWDNVLTRANDRKIKLEIALKEATEFHESLQEFVEWLTHAEKSLAGLRPVSRILENVLSQIEEHKSFQKDVGAHRETMLQLDKKGTHLKYFSQKQDVILIKNLLISVQHRWERVVSKAAERTRALDHGYKEAKEFHDAWMELDRWLTEADQSLDEQPPAGNDPEKIRRLLARHREFQRALGAKQPAYDACLRQGRLLRERCPKPDQPVLQRMSDELKAKWNALCNKSVDRQRKLEEALLFSGQFKDAVQALIDWLDRALTSLQAD--QLLHGDLDTVNNLVEQHRSFQTELKSRSANLESVQRTASELLKTASADDAASIRTQMSALESKWESVSKLSDSKQRKLEEALRQAEQLHKAVHMLLEWLSDAEMKLR--FAGPLPEDEATTRQQMEEHQQFMREMEQQEHNKESTIALAQEILSRCHPDAVTVIRHWVTIIQSRWEEVSLWARQREQKLAEHLRSLRDVLELLEELLRWLLAAEASLMTLEAQPLPNEVPATERLLEDHRRFMDDMSQRQADVDRISKAFASKRQPPAGSAAAGTKDRPSQQRHDRRTPHAASQSTPRTSTPTRGHAAAEPEIRHPRARELLDKWQHVWLLAMERQRRLLEHLKYLQELESIKNFDFDEWRRRFLGWMNNKKSRVMDLFRKIDKDNDGKVTKEDFIDGILK--------SKFPTSRLEMERVADIFDRNGDGYIDHKEYIDPLRPDRDCLVHGAKQNKPLTEAEKIQDEVQRQVAKCTCVHRFKVFQVGEGKYRFGESQKLRLVRILRSTVMVRVGGGWVALDEFLVKNDPCR----------------------AKGRTNLELREQFILAEGVSQSMTPFKPKAFSRAGPITK 4782          

HSP 2 Score: 467.233 bits (1201), Expect = 3.583e-127
Identity = 344/1280 (26.88%), Postives = 645/1280 (50.39%), Query Frame = 3
Query:  354 INLLQLDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEED----IEEKIYQFRNQYADLYANLNSALEELNDDFDHNDF--------RIDFNQTRLENNYLTYLKQYESFCHLF--DDISKVDRNNENQRKFHTISTL--------WSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGY-PADQHYRIIININGKIDKVKKKFEK--LSPPTLSSGVISNRQYTP----IHSMELGDNVLY-SSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMD----FHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQE----LSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAV--TTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEI 4073
            +++LQLDP DR VLR+ADERDA+QK+TF  W+N HL+K NKRV D+F DL+DG  LL+LLEVLS + L  +    RFH L+N+ T L+FLR + +KLVNI AED+VDGNPKLTLGL+W IIL FQ  DI  +  ++ L+ K+ LL+W+++  + YP + + +F++SW+DG AF A+IH+ RPDL+D +S    + ++NL++AF+ A++ELGV ++++PEDV +   DEKS++TY++SL+++ P+        E++  +   +Y +L ++L+S L +         F        ++     R     +   +Q +   H    D++  + R    +++ H  + L        W +  T   ++   L +E+ +++R ++++  +  +  +  N+++++E +I +    + +    +       + ++L   E+ +  +   VQ L    Y  A + ++++  ++ +   ++  +++  L+P T     +  R+ T     I    L +   Y   L    +W+ EK   +   ++  ++  +    E+       I        M +  +  ++   +    + +    L+  ++EL +  +K  +D  + LEF   +   + W+  ++  ++   W  + ++ L E ++    L  E+E RE++ N T+  G++L    H AA  I+  L+ L+++W W+L L   L+ HL   A Y QFF EA E +  +     +LN+ F RP    L+EGE L ++++++ E +  Y   VN ++  S+ V  L  R   +   + + V A+CS  +           GE   L +N+  D W+V NS+      P +CF+I   +P+A + A +L   +  +  LWTK++ +LR  ++ +T+ +VK W  + F  +EP  R+ I+  LN+DA +L+ +    +  + ++ +    +  CN  F +L    +  ++         SP +            +  DL +   K LQE    L+ ++ +P+  DVD L+  V +HKEFE  L++ EPQV ++ +  K    +T   + + + ++ LW+++WN +H++V +LK+ E+    L E    +  +E  L  Q  S P   + ++    Q       +   +   +     L + +++V   T R      S+ D++KL+ +L+ V  R++   NQ+ +RL      S      +N++   + W       V +      +V   + + +  ++      EI +    I+EI
Sbjct:    2 LSILQLDPADRAVLRIADERDAIQKKTFTKWVNKHLIKANKRVDDLFVDLQDGHGLLSLLEVLSGETLPREKGRMRFHMLQNVQTALNFLRYRKVKLVNIRAEDIVDGNPKLTLGLIWTIILHFQISDITFTQNNESLTAKEALLRWAQRTTDRYPGVKVRDFTSSWRDGLAFNAIIHRNRPDLVDFRSCRTRTVRENLDVAFSVAERELGVTRLLDPEDVDTPQPDEKSLITYISSLYDVFPEPASHHPFAEDEKLRKAEEYRELSSSLHSWLRQSTTTLQSRSFPPTLSEVKQLQTENVRFRQEEVPPRQQDKQRLHKLWRDEVHSLVR----EQRLHVDADLTPDNLEASWQRMLTAHADRDRALRDEAARLERLQRLAEKVHRDAKSCDNRLDDVERRIAEEEPRLGRLHPADAKRVCDQVERDLRHIEDALKALFRDVQLLFDGRYHRASELHKLVQKLHERWSNLRLAYQQRLLAPLTSKQYKLEERKVTKQRQVISESRLVETHEYLKFLQSCLDWVQEKLRQLEAADWGCEVPAVQVALERHQADHRLIDQFQKNVDMCISRQGHFEEGSEERAQYQKQLAQLERAYSELLVLSNKRLSDLDALLEFAQSAATELRWLSERQQPEVMRDW-SSPTLNLVELEQHQGTLTAEVEARESAFNATLDQGSSLVRQQHPAARAIEAQLSALQAQWAWLLELLRALEAHLRHAAHYHQFFKEARECEQWLQRGEERLNTTFSRP-SFSLEEGERLLQQMQELREDLARYAGIVNALLERSRQVLPLKQRRAPL--PRPLRVTAVCSYSQ----LNMTVARGEQCWLHDNTQRDRWKVANSKGHEGQVPGVCFMIPPPNPEAIELAESLKRKYDLVVKLWTKKQHKLRLNMIFATIKIVKAWDLKTFRAMEPSQRESIIRALNEDAEKLLAE---GDPTDPDMRRLREEIRLCNKLFEDL----LAKLREEEAEKSPESPSR------------RFADLSARLEKQLQEKERTLNARVQAPIPRDVDSLDALVVQHKEFEEGLQDLEPQVAEMRVAFKQMTKKTPTTQDRHDGVVRLWDRIWNLSHLYVERLKAVEIANHGLSEATTFVSSVEEQLAAQG-SMPEEQNALR----QTHEDLVALQLELQQQQPQLDRLAEDVASVRKVTERSRPSAYSHPDVRKLEDDLRKVVRRWDNAANQLAERLRSCEAASELLRAYRNKMDEERHWASQATVRVNAVKTARPSVDRQQALAAAQERCKTCDDEITELSSWIEEI 1245          
BLAST of Dystonin vs. TrEMBL
Match: A0A4D5RZX0 (Putative microtubule-actin cross-linking factor 1-like isoform x6 (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 670/2320 (28.88%), Postives = 1226/2320 (52.84%), Query Frame = 3
Query: 12384 IAQISP-VNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQK-IETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYG---FESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVR--ENDSLTGQVGERNMEILENETNSVEKLVCQARNDLD-KLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALM-IQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQ--QFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEI-----------------------ITNSKKKTPPLIPIFDRSKRMETNQGISKI------------QEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRE-----TYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPAT 19163
            +A  SP  + T +  E++ +  R+Q L+S L  +   L S    + +  ++++       +L E+++N      D+ ++  QI ++ N + + +  E  + + + E ++L      + A+ +  ++D L     ++ E    R  +L      + +F     D  R + EA N+     P  A +  + +  +    F +  V+PL K+++E+  +GN    +   G+    +E+++D +   ++ L + +S+ E  +D+ L++  KF  +L  +++++++    +  ++ PS +Y   K+QL   + L   L  RQSS+  L   G++++ N    +K+ +Q++L +L+ ++E L   A+ +    +R + ++K+F++   P + WL+  E+ LA   T PT D   +  R+Q+++ L  D      S ++L  I   + G+  ++ +      + ++ DR++   +      +LL +       ++  VN FED L      ES +   ++  V   + ++ +EE   L  E+  H++ + +L   G+DL + +S +D+  +  +++ LH  + +++  A ++L   + ++P+A  F  ++ ++ + +    A ++  E+ +LT Q  E  ++ LE E   V + V +  N L  +L  +   E ++  VE +     +RF  V  ++ ++A +I  ++ ++     ++D  ++   + E+++   ++ I  +   L     +   L    + QK  +   +  +KKL R++P  D   ++   + +K    S T A   +   L++A+PLA+ F+ ++  L  WL E E    +    +L   Q+ + +    AL  +  ++KPLLD + K+G  L ++ +  +GK +   I    +RYN ++  ++ +   LE+ +   ++  +K+D   N L +  D++ ++   S HPEK+ E++     ++ DL K    ++ ++          K   D++ +V  L+ KL +++   +G+Q       + +   L+ A  FW +L  +     ++  +L +     +  ++++ +++++ ++R E++  + ++ +  Q G+ L++    P++ P+V++  E+L   +E V S   ++  N+        +  +    L E+      +   LGP+ ++   V +QI + ++ K +++P   ++E +N+   +L + +  N    +   +  IN  W  LL GL  RQ +L+  LL LG+F  A++E + WI  TE +L + +   GD   +E+ LA+HK++  D+   Q SV  + R   ++I+ D  S    ATQ +L  L + W+ L++ A  +  +LE ALKEA  F  + Q++   + ++  +L   K  GGLP+TA+EQL RFM++Y        ++E  +++  E +K +  +   A++  +  L ++WD V N A  RK +LE A++    FH  + +F+ WLT +EK L   +PVSRI+  +L Q+E H+  ++D+ +HRE MLNLDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R+LD+GYKEAK F D    L   +A     L+   + G  P KIR  + +HKEF   LG     YD+  R G  L+++ P  D   +  ++ +L+ +W ++CNKS++R++ L +ALL SG +KDA+  L+ WL      L +  +   GD++TV  L+ +H   + +L+ R   +E +   A  L+   S ED+S I  Q++ L+S W+ V+KL   K+ RL+EA  QA +  +  + L E+ S +E +LR F   P  E E      I+ H  F +   M+E ++N  +      EIL   +P+A   I+H++ II+S+W ++  W+ QR   L+DHL  L +   LL++L+ WL  AE TL A E++ L   +   +   ++H+ F+ DM+ +Q D D +                          ++++  PL        R  T  G S+              EP   +P+  +L  KW+ VW + L R++RLL+ ++YL+E+E++KNF+F++WRRR++ WMN+ KSRVMD FR+ D D+DG+VT+++FIDGI+         SKF T+R+EME VADIFD+   G+ID+++++  LRPDR+       Q KP  E E I DEV++Q++KCTC + +K+ Q G+GKY+FG+++KLRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELRE+     G   +M PFK K A+
Sbjct: 3799 VASASPDSDTTHIRKEVDDLTRRHQQLTSKLEDRCAQLESASSVVAQYNNKVKTAHQDLTSLEEELENMGAIGRDIRTVNGQIDEVKNFKVKLSTTEDEIQDAERECKDLINHGYTQDAKGARTQLDTLKRQLNRLQERTKGRSLALDQMLAKLEKFYQDLGDIQRSLSEATNEERAFRPVAADVDTIRSQQEEFKHFRKSCVEPLGKEIDEISRVGNGLIQSASPGVNTAILERDVDKLNDEWNLLKEKMSERERKLDVALLQSGKFQEALAGVEKWLQDTEEMVANQKPPSSDYKVVKAQLQEQKFLNKLLLDRQSSMTSLMTMGNEVMRNLAPSEKAHIQSQLQDLSQRFERLNRGAQERMSALERTLPVAKAFQEKMCPLVEWLEQTERRLATMGTIPT-DQDRIAHRVQDHRDLHRDILGHKHSFEELTEIAQTLMGLVGDDEAQAVVESMQEVTDRYARLVEDSERLQQLLAEARAGANAFV--VN-FEDLLVWIGEMESRLSRYQVLSVYVEKLQEQFEELSELSDEIADHQKQVDDLTGSGQDLMRHASGDDAIQLKERLDALHVRYTDLTQRASERLRQAQEALPVARNFHSSHERVVVWIDDAEAALKSVESSALTSQ--ECTIQRLEQEIQEV-RSVLEVVNHLGPQLCQMSPGEGAV-VVESMVSRVNRRFDAVCEQIQRRAERIELSKQRSVEVVGDIDDLLDWFRDVERQLAN-AEPIIPEPEALAAMLKEQKALNEEVSSQKGRVRDILASAKKLARESPPEDQALIRDKAEDLKALVASVTAACADRLSALEQALPLAEHFLETHLDLVQWLDEAESEAERLGAPSLHAGQIKRQQDRNNALLQAVTERKPLLDKLTKTGAALIKLCSPSEGKKVQYLINSDSERYNALRNLLREQQNLLEEAMQSTSQFADKLDGMLNALASTADQLNNAEPISAHPEKIQEQISDNQAVVTDLGKKSPALEAVKKAAREVI--AKAGGDQEPTVRDLKRKLERLNDLWEGIQKAARTRGQSLETALAAAERFWEELNAVMRALRDLQENLDSQEPPAVEPQAIHQQQEVLHEIRQEMEQTKPEVEQCRQAGQDLMQLCGEPDK-PEVKRHIEDLDSAWENVTSLYAKREQNLIDAMDKAMEFHDTLQNLLEFLDTAEEKYSTLGPVASDIDAVKSQIGQLRDFKREVDPHMVEVESLNRQAKELVEHTSANQARAIREPMDDINRRWTALLKGLVDRQRELENALLRLGQFQHALNELLVWISKTEKTLEDCRPVAGDAQVIEVELAKHKVLMNDIQAHQTSVDTLNRAGHQLIEADRHSEDASATQTKLNNLNRRWQALQDKAAERQRQLEAALKEAQAFNQEIQDLLMWLGDVDGQLASSKPVGGLPETAREQLNRFMELYNELDSNRHRVESALQQGQEYTKVAEGTTTTALQHSLRTLKQRWDNVLNRANDRKIKLEIALKEATEFHESLQEFVEWLTNSEKYLTNLKPVSRILENVLVQIEEHKTFQKDVGAHRETMLNLDKKGTHLKYFSQKQDVILIKNLLISVQHRWERVVSKAAERTRSLDHGYKEAKEFHDSWAELDRWLAEAERSLDDQPAAGNDPDKIRRLLARHKEFQRALGAKQPAYDACVRQGRLLKERCPKADLPVLQRMLDDLKARWNAVCNKSVDRQRKLEEALLFSGQFKDAVQALIDWLDKALGTLKE-DQLVHGDLDTVNNLVEQHKSFQTELKSRSTNLESVRRTASELLKTASSEDASNIRQQMSILESKWDTVSKLCESKQTRLDEALKQAEQLHKAVHMLLEWLSDAEMKLR-FA-GPLPEDEATTRQQIAEHQQFLRE--MDEQQVNKDKTIALAQEILAKCHPDAVTVIRHWVTIIQSRWEEVSLWARQRQQKLEDHLRSLRDILDLLEELMRWLLGAEATLTALEAQPLPDDIPLVERLIDDHKVFMEDMSKRQPDVDRVSKAFSGKRQQPPVQQPVQQLQQHPVGARRRGEPL-----HHDRRTTPHGASQSTPRTSTPVRGHHAEPEIRHPRAKELVDKWQHVWLLALERQRRLLERLKYLQELESIKNFDFDEWRRRFLGWMNNKKSRVMDLFRKIDKDNDGKVTKEDFIDGILK--------SKFPTSRLEMEKVADIFDRNGDGYIDHKEYIDTLRPDRDCLVHGARQNKPLTEAEKIQDEVQRQVAKCTCVHRFKVFQVGEGKYRFGESQKLRLVRILRSTVMVRVGGGWVALDEFLVKNDPCR----------------------AKGRTNLELREQFILADGVSQSMTPFKSKVAS 6066          

HSP 2 Score: 76.2554 bits (186), Expect = 4.776e-9
Identity = 223/1131 (19.72%), Postives = 455/1131 (40.23%), Query Frame = 3
Query: 14781 KEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDA-KKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVH---PEKLDEELGVF-----------------------------DEILYDLDKLQIFVDKLQIGIENCSP-----SRKNANDKDDSVEI---LEKLA-KISSSNK-GLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQL------IEKVNNPNETP--DVEQAEEELK-------------------RNFEAVRSSCEQQITNIDRQ-QSLI----------------------------TK-----LEEMRMKLDEWFK----------EVNNRLFILGPLPTETRPVLTQIQKTKEL-KNDIEPKHRDIELINQLGYQLTKGSHPNIKNQV-NSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLP---DTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTL---LDDIASNLEILERDTSIGQ--TPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQS-EEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHE 17798
            + F S+   ++ WL E +  +  +   + D D LH+   E +    S  D++  + +++  G  +   + R Q    L    DA +K ++ I++    R T L+       + N   ++    L+    R  D    S H    EK  +EL  F                             + +  DLD L+   +KL  G+ + S      S K A  +D + E+   L+++  K++S +  G  ++  +  E++  LL  A E    L    D+       L  S   D +T  +   +K ++DL      H++   K+  +  QL      + + NN  +T   D+   EEEL+                   +NF+   S+ E +I + +R+ + LI                            TK     L++M  KL+++++          E  N      P+  +   + +Q ++ K   K+ +EP  ++I+ I+++G  L + + P +   +    + ++ND W  L + + +R+ +L   LL  G+F  A+    +W+  TE  + N K    D   ++  L + K +   +   Q+S++ +     E+++    S       +L+ L + +E L   A+ +   LE  L  A  F   Q+++   ++ L          G +P   D    +++   D++R         E+  E +  +         +A+   M+ +  ++  +   +E  +  L +A      F ++    + W+   E  L++ + +S  V  + EQ E    L  +I  H++++ +L      L   +   D + ++  + ++H R+  +  R+SER R        A+ F   +  +   +DD  + L+ +E      Q  T  ++ ++I   +E    L V N        LG QL   +P + +  ++ +V  +  ++ ++C +   R + +  +   S      + +LL W R +E +L+++      +   +  +L E   L +++  +   +  I   A  L  +S  ED + I D+  +LK+   +V     ++   LE+A   A  F      L ++  ++E E
Sbjct: 3517 RGFFSTCEDIQGWLQEIQHTLSPDFKISADTDILHRQVTEFEPAYKSLLDKEHEVHLLLSKGTDMVAKMTRKQESQQLRTRLDAMRKAWDKIRKEATDRHTRLQRAFENCKKFNAAFNKFGPWLQTTEARFYDLGPISYHRPETEKQAKELQGFKNEISRHSQEYDSVRNLGETFLSGCDVDKEGVKKDLDTLRTRWEKLNQGVTDRSRELDEVSAKLAEFQDKARELNHSLQRMEDKVASHDALGDAARNPQLLERMKALLREAEELQRGL----DRLRAFAEGLVASASPDSDTTHI---RKEVDDL---TRRHQQLTSKLEDRCAQLESASSVVAQYNNKVKTAHQDLTSLEEELENMGAIGRDIRTVNGQIDEVKNFKVKLSTTEDEIQDAERECKDLINHGYTQDAKGARTQLDTLKRQLNRLQERTKGRSLALDQMLAKLEKFYQDLGDIQRSLSEATNEERAFRPVAADVDTIRSQQEEFKHFRKSCVEPLGKEIDEISRVGNGLIQSASPGVNTAILERDVDKLNDEWNLLKEKMSERERKLDVALLQSGKFQEALAGVEKWLQDTEEMVANQKPPSSDYKVVKAQLQEQKFLNKLLLDRQSSMTSLMTMGNEVMRNLAPSEKAHIQSQLQDLSQRFERLNRGAQERMSALERTLPVAKAF---QEKMCPLVEWLEQTERRLATMGTIPTDQDRIAHRVQDHRDLHRDILGHKHSFEELTEIAQTLMGLVGDDEAQAVVESMQEVTDRYARLVEDSERLQQLLAEARAGANAFVVNFEDLLVWIGEMESRLSRYQVLSVYVEKLQEQFEELSELSDEIADHQKQVDDLTGSGQDLMRHASGDDAIQLKERLDALHVRYTDLTQRASERLRQAQEALPVARNFHSSHERVVVWIDDAEAALKSVESSALTSQECTIQRLEQEI---QEVRSVLEVVN-------HLGPQLCQMSPGEGAVVVESMVSRVNRRFDAVCEQIQRRAERIELSKQRSVEVVGDIDDLLDWFRDVERQLANAEPII-PEPEALAAMLKEQKALNEEVSSQKGRVRDILASAKKLARESPPEDQALIRDKAEDLKALVASVTAACADRLSALEQALPLAEHFLETHLDLVQWLDEAESE 4623          

HSP 3 Score: 72.0182 bits (175), Expect = 8.698e-8
Identity = 88/441 (19.95%), Postives = 189/441 (42.86%), Query Frame = 3
Query: 10740 QDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEE-------IQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTG--KSIENKHQQINDLKNL 12035
            Q+LLR +   PG   L+ +L  L  ++  L  + +  L L +    + K F +    + N + +K++M  VLGP+        AQ QQV  + DE    E  ++ +   GQE++  + P +    +I + ++ + +  + +   L++RE ++ +  G + DF+ ++  + + L  + +  D+    +  + D EE       +   L++ +  L ESE +   L + ++D  +  EIK K     +    +  KI++    +      +    +  ED + WLQ  Q  L+    ++      L   + + +     +  K+ +V  + ++   M  + +   +S+Q+  +L  +    + I  +  +     Q+A  +  K N   NK   W+   + +     P+     ++E +  E  G    I    Q+ + ++NL
Sbjct: 3256 QELLRRKPNAPGSESLQQQLTELLSRWQELLQAIRIRLLLIQ----EFKDFQDTHDLLHNWLSQKDKMFQVLGPIAHEPRMVAAQTQQVLVMRDEFSSQEPLLRRMNLCGQEVVGQLEPNNPAGRKIRDQMEAIKRHWNEMIGRLEERERSLGAATGATTDFHTVLGKLLEALQNIGDDFDQ----LAEAGDLEEQLRRLRGLDDRLEAQRPPLAESEAMCDHLCDILTDVASRNEIKGKWGTADKLYNNLNRKINNRKAELESSLREDRGFFSTCEDIQGWLQEIQHTLS-PDFKISADTDILHRQVTEFEPAYKSLLDKEHEVHLLLSKGTDMVAKMTRKQESQQLRTRLDAMRKAWDKIRKEATDRHTRLQRAFENCKKFNAAFNKFGPWLQTTEARFYDLGPISYHRPETEKQAKELQGFKNEISRHSQEYDSVRNL 3687          

HSP 4 Score: 69.3218 bits (168), Expect = 6.208e-7
Identity = 150/741 (20.24%), Postives = 298/741 (40.22%), Query Frame = 3
Query: 15684 QAEEELKRNFEAVRS-SCEQQITNI-DRQQSLITKLEEMRMKL----------------DEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPN--IKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEI--IKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEM-FKFSGGLPDTAKEQLKRFMDIYRTF-PKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMA-THLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTL----------------LDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQS-EEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFF 17780
            Q +E L+R   A  S S +QQ+T +  R Q L   L+ +R++L                  W  + +    +LGP+  E R V  Q Q+   ++++   +   +  +N  G ++     PN     ++   +  I   W  ++  L +R+  L     +  +FH  + + +E +    +    +  E GD   LE  L + + +   +   +  +++ E     +  I  DV+S  +E   +     K +  L      +  ELE +L+E   F+   ++I   + E+   L   FK S    D    Q+  F   Y++   K +       + +  ++K + +   + +   ++ + K WD ++  A  R +RL++A E  + F+    KF  WL  TE       P+S       +Q +  +  K +I+ H +E  ++  +  T L       D   ++  + ++  RWEK+    ++RSR LD    +   F+D  R L                L D A N ++LER  ++ +   +++  + + + F   L                +   +P  D+  I + V +L  + Q L +K  +R   L  A  +   Y + +      L ++E +L +     G D+ TV   ++E    + +L   +  I+    +   L+     +D+     QL  LK   N +           E  K +++  +++   L++F+
Sbjct: 3254 QVQELLRRKPNAPGSESLQQQLTELLSRWQEL---LQAIRIRLLLIQEFKDFQDTHDLLHNWLSQKDKMFQVLGPIAHEPRMVAAQTQQVLVMRDEFSSQEPLLRRMNLCGQEVVGQLEPNNPAGRKIRDQMEAIKRHWNEMIGRLEERERSLGAATGATTDFHTVLGKLLEALQNIGDDFDQL-AEAGD---LEEQLRRLRGLDDRLEAQRPPLAESEAMCDHLCDILTDVASR-NEIKGKWGTADKLYNNLNRKINNRKAELESSLREDRGFFSTCEDIQGWLQEIQHTLSPDFKISADT-DILHRQVTEFEPAYKSLLDKEHEVHLLLSKGTDMVAKMTRKQESQQLRTRLDAMRKAWDKIRKEATDRHTRLQRAFENCKKFNAAFNKFGPWLQTTEARFYDLGPISYHRPETEKQAKELQGFKNEISRHSQEYDSVRNLGETFLSGCDV--DKEGVKKDLDTLRTRWEKLNQGVTDRSRELDEVSAKLAEFQDKARELNHSLQRMEDKVASHDALGDAARNPQLLERMKALLREAEELQRGLDRLRAFAEGL----------------VASASPDSDTTHIRKEVDDLTRRHQQLTSKLEDRCAQLESASSVVAQYNNKVKTAHQDLTSLEEELENMGA-IGRDIRTVNGQIDEVKNFKVKLSTTEDEIQDAERECKDLINHGYTQDAKGARTQLDTLKRQLNRLQ----------ERTKGRSLALDQMLAKLEKFY 3956          
BLAST of Dystonin vs. TrEMBL
Match: A0A1S3K4B8 (LOW QUALITY PROTEIN: microtubule-actin cross-linking factor 1, isoforms 1/2/3/5-like OS=Lingula unguis OX=7574 GN=LOC106178456 PE=4 SV=1)

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 685/2352 (29.12%), Postives = 1223/2352 (52.00%), Query Frame = 3
Query: 12240 AEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKS--MHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIR----------KIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKH---MEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDR-LKKRQSSLDELNKAGSDLLINTKEP--KKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQN---DDSSIDESIKKL--KIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKL---VCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQ--KINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSV-EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPI------FDRS--KRMETNQGI------------SKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKP-ANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF 19145
            AEE L+  E    + + V +   +++T Q+++     + E+      ++ Q   V+  ++  +++ +  R+  L+ ++  +L+ L    + + E    I+  +T      +K+ +       +      +H + +L+ E + ++  +   +   ++L       A+ S    ++D ++   EK+ + +D    S+    ++VT  + + N   R          K+D    DP +   +    + + AFS Q  +         ++   + C  V+S     H   M  +++ +K    R+   V+  +  +   + K   F  SL  L   ++  + + +++          K  L   +    + L+  Q  L+ ++K G  L +++  P    S L+ +++ L  K+  L      +    D A+  S  F +     L WL   E+ L      P+ D    + ++QE K LQ    D     E+IKK+  K+     DG   + VS     ++N +  R+ E +    E+ + L     + + + +++    D L   E  M   +    +  + R        + +EV  H E L    + GE+L Q+ +  + A +  K++ L   +  ++  +  +L   +  +P+AE F  A+ K   +L  L   +R  D ++G+ GE  +E ++ + N++  +   V Q  + L KL    A      ++ED+  ++ KRF+ +  +V KKA KI  ++ ++   +E L    +++  FEQ  ++ + +  I++D   L+E   D   L    N+ K      +   +KL+R+    D  +++  +D +K+ +++ ++    +   L++A+PL+  F  ++  L+ W    EE + +  +  L+ DQ+ K +  ++ L     +QKPL+D + K+G  + ++    + + I   ++    R+  IK   + R+ +LE+++   +E +EK+D     L    +++  +   S HP+KL ++L     I+ DLD+    +  ++          +  +++D+SV ++ +K+ ++      ++  T E    +   L +++ FW +L  +     EM   +    +  L    + ++++++E L+ +I+    D+  + Q GK+LIE    P+  P+VE+  EE+  +++ V++    +   ++   S  TK +E  + L +W +        LGP+  +T  V  QI   K  K  ++PKH  +E +N LG +L K S  +    V   +A +N  W  L+DG+G+R+ +LQ  LL+LG FH A++E + W+  TE +L  I+   GD   +E+ +++HK+++ D+   ++SV  +     ++I  + S+       +L+ L   W+ +    R K  +LE A +EA +F+G+  +  + + ++ + L   K  GGLP++AK+QL RF++I++       +++  + E  +I +K  ++    +  +++ L  +WD V+  A+ R+ +LE A+   + F  D+  FI WLT TE+N+N  +PVSR++ TI++Q+E H+ L++DI+S+RE+M  LDK  THLKY SQK D++LI+NL+ S+ HRWEKVVSRS+ER+R LD+G+K+A++F ++ + L D +  +  +L+ + +I   P KI+EQI KHKEF   LG     YD+ +R+G  L++K+   D   +  ++H ++ KW S+C KS+ER++ L +ALL SG+ +DA++ LL WL  +EP L++  +   GDM+TV  LL EH   +++L  R   +  +      L+  SEED+  +++ L ELK+ W+ V KL+ +K++RL+EA  +A +F +    L E+ + +E  LR  +   ++E+E  +S  + +       L+  E  +      G +IL  ++P A   +KH+I I++++W ++ +W+ QR   L D L  L+    LLD L+ WL  AE  L   E   L   + E +    EHE F  DMT +Q D+D  +T ++K+ P L         F+R   KR  T + +            +   EP F NP++  L +KW+ VW M ++RR++L D  +Y KE+E +K+FNFE WR+RYM WMNH+KSR+MDFFR+QD D DG+VTR+EFIDGI        + SKF T+R+EME VA+IFD +K GFIDYR+F+AALRPD +    KP   +NE I DEVK+Q++KC C   + I + G+GKY+FGD++KLRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELRE+    +G   +MA F
Sbjct: 7671 AEEKLEMMEPVALERMKVIQQHKDVQTLQTEIVRKTHNHESLNTQGQTLMQNVDVDKQVVADQLDAVNQRWDSLNKAVDDRLLTLEDMSQKLHEFFDLIKDLSTSLSKYEDKLSSHDALGA-VAKGSRYLHIIQSLQEEVHSMQPQIDYTQELAQSLISAGPANAKTSQITSRVDEVSERYEKLAQEVDSWLASIETGSQVVTGAQQQVNTVGRQLQGFEEDLEKMDACGRDPHV---VEQQLQELQAFSAQISEGAAA-----VNEAEERCHNVMSQGYIGHGDPMLAQVEDLKKQHSRISDRVAQRQGELSGMMNKLDDFHDSLRQLHTAIDRAAEEQESQNPVGGNADNLKKLLQELKTFEKKSLEPIQKQLEVVSKQGQQL-VSSAAPGVSTSGLECDIESLMDKWNELNQKVRDREAALDDALLQSGKFSEAVSALLDWLGETEE-LMEHQKEPSADYKVAKAQMQEQKFLQKMLEDRQGNVEAIKKIGSKLSTEDSDG---QQVSA----QVNDIVKRYEELKAGATERRQSLDTMMTVAKEFQEKLEPVIDWLDTTEKKMASAEPVATESEKIRQQLHHQKEVNEEVADHGEDLAAALKKGEELLQLCNGEERAHVQEKLDELKLRYSALNEKSADRLQQMDEVLPLAEEFEDAHGKFLDLLNRLEPELRGKD-MSGKEGENQLEEIQAQMNNLVPILTAVSQTGHPLSKLAIGSA---GAAEIEDLINKDTKRFEALKEQVDKKAEKINFSKQRS---QELLKDISDLMDWFEQTGRLIQTAQPISSDPGVLKEQLQDHKALTEEMNQNKGKAREVVTIGRKLLRETSIEDDGTIQDKMDDLKQLTDNVSRLCTDRLGLLEQAMPLSVHFHDTHRDLEAWFEAVEEKITEQDVPALNTDQIKKQQDGVRILRQEIIEQKPLVDKLNKTGQAMIKLCGLEEARKIQEFMDTDNNRFEMIKNSTRERSNNLEEVMQQTSEFSEKLDNMLETLVATAEQVEHAEPVSAHPDKLRDQLEENKAIIEDLDRRLAALHSVKASASELI--SQAVDEEDESVKDMKDKVDELVQLYSDIRKATEERTAVLEETLEVSDTFWVELNQLMGTLKEMQDTVELQEVPALQPELIREQQEVLEALKEDIEASHTDVDDVHQVGKRLIELCGEPDR-PEVEKNIEEVDTHWQDVQAQMVTRAKLLEDAMSKATKFQESLIHLLDWLQVTEEAFIGLGPIGADTDTVKMQIDALKAFKGAVDPKHVSVEALNHLGQELIKDSTTDQGAVVKDQVAEVNKRWDALIDGIGERRAKLQQALLNLGAFHVAMNELLSWLDKTEQTLDEIQPALGDTRLMEIAMSKHKIVQNDVEAHRSSVDSVNDAGKQVISSEGSADASSTRHKLDLLNMRWDAVLGKTRDKQLDLEHAYREAQVFHGELADTLQRLSDIDAHLITSKPVGGLPESAKDQLNRFLEIFKDLEGNEPRVQDLLSEGEKIVQKCGETTATNLNQNLQALKNRWDNVRARAKDRRKKLEDALAQADKFQADLNSFIAWLTNTERNINNLKPVSRVLQTIVDQIEEHKGLQKDISSNREKMAALDKTGTHLKYFSQKQDVILIKNLLLSVQHRWEKVVSRSAERTRQLDHGFKQARQFHEVWQELNDWLNQSEAMLDTEQTISNDPVKIKEQINKHKEFQRTLGAKQPIYDTVQRMGRVLKEKSSEADEPVLQNLLHEVKNKWNSVCGKSVERQRRLEEALLFSGHLRDALSALLDWLYKVEPTLTE-EQMVHGDMDTVIALLEEHKAFQQELGKRSSSVGSVQKSGKDLIENSEEDAGDLQNDLIELKTRWDRVCKLSVDKQKRLDEAMKKAEDFHKRAQQLLEWMADAEMHLRYHSHIADDEEE--LSQQLEDMKSLQAELVKQEENLKTTLALGGDILKQSHPVAVMPVKHWITILQARWEEISTWANQRERRLTDALSELHNSMALLDKLMTWLQTAESHLTYQEQEPLPVDMEEIEKLTKEHEEFENDMTSRQPDYD-CLTKTQKRRPSLDSSSGLLSPFERGSPKRSSTPRQMKYDARGRAGSTPTPTAEPQFKNPRVTALFNKWRHVWLMAMDRRRKLQDAQDYFKEMERLKDFNFETWRKRYMKWMNHNKSRIMDFFRKQDKDRDGKVTRQEFIDGI--------LISKFPTSRLEMEAVANIFDHDKDGFIDYREFVAALRPDNKA--AKPEQTDNERILDEVKRQVNKCRCQKKFHIHKIGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWIALDEFLVKNDPCR----------------------AKGRTNVELREQFILAQGVSQSMAGF 9958          

HSP 2 Score: 486.878 bits (1252), Expect = 6.029e-133
Identity = 361/1302 (27.73%), Postives = 658/1302 (50.54%), Query Frame = 3
Query:  393 LRVADERDAMQKRTFENWINCHL------MKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK----EEDIEEKIYQFR-NQYADLYANLNSALEE-----LNDDF-----DHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNN-----ENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYP-ADQHYRIIININGKIDKVKKKFE-----KLSPPTLSSGVISNRQYTPIH--SMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILES--ENKYQMDMD----FHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKF--------KNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEAAQDTISSVVGNLKDVPTNL--------------DQLI--SAVT---TSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFL 4097
            LR  DERDA+QK+TF  W+N HL       K  ++V D+F DLRDG  L+ LLEVLS + L  +    +FH L N+   LD L+++ IKLVNI A+++VDGNPKLTLGL+W IIL FQ  D++   ++ +L+ K  LL WSR+  E YP +N+ +FS+SW+DGKAFLA+IH+ RPDL++ ++I  N+ ++NLE+AFN A+KELGV ++++PED+     DEKS++TYV+SL+ + P+    E+ +++   Q R  +Y  L + L + L++     L+  F     +      +FN+ R+E +    L + +    LF ++  +   +     + +     ++ L  +F    +EK + +  E+ +++R ++++  +  +       +++IE K+ +  + +      E  +   +I   L   E  I  +   VQ LK   Y  A+Q Y+ I  +  +   ++   E     KL+  +  +  IS ++ T +   S  +  N  +  +     WI E+  ++ + ++  DL  +    +K      +I    +EFK  +E     K  +  D    + Q  + ++  ++ L    ++     +S L+F+  ++  + W+  KED ++   W  +++++ +E+ EK+        K+L+ +LE+RE   N     G  L +  H A+  I+  ++ ++++W W+L LT CL+THL+    Y QFF +A   +  +   T+ LNS + R   V +++GE L RE +DM + +++Y++ +  ++A S+ +  L +R   ++    + VKAIC+ K+          + E   L +N     WRV NS     + PA+CFLI   + +A  TA  L S F  L+ LW  ++ +LR +++ +T+ +VK W  E F  L P  R+ I++ LN DA  ++ D       E E+ +    + QCN  F          VQ+     Q ++ +K+ +R    S+  Q+D L        Q LS +L   +  + + LE  V +HK FE +L+ YE QV  +   V++  +    ++  +  +++ W  LW+ AH++V +LK  E+    +DE+  ++   E  L                      A+QD+++S VG L+    +L              +QL+  +A T   T R     + Y D+ +L+K++  +  R+E + +Q+ +R+ + +         +N L    AW+   Q  ++ Q  +  +V  ++++      + N    +++ +P+++ +N     +L
Sbjct:   43 LRYTDERDAVQKKTFTKWVNKHLKRHWRLSKSVRQVGDLFEDLRDGNNLITLLEVLSQETLPRERGRLKFHKLNNVQIGLDLLKNRGIKLVNIRADEIVDGNPKLTLGLIWTIILHFQISDVIVPGQAPELNAKDALLLWSRRTCEGYPGVNVRDFSSSWRDGKAFLAVIHRNRPDLVNYRAIRNNTPEKNLELAFNIAEKELGVTRLLDPEDIAVPQPDEKSVLTYVSSLYNVFPEVPSLEQSLQDNERQIRWEEYRGLASALVTWLKDNTSLMLDRTFPVTVVEMKSMLSEFNRYRIE-DVPPRLAEKQKLEQLFYELQNLSVGSSQFTIDEELHIDNVNRLLDRFTIAQQEKDMAIQAETTRLERLQRLAEKVHKDSKICDENLDDIERKMNEEQHRVEVIHPLEAKKGCDAIDHALKLTEGSIQTLFEDVQALKDGRYHLAEQLYKRIYQVQERWLALRTCLEEEIMSKLASRSFVTEGISIQKRTEVQLESRLVETNEAFKMVQDCLEWIAEQQKMLEDQDYGEDLPTVQAYLQKHRQDSQKI----EEFKQHVEKCITAKSTLPADEQKLYSQWMSKVEVAYSLLHNTYTRRTKALESLLDFIQAASVELKWLNDKEDTEVARDW-SSQTLQ-AEEIEKYYQKIYPEAKSLMTDLEIRELQFNAVQDKGEALVMERHPASKTIEAHMSAMQTQWSWLLQLTLCLETHLKHATAYYQFFEDAQHCEEWMNRQTDLLNSHYDRA-EVSVEDGEKLIRETKDMKDLLDEYQQRIEALVARSRDILPLKMRRERLISP--IPVKAICTYKQ----LNMSISKDEECMLFDNGQITKWRVANSYGREGSVPAVCFLIPPPNKEAMATAERLRSQFEHLQTLWNAKQRKLRRKMVFATIRVVKTWDLEQFQRLGPAQRETILKALNDDAEMVLSDRD--GTPEPELRQLRDEMKQCNQIF----------VQLTNQLQQEAASLKSPSR----SLLEQVDQLHRDLDHKEQVLSGRLNDTIPREREKLEQTVVEHKAFENDLQGYEDQVEMIRGSVRSPQAANPHIQTTIGVVLEKWSNLWSMAHVYVERLKCVELTLCSMDEVTGLLTGYETHL----------------------ASQDSMTSDVGILRHNKQDLMDLKQAMASKNILVNQLVENAAATRRITERSRPGMMQYPDVDRLEKDVDRLTTRWENVCDQVAQRIHNTDTAIELLSMFQNGLSKENAWLDQQQEGLQGQPPLTGDVQHARDMLDATAVLYNG---LSEKRPQVEAVNSYGGRYL 1289          

HSP 3 Score: 162.155 bits (409), Expect = 5.882e-35
Identity = 239/1110 (21.53%), Postives = 492/1110 (44.32%), Query Frame = 3
Query: 8784 LQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQK-------KIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENV------LMNNASRN-----EPKLKELDDKIKQKLLVASNIEAKVNDTRKL---LGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQG----FPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPT-SITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSD--------KLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVS-------DRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKI-DHSVDMIGKRSHHEDVLLTK-LEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLT---NVIENIDT-------DINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESI 11954
            L++ +   +    E  ++  D+R L  +   F+D+  + ++ + K+          ++ SK      E +  V D  KD  D Y+  L Q     E L+  +EK K       KI+   +++ + L ++           +    + +  +N E ++ SK  ++++ + +  I  L  +  +   I+     ++   ++   I   L      +    + +     S++ L  WL  ++ +I+N+  +SL+   + EQ   I+ + A+I ++Q  +E+V      ++ N+        + KLK+L+ +  + L   S  + +V D  ++   L +F+ A+K+  +W   T + L  +  ++L+  +FKEK+D   +  + +   +E+ R + K+L+      +   ++  + N+E  W  +  L++ R K+   R+ +S  YA L+  ++  L+ +E  +    P+A+ +  ++ Q ++++  I E  +    I+E   +G+ YD + QG     P+   +Q    S  R PS++K        SPT S  K P   N      S   SS  SS D     ++ +ET  ++ DI  RY  + D L +R+++I   L   LS + +  +  +        K+D     + + + K+  L  +  + E       +L   +   +T   +L++N+    G  EL   L +LE++F   K + ++      N    MK+F +  + ++  + +KE+M+ VLGP+ T  +    QL+QV  L +E+ G ++  ++L   G  I+    P S E   I + L+ +SKK +NL   L+ RE  +  +   S  FY  I D+        DRL+       + D       + ++++ E      IL+++ N    + + + D++T  ++KNK+  + ++  + + +I     D+  K +  E    T+   D   W+Q    +L+      G+   TL D +RQ + LQ ++  ++ Q++ +  +  ++     P+  +  + +KL  +    + +E   T       D N  S  + Q+           + +  W+   + K+    PV LE +
Sbjct: 6614 LKEHMDKHRAFSREVMAHEADLRFLNMAAQHFMDEAKQFQKCQLKYKK------GGDRSSKHLILPGEDIEGVRDKVKDTMDSYQDILDQCNAYSEKLDKTSEKNKHFLETVGKIEDWIKSADKRLNELDWEGVSNDAQGMYRQLEKIRTINAEAIAQSKTDRDVKHTGKELIVCLRELRASDVQIEDVEHRMNDVEDQHGFITADLMSRSSVLQTTMVQSQGVRESLDGLTDWLTNVEAKIRNLRPISLNRDTLKEQMSEIEVLQADIDAQQQAVESVNKKGAEIIKNSDSEVSKSMQAKLKDLNTRFGEAL---SRADTRVRDLEEVSDRLTAFQTALKNFDEWCIPTLDSLDSKTTLQLEPAQFKEKVDIFAQEKDSQLPYLEKLRHLGKDLIEDPRTMETGLVKDALTNVEHSWHDITALLSEREKDAEMREKHSTGYANLRTLVLLWLDGFEAKVYELQPVAVKMEVVKKQKDELKPLIEECENYGTTIDEINDVGNAYDQLQQGERNISPIRRTRQR--VSSLRSPSRLKTP------SPTRSGPKSPGYVNGSVSSESSGVSSRKSSVDNFLSLEDLTETQCQLIDINQRYEMLNDLLADRQAEIDRTL---LSLEAQKVDLENVKTWLQEHKVDP-AEHVPASQSKSQQLLKDHAKFEAEMHSKEDLIAAMKERVT---ELVKNKGDQSGTAELVKNLQQLEEEFTDAKAACEQRRRSLANMVEDMKEFKDTSRHLDKWLAQKEKMVAVLGPIATEETQIQNQLEQVKVLEEELAGHQHQYEQLVQAGSSILDQCEPESKEAQRISQQLEEISKKWNNLESSLQQRENTLKEVQTVSAGFYDAIQDIGEWAPKTMDRLSRQASISSQADIMREQERELKDLEEEAKEKTKILEDARNAYGKISDKVKDQSTKQDLKNKLEMMDKSLSDTKRRIAGRKADL--KVAMKEGEQFTQSCADLMDWVQGAMTELDSGQPVSGD-DLTLKDQLRQHEALQKEMDDRQDQLKLLLDKGQQVLTSTPPSPATADLQNKLDTIKLQWDALEKKATHRKRKLSDCNEKSSAFHQS----------LDHMTTWLQFAEEKLEMMEPVALERM 7686          

HSP 4 Score: 116.701 bits (291), Expect = 2.657e-21
Identity = 208/997 (20.86%), Postives = 397/997 (39.82%), Query Frame = 3
Query: 5364 SISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIK--------LNESLISGPNQEIIH----PNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLL-KDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDE-IAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYK--IINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIG--FKDPISGGIISPIDA-----------IEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLF--DPIRCEIRDNCGHI-------------------------------ITLNDAINEDLFPEFV------------PTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILD-------HPQSNVTVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSV-------FATIITLTNRSLYFEN-----LNKRHDNYQIISVYD-PRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLL 8072
            + +EAL    +D  S   I+P   + +++ EA+    +T  G  +       + F +A +KG I         +  ++I    Q I+     P   + +T   A++ GI+ T+ E+++N  T E   + +A +  FI+  ++   ++    I++     L I  AI     D +TG++   +     ++ EG  D  + + QYN +   +  ++ F+ +I++ +    D T       ++ Y ++ +  D    E I++  A  R  + +  G+Y + +        DAI  N+++    ++   V      +  +        V +   KEW+S   A +  I+D   G +   + N    V+ IP  +AI  G+I+A+ +  + +  E    G  F+   +  II  IDA           I + L+D + + F+N+ + + +T+ +A D GFV+T +      T++  I     DF    + L   +  M++++AI    +D       HP  G  I L EAI+  L    P   + R+   HI                               I L +    D+ PE              PT    +     +  G +     +  DPR      V EA+    LD       +PQ+N  +    ++ +V+   +++ + + F   K T  L          D  S  I++V D    +E  +SVA   R   +++         HS    +P   T+E +  +I    G         + +++     K  L+EA+++ + D               S +E+V  GL++  G+S      +  ++  + +  +V  GV  TA    Q+    +IDP   L  DP +G   ++   ++ G +         T          F N     L  R   ++ IS        + +++ EA++R +I++ + T+ + ++  + T   A Q GLL
Sbjct: 3754 TFAEALEAAYLDPTSAQFIEPETKRTMNIMEALDQKFLTTTGHYVYPDTGRKIHFGEAMDKGIIVESKHEGEVVKTTVIREQKQMIVDSVTDPRSGRDITFDKAVKDGILQTEMERYVNPNTGEAMPISDAVDEGFITGEIVDTQVSTEEHISSAVRRTLHITGAI-----DTRTGKMVAPTE----AVEEGILD--LPKAQYNDL--RSGRVLPFAEAIEKGLLFAEDHTVP-----KRAY-SLLSAMDPISGETINIKNALDRGILLEKTGVYVNPRSGATVPVIDAIRQNYVKAEEIETPPGVKAGTITEQTQYDIKV---VLDAANKEWLSLINAAQRNILDLQRGRFTDTLANK---VMSIP--DAISQGFIKAVLK-TQYIYTETAATGAIFRQTKTTNIIEVIDASTRERMTVIEAIRRKLLDEEMKTFYNSHTRENMTIQQAIDAGFVITTQQPRTSRTVHTKI-----DFTFDYIILEGNKEKMSVDDAIQRGYLDPATGCFIHPLTGGLITLEEAIKRKLIKTQPPLKQTREKPSHIDIQQTPEIIVTPETPKQVKPPSKPPEEEEDHIELREIARSDITPERTLQAASSRENLSSPTSPGSM----PVSGGTVSFSIKSVIDPRTGEEITVGEAVRHGYLDKQGRNYVNPQTNTRI---PIEEAVRQGLVKLYSSDPF--GKGTSPL--------AKDTKSFSIKSVLDPRTNEE--ISVAEAIRHGYLDK---------HSRCYVNP--YTDEKIPLDIAVQQG--------LIRVVHVEDSVKHTLQEALQQGLIDVARGRYTHPNTGEKMSIDEAVHRGLLI--GESREDLTALGNKSASMASLPFVGNGVTFTAAF--QL---GRIDPNTGLYHDPGSGHKMSVGEAVKQGLINPGSSTTTMTRTITKKEQRSFTNQGSATLPPRPSAFRTISQDGMATARRGLSFVEALERGLIDLHNQTFKHPRSGHLLTFEQAKQAGLL 4672          

HSP 5 Score: 113.62 bits (283), Expect = 2.539e-20
Identity = 188/912 (20.61%), Postives = 373/912 (40.90%), Query Frame = 3
Query: 5595 IIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEK-LTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFL---TCPLIKFSISIDEIAINIDQTECNL---FENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHE--------KDRIYYSFTDAIDANFIQTNNEK--------SKERVXXXXXXXXXXXXX--XXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDF--------------GFVID------------IPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCE----IRDNCGHIITLND---AINEDLFPEFVPT-----DKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNVTVYMTDVQNSVQNKTLEIPNEEKF-VDTK------TTKTLESIKRNYFGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESV---------KMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT------NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFA-TIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLL 8072
            +  P    +++L  AI+ G++  K E++++    +   L EA    ++ ++L+K+L   CGI++    K LT+L+AIN  L    TG I D    + ++I +    KI+T     R+  +   T  + +        ++   +T  +L    +   +       +D    E ++LDEA KR  ++  +    H          + +     D I   ++   N++         K+ +++  ++    +K        V++P T   +S  +A+E G++D   G YK + D               G +                I++A+  G I+ I ED   +       G +D  S  + S  +A+E+GL+D     + N ++ Q +++ EA   G++     +++L        + L+ F SGI+ +   ++S+    +      D     ++ P  GR + + EA  + +F   + +    +     HI T+      IN+   P+  P+      K K+T  +A+ +G +D +  TF DP       VE A+    L      +  +  D   S  +  +E   + +  VD +      T+  +++ +  +  D       + +  A + +E       +E I  +++   + + NA S G    K ST E +T  + +L       +S     ++P T   +N+E+AI+    +   +   ++      S EE++         K G ++ +   E  +  +I    V+      H  VG   +L          +T N++    Q +K P       + N ++ G V   +  T   R    + L++R   YQI +V DP     +   EA+   ++N  +  Y N +T ++  LS+A++ GL+
Sbjct: 1704 VFDPQSGLRMSLSQAIENGLLQLKREEYVDPSNGKHLKLSEACNQGYVDQALVKELYSLCGISDPYTGKTLTLLEAINNGLYSPITGLITDPKTGRGLTILDAIKHKILTPEAATRLSLVSITTSDMTQTQAYYGVTSMAAAETSLSLSDAIDKGAIDAHTGQFFDIVSCEKMTLDEAMKRGLLDARVMEVVHPFSGRKVTLAEGVSLGLIDTIAGKYVDNKNQRKMNLDDAHQKQLIVKPFSLHGALMKGIINYQGRVYSPRTGLVMSVGEAIEHGLLD---GQYKSLIDCQTNEVLSLSDALRRGLITSEGRFMNKKTRQTSSIHDAVNQGLIQVISEDTVFVTR-----GIRDMTSNAMYSLPEAVERGLMDPNNMRYINQRTGQTMSVLEASRRGYI-----DVRL-------AERLLTF-SGIIDVVGNQLSII--RSTQRGFFDPTMGQVRDPSLGRVMTIEEATHSGVFTFEKGQELLLLTAPVCHITTITTKIHPINQFEHPKVQPSRELAVAKKKLTLSQAVSRGLVDEQQGTFTDPATGQKTSVENAITSGRLGLISEVIQAHPMDFDVSETSHHVETGKDSRMEVDVRDSYKQETSGNMQTFRETHVKD-------RKIARARVEEEDDSDEEMEEEILTLSKSLLHDLLNAKS-GYFLEK-STREYITL-LDALQKELISRDSA--VFVDPQTKDSMNIEDAIRRGFLESTGHYTDAL--GKRMSLEEAIQKNIVIFRNKEGGVITQALKETHKFTVI---GVIDAQTGAHLPVGKAIQLGLLDQSQGLYITRNRM---GQPVKLP-------IRNAIQEGLVIIDSGATRVTRVEETQTLSERI-TYQIKAVKDPIFRTPMAISEAVKTGILNPSNGQYTNTETGQVFQLSEAIEKGLV 2564          

HSP 6 Score: 96.6709 bits (239), Expect = 3.396e-15
Identity = 82/371 (22.10%), Postives = 167/371 (45.01%), Query Frame = 3
Query: 5046 KFLDPITNTELKYTDAIRYQYINDDISEILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKS----SISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMY 6146
            +F D ++  ++   +A++   ++  + E+  V P      +T  E V     D  +G   D+     + L  A Q+ ++ KP S L   L K    +   + + ++    S+ EA+  G++DG  +  I    ++ +SL +A++ GL+T  G+ +  K + + S  DA N+G I++         + I         +L  A++ G++D  N ++IN  T +  S+ EA    +I   L + L  + GI +    +L+I+++      D   GQ+ D S  + ++I E  +  + T  +   ++ LT P+   +    +I         N FE+ K+  +       K+   ++L +A  R  +++  G +
Sbjct: 1866 QFFDIVSCEKMTLDEAMKRGLLDARVMEV--VHPFSGR-KVTLAEGVSLGLIDTIAGKYVDNKNQRKMNLDDAHQKQLIVKPFS-LHGALMKGIINYQGRVYSPRTGLVMSVGEAIEHGLLDGQYKSLIDCQTNEVLSLSDALRRGLITSEGRFMNKKTRQTSSIHDAVNQGLIQVISEDTVFVTRGIRDMTSNAMYSLPEAVERGLMDPNNMRYINQRTGQTMSVLEASRRGYIDVRLAERLLTFSGIIDVVGNQLSIIRSTQRGFFDPTMGQVRDPSLGRVMTIEEATHSGVFTFEKGQELLLLTAPVCHITTITTKIH------PINQFEHPKVQPSRELAVAKKK---LTLSQAVSRGLVDEQQGTF 2223          

HSP 7 Score: 92.8189 bits (229), Expect = 4.688e-14
Identity = 147/685 (21.46%), Postives = 290/685 (42.34%), Query Frame = 3
Query: 5403 NSEFSIKPNFSQK--ISLFEAVQNGLVTENGKIIVDKNKPS---LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFIS---KSLLKDLTVYCGITN---------GNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYI--------SLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIID-----HLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDLFPEF---------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVY---GVEEALAKNILDHPQS-NVTVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTL---ESIKRNYFGDDQDSKLIQTVKDASIRQELPLSVA 7316
            N  + +    SQ+  +SL E    GL   + ++ +D    S   L+   A   G I    +LI+ P+         Q +TL  AI  G+++ K+ + ++  T E  SL EAY ++FIS   K+L     V  G+ +         G+ +K+T+ +AI  +LID  + +I   S  Q +++ E     ++  +    ++  +   I  + ++D + + +D +    +    L Q +   +D      I        +L++A +   ++ +  +    +        +AI    + T+  +                       VF+P   + +S  QAV++G +      H+  +  I  + G   +  +N+AI  G +++  +      +E+  +   D I+ GI+ P    EKG+V+          S + LT+ +A   G +   +L     T    I+ G ++  +GI T P     MT+ + ++++  D      +   +G+ + + EAI+  +FDP  C ++D+     +++ DA N+ L  +F          P  K +   ++++      + T    + +  N +   G+   L     D  +S ++T  +TD    +  KT  I      +D KT+K L   E++K+     D D+  I   KD++  Q +P+S A
Sbjct: 5121 NIAWHVSTGLSQRKGLSLTEVFHQGLFDPSSQVFIDAGTGSVQGLTLQSAIESGLIDSERTLINLPSS-------NQPMTLSDAITQGLVNPKSGEVMDVSTGESISLLEAYNSEFISDSAKALTLSEVVQLGLYDDQTGLITGPGSEKKITLREAIQHSLIDPSSKEIKHPSTGQMLTLQEAVEQNLLDLDSGELLISHSGERINLATAVD-MGVILDTSAIPPY----LQQLVEGFWDKSSGRIIDPVSGKMLTLEKAIETGILDPNKLLLRDPETNEAVPLLNAIQTGIVDTSTGR-----------------------VFDPTKGKDISFDQAVKEGRVIQTQLLHVPEDEDIHMESG---NKGLNKAISDGILDSTSKIYVPETHEM--LSIPDAIALGIVDP----EKGVVN---------ISQKQLTLQQAGHAGLLRKPELP---RTFTQAISCGALNPSTGIYTDPVSGRQMTMLQCMDNDVFDSTVKEFQDSWSGKEVTMSEAIQLAIFDPETCTVQDSKTDERLSITDAQNKGLLLQFRTPGTSENSTPKLKPRTGKQKSIPPPLTVITTAELSENQQQNDFSSAGIASKLQVQRRDRERSPSITEAVTD--GLLDTKTNYI------IDAKTSKRLSMSEAVKKGVI--DTDNTFI---KDSATGQLVPISEA 5736          

HSP 8 Score: 90.8929 bits (224), Expect = 1.524e-13
Identity = 247/1256 (19.67%), Postives = 458/1256 (36.46%), Query Frame = 3
Query: 4743 KLSIIDMLKLNVFNIFNGTFNVDCFFEPLTISKAVNSQIIDRKVGGYLNCLMISSIELLHSPPTVISAIYSPKELKIQPPXXXXXXXXXXXXFNPIS-----DKQIKFLDPITNTELKYTDAIRYQYINDDISEILFVDP-----SENSFHLTTKEA------VKNKFFDPESGNIFD----HNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVD-KNKPSLSFLDAFNKGYIKLNESLISGPN-----QEIIHPNL-----------------TQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQ-----------IFDRSNNQF-----------ISINEGYYDKII--TENQYNRI----VFLTCPLIKFSISIDEI--AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFI-----QTNNEKSKERVXX----------XXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSG-NYKIINDFGFVIDIPINEAILSGYIEAIDED-------VKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP-TINDLITQGLVDFDSGIV-----TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCE-IRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNVTVYMTDVQNSVQ---NKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENN---STQLFIINPNTGRKLNLEEAIKENIYDPVENMIR-SVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLH-TIMKTRQYMPLSCPFTNVHIRTIEEEMNFSIPQS 8177
            +LSII   +   F+   G          +TI +A +S +   + G  L  L+ + +  + +  T I  I   +  K+QP          L L   +S     ++Q  F DP T  +    +AI    +   ISE++   P     SE S H+ T +       V++ +    SGN+      H +D  I    AR E        + + +L                ++S++L+  +++  S + ++ +  + I+L +A+Q  L++ +  + VD + K S++  DA  +G+++               +E I  N+                 T K T++G     +ID +    +      Q  L +  +  +I+++ +           G   KL I  AI E L+ I +G            + +R   Q            ++I+E     I+  +  QY       VF     I+  + I E+    + D +   +   R+   TI  V D+K  + IS+ EA K+  ++   G+Y + K     S ++AID  F+     Q   E+ +E+V                 +E+++   I +V +P TK+ ++   AV+ GI+DH  G  Y         I   +N  ++   +  +  +        +   +   I    DP    +IS   A++ G++DR    + +  +   +++ EA + G V  +    K P  I+ L+T    + +          +P   V + ++        D     +  P         + +     +P+  E I       ++   A+   LF                      + +T  FRDP +D    +  A+A+  +D     VT   T    +++   +K + IP   K V+   T  +E +  + F                               +  +R  + +ME+A   GL               +   G   E +    T +FI++PN+G++  L  AI+  I D      R S +     S+ ++VK GL+ +                 VYN                                 P TG+ T L +G +          L +R++    L+        +SVYD  + + +    A+ + +I      YI+ KT E  +  +  Q GL+  T       M LS    ++   T++     SIP+S
Sbjct: 2117 QLSIIRSTQRGFFDPTMGQVRDPSLGRVMTIEEATHSGVFTFEKGQEL-LLLTAPVCHITTITTKIHPINQFEHPKVQPSRELAVAKKKLTLSQAVSRGLVDEQQGTFTDPATGQKTSVENAITSGRLGL-ISEVIQAHPMDFDVSETSHHVETGKDSRMEVDVRDSYKQETSGNMQTFRETHVKDRKIA--RARVEEEDDSDEEMEEEIL----------------TLSKSLLHDLLNAKSGYFLEKSTREYITLLDALQKELISRDSAVFVDPQTKDSMNIEDAIRRGFLESTGHYTDALGKRMSLEEAIQKNIVIFRNKEGGVITQALKETHKFTVIG-----VIDAQTGAHLPVGKAIQLGLLDQSQGLYITRNRM-----------GQPVKLPIRNAIQEGLVIIDSGATRVTRVEETQTLSERITYQIKAVKDPIFRTPMAISEAVKTGILNPSNGQYTNTETGQVFQLSEAIEKGLVIAEVVKGDSTDGSGSKIVTRRQTTFTIKAVIDAKSGKQISVTEAMKKGILDQVQGVYINNKTYETLSLSEAIDKGFVIAEAGQLKREERQEKVSSLHIEDDLEEVASEEVAEQVQKIVIRTVTDPRTKKELAYDDAVQQGILDHARGLYYNPTTGRSMAIADAMNSGLIQAEVTMVTREAGMSVSTARGTKDGFDIESVVDPRFQMVISVDRAMKAGILDRDLTTYTHPWTGLQVSVKEAVERGLVNPQD---KSPFHISQLVTTVFQELEQKQAEEKRNAMPEDAVEIKIDHQAKETDTDSITITMDAP---------KVVSKKTGEPVSSEAISIEVTSALSFKSAVKLGLF----------------------NTETGKFRDPASDETMSLNFAIARGYIDPDAPAVTDLPTGKSYTLKEAFDKNIVIPYSGK-VNRNITNFMEIVLDDIF------------------------------FSQTSRSLNMNMEDAIKCGLLDTSSGAFHHPIKAESVTIGRAVEKDYICGTSVFIVDPNSGQRFTLAHAIRAGIMDSEIGEFRDSQSGRKLLSFTDAVKSGLVES-----------------VYN---------------------------------PVTGEVTDLSSGEK---------VLLDRAIKLGQLDANE-----VSVYDFDVGRRVPLDVAMRKGIIERRSGNYIDQKTGEKKSAKEMAQLGLISITGAPVLHGMSLSEAIQSI---TVKRTAKISIPKS 3204          

HSP 9 Score: 82.0333 bits (201), Expect = 7.340e-11
Identity = 126/568 (22.18%), Postives = 235/568 (41.37%), Query Frame = 3
Query: 6396 GFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIR-DNCGHIITLNDAINEDLFPEFVPTDKNKI-TFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILD-------HPQSNVTVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLL 8072
            G V  + +  AI SG I          ++E  +I    P S   ++  DAI +GLV+ K     +  + + +++ EA +  F+       K  T+++++  GL D  +G++T P  E  +TL EAI  + ID     +KHP  G+ + L+EA+E +L D    E+   + G  I L  A++  +       D + I  + + L +G+ D  +    DP +  +  +E+A+   ILD        P++N  V +    N++Q            VDT T +  +  K       +D    Q VK+  + Q   L V  DE I          ME+ +  GL       N++++  I         ++++++++  P T   L++ +AI   I DP + ++    +    + +++   GL+       R  E                       +   Q ++   ++P   +  DP +G+  T++  ++N  VF + +                  +Q     D    + +T  EAI   + +    T  + KT+E  +++DA   GLL
Sbjct: 5160 GSVQGLTLQSAIESGLI----------DSERTLINL--PSSNQPMTLSDAITQGLVNPKSGEVMDVSTGESISLLEAYNSEFISDSA---KALTLSEVVQLGLYDDQTGLITGPGSEKKITLREAIQHSLIDPSSKEIKHPSTGQMLTLQEAVEQNLLDLDSGELLISHSGERINLATAVDMGVI-----LDTSAIPPYLQQLVEGFWDKSSGRIIDPVSGKMLTLEKAIETGILDPNKLLLRDPETNEAVPLL---NAIQT---------GIVDTSTGRVFDPTK------GKDISFDQAVKEGRVIQTQLLHVPEDEDI---------HMESGNK-GL-------NKAISDGIL--------DSTSKIYV--PETHEMLSIPDAIALGIVDPEKGVVN--ISQKQLTLQQAGHAGLL-------RKPE---------------------LPRTFTQAISCGALNPSTGIYTDPVSGRQMTMLQCMDN-DVFDSTVK----------------EFQ-----DSWSGKEVTMSEAIQLAIFDPETCTVQDSKTDERLSITDAQNKGLL 5610          

HSP 10 Score: 77.7962 bits (190), Expect = 1.392e-9
Identity = 213/1140 (18.68%), Postives = 477/1140 (41.84%), Query Frame = 3
Query: 14700 RVKKQSESTTKA---LESQQQQ----LDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILAN-IEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRIT--DSYQP-SVHPEKLDEELGVFDEILYDL----DKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIED--KFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWF---KEVNNRLF----------ILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIK-NQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGK------AIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSD---SSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIK 17999
            R+ +Q E  +K    LES  QQ    L E   ++  F  +   + +W  +T + + +    +   D + + E+E+K L    +++  +L+    +   +S  V     K  L N +E   K  ++ K  I  R  DL+   +   E  +    CA+ ++ ++  +T  DS QP S     L ++L   + +  ++    D+L++ +DK Q  + +  PS   A+       +  KL  I      L+ +    K K+ +    ++ F   L  +    +F E  + +       L    V  + K ++ L+ EI     +   ++ +G+ L++ V       DV++  + +    +AV    +     +D +  L+T LE+M  KL E+F   K+++  L            LG +   +R  L  IQ  +E  + ++P+   I+   +L   L      N K +Q+ S +  +++ + +L   +      ++     +    + V+     +   E  L  +     D + +E  L + +   A ++   A+V++ E +   ++ +     G     ++E L+K    + +    +  EL   + +   F+   +++   ID    + E     GG  D     LK+ +   +TF K +++  +   E      +   S          +E D+E L+ KW+ +      R++ L+ A+     F   +   ++WL  TE+ +  Q+  S        Q++  + L++ +   +  +  + K+ + L   ++  D   +   ++ I  R+E++ + ++ER ++LD     AK F++    ++D + +  + +     +     KIR+Q+   KE +  +  H     +  + G +L      ++   + E +  L++++ +L  KS +R + +++ L L+  ++DA    L  L  +EP+L     S K     +  +Q  +N    +   +    H + K+   +          ++ IED + +    +  + +  ++K  ++  +K ++ E  +  + L ++F ++   ++  T  P      ++   + +H    + +  N+ K  +    G ++L     E +G+I+  ++ +K
Sbjct: 7401 RISQQLEEISKKWNNLESSLQQRENTLKEVQTVSAGFYDAIQDIGEWAPKTMDRLSRQASISSQADIMREQERELKDLEEEAKEKTKILEDARNAYGKISDKVKDQSTKQDLKNKLEMMDKSLSDTKRRIAGRKADLK---VAMKEGEQFTQSCADLMDWVQGAMTELDSGQPVSGDDLTLKDQLRQHEALQKEMDDRQDQLKLLLDKGQQVLTSTPPSPATAD-------LQNKLDTIKLQWDALEKKATHRKRKLSDCNEKSSAFHQSLDHMTTWLQFAEEKLEMMEPVA--LERMKVIQQHKDVQTLQTEIVRKTHNHESLNTQGQTLMQNV-------DVDK--QVVADQLDAVNQRWDSLNKAVDDR--LLT-LEDMSQKLHEFFDLIKDLSTSLSKYEDKLSSHDALGAVAKGSR-YLHIIQSLQEEVHSMQPQ---IDYTQELAQSLISAGPANAKTSQITSRVDEVSERYEKLAQEVDSWLASIETGSQVVTGAQQQVNTVGRQLQGFEEDLEKMDACGRDPHVVEQQLQELQAFSAQISEGAAAVNEAEERCHNVMSQGYIGHGDPMLAQVEDLKKQHSRISDRVAQRQGELSGMMNKLDDFHDSLRQLHTAIDRAAEEQESQNPVGGNADN----LKKLLQELKTFEKKSLEPIQKQLEVVSKQGQQLVSSAAPGVSTSGLECDIESLMDKWNELNQKVRDREAALDDALLQSGKFSEAVSALLDWLGETEELMEHQKEPSADYKVAKAQMQEQKFLQKMLEDRQGNVEAIKKIGSKLS--TEDSDGQQVSAQVNDIVKRYEELKAGATERRQSLDTMMTVAKEFQEKLEPVIDWLDTTEKKMASAEPVATESEKIRQQLHHQKEVNEEVADHGEDLAAALKKGEELLQLCNGEERAHVQEKLDELKLRYSALNEKSADRLQQMDEVLPLAEEFEDAHGKFLDLLNRLEPELRGKDMSGKEGENQLEEIQAQMNNLVPILTAVSQTGHPLSKLAIGSAG--------AAEIEDLINKDTKRFEALKEQVDKKAEKINFSKQRSQELLKDISDLMDWFEQTGRLIQ--TAQPISSDPGVLKEQLQDHKALTEEMNQNKGKAREVVTIGRKLLRETSIEDDGTIQDKMDDLK 8496          

HSP 11 Score: 77.411 bits (189), Expect = 2.223e-9
Identity = 188/1016 (18.50%), Postives = 428/1016 (42.13%), Query Frame = 3
Query: 14274 EKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMS------DQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAV-DRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQG---KNILANIEDA----------KKRYNNIKEFIKTRATDLEDLILINTELNE----KVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQS-------------QTMEYKEKIMNLLSLAN---------------EFWNDLKLIEDKFHE-----MTIHLTNSTIEDLNT--------------RSVNDKKKLIED-LRGEIDVHEKD--IGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMR------MKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIK--NQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTN----------IKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKA-IEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDIT--SHREEMLNLDKMATHLKYISQKHDI--VLIRNLMSSIHHRWEKV 17030
            E +VC        L+ + A +  +E VE    + E +   +  ++  +++ + +   +++   E+LD   + L+N E KI  +       D +    SE+E  + D        + Q++++ S      ++I+ +     KS+++ + D   +  E+ ++A +++ + L+E       F ++     +W + T +++       L+P Q    ++++   A   + Q P L+ +   G  L +    ++    K+ L N+E +          +++   ++E   T   +L  L+L+  +  E    ++   A ++E ++ +  D  +P      L EE   +   + +++ +    D+LQ G  N SP R+    +  S+    +L   S +  G +S                  K  + N LSL +               E  ND  L+ D+  E     +++      +E++ T               S +  ++L++D  + E ++H K+  I  + ++  +L++   + + T ++ +  ++L+  F   +++CEQ      R++SL   +E+M+        LD+W  +    + +LGP+ TE   +  Q+++ K L+ ++       E + Q G  +     P  K   +++  L  I+  W  L   L QR++ L+ +      F+ A+ +  EW   T + L+           ++ +  ++  LE    +   I  D   +   +S  ++   +  K+D+ +       +LE + KS  + K     +  +L+ A+KE   F     ++   +    ++L+  +   G   T K+QL++   + +       +++  +++  ++   +  S   A ++  ++ +  +WD ++  A  RK +L    E    FH  +     WL   E+ L    PV+     +++Q +  + L+ +I   +H  E LN     T  + + Q  D+   ++ + + +++ RW+ +
Sbjct: 6778 ELIVC--------LRELRASDVQIEDVEHRMNDVEDQHGFITADLMSRSSVLQTTMVQSQGVRESLDGLTDWLTNVEAKIRNLRPISLNRDTLKEQMSEIEVLQADI-------DAQQQAVESVNKKGAEIIKNSDSEVSKSMQAKLKDLNTRFGEALSRA-DTRVRDLEEVSDRLTAFQTALKNFDEWCIPTLDSLDSKTTLQLEPAQF---KEKVDIFAQEKDSQLPYLEKLRHLGKDLIEDPRTMETGLVKDALTNVEHSWHDITALLSEREKDAEMREKHSTGYANLRTLVLLWLDGFEAKVYELQPVAVKMEVVKKQ-KDELKP------LIEECENYGTTIDEINDVGNAYDQLQQGERNISPIRRT-RQRVSSLRSPSRLKTPSPTRSGPKSPGYVNGSVSSESSGVSSRKSSVDNFLSLEDLTETQCQLIDINQRYEMLND--LLADRQAEIDRTLLSLEAQKVDLENVKTWLQEHKVDPAEHVPASQSKSQQLLKDHAKFEAEMHSKEDLIAAMKERVTELVKNKGDQSGTAELVKNLQQLEEEFTDAKAACEQ------RRRSLANMVEDMKEFKDTSRHLDKWLAQKEKMVAVLGPIATEETQIQNQLEQVKVLEEELAGHQHQYEQLVQAGSSILDQCEPESKEAQRISQQLEEISKKWNNLESSLQQRENTLKEVQTVSAGFYDAIQDIGEWAPKTMDRLSRQASISSQADIMREQERELKDLEEEAKEKTKILEDARNAYGKIS--DKVKDQSTKQDLKN-------KLEMMDKSLSDTKRRIAGRKADLKVAMKEGEQFTQSCADLMDWVQGAMTELDSGQPVSGDDLTLKDQLRQHEALQKEMDDRQDQLKLLLDKGQQVLTSTPPSPATADLQNKLDTIKLQWDALEKKATHRKRKLSDCNEKSSAFHQSLDHMTTWLQFAEEKLEMMEPVALERMKVIQQHKDVQTLQTEIVRKTHNHESLN-----TQGQTLMQNVDVDKQVVADQLDAVNQRWDSL 7744          

HSP 12 Score: 70.8626 bits (172), Expect = 1.760e-7
Identity = 110/488 (22.54%), Postives = 212/488 (43.44%), Query Frame = 3
Query: 6444 IEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRS-MLKHPDNGRHICLREAIENDLFDPIRCEI-RDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNVTVYMT--DVQNSV---QNKTLEIPNEEKFVDTK-TTKTLESIKRNYFGDDQDSKLIQTVKDASIRQ-ELPLSVATDERITAVNRKPSNSMENAHSLGL-KSPKLSTNESLTSNI--TSLTGSNTENNSTQLFIINPN-------TGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGV--GVTAKLT-NQMLTENQIDPINQLIKDPKTGKSTTLINGLENG 7838
            I  +D+ ++S   +  +  FKD  SG ++   DA+ KGL++       +  S  I+T+ EA  L   L  K +    T+ + I Q + D  +G V  P     +TL EA++   I  + + +  HP    ++ L+ AIE  L D    +I   + G +++L+DAI+      ++ +    I+  EA EQG +D  + +  +P +      EEA+   +L     +    M+  D  +++   Q++  ++  + +  D    +K +++ ++    D + +K  + +K A  R+  LP   A    +  +   P    E  + + L K+ ++   E+ T      S  G  T + +    ++NP+       +G KL L+EA+++ I D                    ++ G +++    ERL  ++  +R  +  +     KG   G    LT    L +  I+    +I DP TG+  T+   +  G
Sbjct: 5821 IHTLDDAIRSGQIDFNLSVFKDLQSGQMLPVEDAVGKGLINPSTGQV-HLPSGHIITLAEA--LERQLITKKKANFLTLGEAIGQEIYDPHTGHVADPESGQEITLQEALDREIIHPEHAGIFIHPVTQENLTLQGAIEVGLVDGQAGKIVHPDNGMLVSLDDAISNG----WLISSATPISLSEAKEQGLVDFSSGSIVEPTSGQELTFEEAVKAGLLQDKNVDTLRNMSAEDFDSNITDLQHEAFKLEAKSESHDAADMSKQIQNTRQVKSLDMKGAKESEKIKPAITRRPRLPSPTAPKSPL--LEAMPG---EQCYGVSLSKALEVGLYETKTGRFYDPSSGGHVTLHQALNCGLLNPSGREILDQSGAKLTLDEAVQKGIVD--------------------LRKGFLIDPNTGERLHMDQAFERGLIAPS----EKGEVNGHVQGLTLADALQQGLINTTTGIITDPVTGRVHTMGEAVAQG 6272          

HSP 13 Score: 69.707 bits (169), Expect = 3.767e-7
Identity = 60/247 (24.29%), Postives = 115/247 (46.56%), Query Frame = 3
Query: 5124 SEILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFD 5864
            S +L   P E  + ++  +A++   ++ ++G  +D +   ++ LH A   G+L+   S  +I+          D +  K ++ EA+ +GI+D    F I PN  +++ + +A + GL+  + K  V+ +   L+  DA  +G I     +I+ P    +H       T+  A+  G+ID      I+ IT +  S+  A     ++  +++  T    + +  N  LTI QA  + LI +K  Q  D
Sbjct: 6116 SPLLEAMPGEQCYGVSLSKALEVGLYETKTGRFYDPSSGGHVTLHQALNCGLLNP--SGREIL----------DQSGAKLTLDEAVQKGIVDLRKGFLIDPNTGERLHMDQAFERGLIAPSEKGEVNGHVQGLTLADALQQGLINTTTGIITDPVTGRVH-------TMGEAVAQGLIDGDASMVIDPITLKPVSVSVA-----LASRIMEPRTGKLRLPDKFN-SLTIEQAQEKGLIILKGKQHGD 6337          

HSP 14 Score: 66.2402 bits (160), Expect = 4.742e-6
Identity = 80/326 (24.54%), Postives = 148/326 (45.40%), Query Frame = 3
Query: 5019 FNPISDKQIKFLDPITNT--ELKYTDAIRYQYINDDISEILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILS---KPIS---ILQIVLEKDEFPFLVDINNEKS-SISEALVRGIIDGNSEFSIKPNFSQKISLFEAV-QNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFI--SKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCP 5960
            F+P S  Q+ F+D  T +   L    AI    I  D    L   PS N   +T  +A+     +P+SG + D +    I L  A     +S   K ++   ++Q+ L  D+   +    +EK  ++ EA+   +ID +S+    P+  Q ++L EAV QN L  ++G++++  +   ++   A + G I L+ S I    Q+++                G  D  + + I+ ++ +  +L++A E   +  +K LL+D           NE + +L AI   ++D  TG++FD +  + IS     +D+ + E +  +   L  P
Sbjct: 5147 FDPSS--QV-FIDAGTGSVQGLTLQSAIESGLI--DSERTLINLPSSNQ-PMTLSDAITQGLVNPKSGEVMDVSTGESISLLEAYNSEFISDSAKALTLSEVVQLGLYDDQTGLITGPGSEKKITLREAIQHSLIDPSSKEIKHPSTGQMLTLQEAVEQNLLDLDSGELLISHSGERINLATAVDMGVI-LDTSAIPPYLQQLVE---------------GFWDKSSGRIIDPVSGKMLTLEKAIETGILDPNKLLLRDPET--------NEAVPLLNAIQTGIVDTSTGRVFDPTKGKDIS-----FDQAVKEGRVIQTQLLHVP 5437          
BLAST of Dystonin vs. TrEMBL
Match: A0A1V9X9D5 (Microtubule-actin cross-linking factor 1-like OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_11811 PE=4 SV=1)

HSP 1 Score: 939.873 bits (2428), Expect = 0.000e+0
Identity = 672/2409 (27.90%), Postives = 1229/2409 (51.02%), Query Frame = 3
Query: 12429 MEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENL-AEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANND-----PELAKL--LNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEY---------------QKSHYXXXXXXXXXXXXXXXXXDQVNLFE---DTLYGFESAMKDLKLNIVDPYQTRDIWEESLN--------LVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLD-------KLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMR------MKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ-RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKA--IEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALM-IQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL----IPIFDRSKRMET-----------NQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDH----------DGRVTRKEFIDGIIDS------KVC---------------------------------------------RHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCR-----VLHCGDCECVCHFSMS---SLELLEAKGRTNYELREKLSNPKGTINTMAPFKFK----------PATLPI--PTKKPTTAKIPSPR 19214
            M+++  R++ L++ L  K   L++    M +  +R++   T   +L ++ + F   + D+ +L  Q+ ++   + + +     L   + E  N+ A+  I+ A+    ++DNL     ++ E  + R++ +    + + +F     D  R + +A+N+     P  A +  +    +    F    V+PL K +EE+  +G     T  +G+    +E +++ +   +++L + +++ E  +D  L+   KF  +L +++++++     +  ++ PS +Y   K+QL   + L+  ++ RQS++  L + G D++ N    ++S +Q+ L+++  +Y+ L + A+ +    +R + ++KSF+D   P + WLD +EK L    T PT DA    +R QE+K+L  D        ++L  I   + G+  +  +    + + +L DR++                 +    ++ + L +  ++      ++  F    D L G+ S M+      +  YQ   ++ E L         L +++  H+  +  +   G+D+ + ++ +D+  +  +++ L   +++++  A +++   + ++PIA+ F   + K+       +  + E +++   V    +   E+  + +E+ + Q RN ++       +L  +   E +   +E +     +RF  +  ++ +KA +I  ++ +      +LD+  +   + E+++ + ++ I  D   L     +   +    + QK  +   +  +KKL+R++ G D   ++   + +K  S   ++    +   L++A+PLA+ F  ++  L  WL E E          L+P Q+ K + + KAL  S  D KPLLD + K+G  L ++V   +G+ +   +    +RYN+++  +K +   LE+ +    +  +K+D   N L N  D++ ++   S H EK+ E++   + I+ DL+K    +D ++   ++     K   D+    +I +KL+K++     +Q    +    + + LS A  FW++L  +     E+  ++       +   ++  ++ ++ ++R EID  + ++ +  Q G  L++    P++ P+V++  E+L + ++ V +   +      R+QSL   L +          L E+      R   LGP+ +E   V  QI   K+ K+D++P    +E +N+   +LT+ + P+    +   L  IN  W  L  G+  RQ +L+  LL LG+F  A++E + WI  T+  L ++KI  GD   +E+ LA+HK++  D+   Q++V  + +   ++I+ D SS     TQ +L  L   W+ L++ A  K  +LE AL+EA +F  + Q++   + ++  +L   K  GGLP+TA+EQL RFM++Y    +++    K     ++ +    +S G A  ++  ++ L  +WDTV   A  RK +LE A+     FH  + +F++WLT +EK L+  + VSR++ ++LEQ+E H+  ++D+++HRE MLNLDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+++ER+R LD+GYKEAK F D    L   +      +E   ++G  P +I+  ++KHKEF   L     TYD+T R G  L+DKAP QD   + +++ +L+ KW  +C K++++++ L +ALL SG +KDA+  L+ WL    P L D +++  GD++TV  L+ +H   +  L++R   +E +   +  L+   S ED++ I  Q+++L+S W NV  L+N+K+RRL++A  QA +  +  + L E+ S +E +LR F   P  + E      I+ H  F K +              HEIL   +P+A   I+H+I II+S+W ++  W++QR   L+DHL  L +   LL++L+ WL  AE TL A E++ L   +   +   ++H+ F+ DM+ +Q D D I      KT P      P    S+   T            +G +  Q     NP+  +L  KW+ VW M L R+KRL DH++YL+E+E ++NF+F++WRRR+++W+N  K R MD FR+ D D+          DG +   E+   +I S       +C                                             R   + F T+R+EME VADIFD+   G++D+++++  LRPDR+    +P  E E I DEV++Q++KCTC + +K+ Q G+GKY+FG+++KLRLVRILRS VMVR+GGGW AL+EFLVK+DPCR      L         + S+S   +L++   KGRTN ELRE+     G   +MA FK K          P  LP   P  K +    PS R
Sbjct: 6022 MDELERRHRDLTNKLEDKCHELDAAAGVMAQFNNRLKSIQTNFGHLEDEFNEFGPIARDVRTLNAQMSEIRTFKGKLHSATDELEESEREARNIIAQGYIQDAKGLRTQLDNLKKQLGRLNEKANKRESGIEAMLEKLQKFYEDLGDVQRSLSDASNEERNFRPVAADVETIRQQQEEFKHFRRNFVEPLGKAIEEMNRVGQGLIQTAPAGVNTAQLENDIEKLNSEWNQLKERMNERERTLDAALLHSGKFQEALTSVEKWLQETEEMVANQKPPSADYKVVKAQLQEQKFLIRLIQDRQSNISSLMRMGEDVMKNVAPAERSNIQHTLEDIRDRYDKLQSGAKRRMDALERTLPVAKSFQDKMAPLVDWLDHSEKKLTAMQTIPT-DANRAAQRAQEHKNLHRDILDHKRDFEELTEIAQTLMGLVGDEEAQIVVDSLRELTDRYARLVEESERLEEMLQNAKEGKQQQQQQQLRQIESVAFLSRSRIRAFSENYDELLGWMSEME----RRLQRYQILSVYSEKLQQQLEELTELGEDIADHQRQVDQVVSAGQDMMRFATGDDAFNLKDRLDNLQARYNDLASKAAERVRQAQEALPIAQNFHQNHEKV-------SNWIDEAETVLKSVESAGLNTQESAIHRLEQDIPQVRNIIEVVNHLGPQLCQLSPGEGA-NVIESMMTRLNRRFDAICEQIQRKAERIELSKQRNSEVIGDLDELNDWFRDLEKQL-QHAEPIIPDPDALSAMLKEHKAICEDVSSQKGRVRDLLAAAKKLMRESTGEDQSLIRDKAENLKDISNRVSQLCADRLSALEQALPLAEHFFDTHAELVQWLEEMETEAELLGAPALNPAQIKKQQDKNKALLQSMNDHKPLLDKLNKTGAALIKLVPMEEGRKVQYIMNQDNQRYNDLRNLLKNQQQALEEAMQSTAQFADKLDGMLNALANTADQLNNAEPISAHVEKIQEQISDNNAIVDDLEKKSSALDAVRKAAKDVI--SKADGDEPAVRDIKKKLSKLNDLWDEIQGLASKRGRSLNDALSAAERFWDELNAVMRALKELQDNINAQEPPAVEPSAIQQQQDVLHEIREEIDNTKPEVDQCKQAGTDLMKLCGEPDK-PEVKKHIEDLDQAWQNVMTLYAK------REQSLADALSKAMGFHNTLQDLLEFLDSAEERFSKLGPIASEIVTVKHQIADLKDFKDDVDPHMVQVEALNRQAKELTERTTPDQARPIREALKDINKRWTALNKGIVDRQKELENALLRLGQFQHALNELLTWISKTDRQLDDVKIVVGDPQVIEVELAKHKVLMNDIQAHQSTVDSLNKAGHQLIELDRSSRDAGETQSKLANLNARWQSLQDKANDKQRQLEAALREAQLFSQEMQDLLMWLSDVDQQLASSKPVGGLPETAREQLNRFMELYN---EIDSNRHKVENTLSQGADFVRRSDGSATNLQHSLKTLKSRWDTVLQKANDRKIKLEIALREATEFHEALQQFVDWLTDSEKYLSNLKAVSRLLPSVLEQIEEHKNFQKDVSAHREVMLNLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAKEFHDSYEALDKWLTEAEHTIEDLANVGNDPERIKRTLSKHKEFQRALAGKQATYDATMRAGRLLKDKAPKQDVPTLQKMLDDLKEKWNRVCAKAVDKQRKLEEALLFSGQFKDAVQALIDWLDKSVPTL-DPNEKVHGDLDTVNNLIEQHKQFQADLKNRQANLESVRKTSRELLRTASSEDAAHIRQQMSDLESKWENVMSLSNQKQRRLDDALRQAEQLHKSVHMLLEWLSDAEMKLR-FA-GPLPDDEATCRQQIAEHQRFMKEMEQQGHNKEKTITLAHEILQKCHPDAVSVIRHWITIIQSRWDEVSQWAKQRLQKLEDHLRGLRDILDLLEELMRWLLGAEATLTALEAQPLPDDIPATEQLIDDHKIFMDDMSRRQPDVDRIAKAFTTKTAPQPATKTPAGRSSRGPHTRAGTPGRAGTPTRGAAGEQAGTITNPRARELIDKWQSVWLMALERQKRLQDHLKYLRELEGIRNFDFDEWRRRFLAWLNAKKMRAMDAFRKIDKDNDGKVTKQDFIDGIIESSEWPQSVIYSITSIRHSLCTTRTLPALVTISVTDRRQTEPGPLRPTDRNLTNTRNAFTSKNVRMRFYVAGFPTSRLEMEKVADIFDRNGDGYVDHKEYIDTLRPDRDN---RPLTEAEKIQDEVQRQVAKCTCVHRFKVFQVGEGKYRFGESQKLRLVRILRSTVMVRVGGGWVALEEFLVKNDPCRGSREDALLLTKLIIERYQSVSKPFALQVPHTKGRTNVELREQFILADGVSQSMAAFKSKGPGASSFGKGPGGLPTQGPITKTSYLGCPSAR 8398          

HSP 2 Score: 356.681 bits (914), Expect = 1.250e-93
Identity = 293/1195 (24.52%), Postives = 581/1195 (48.62%), Query Frame = 3
Query:  723 FQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFEL-------NPKEEDIEEKIYQFRNQYADLYA------------NLNSALEELNDDF-DHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNN----ENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKFEKLSPPTLSS--------GVISNRQ-YTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGL------NKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQS-KNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLILFVKNGMSETVGLKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIK-----ILIAQLEAAQDTISSVVGNLKDVPTNLDQLISAVTT----SRQNQKDV-SYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYEDIFKNYQNEIQ 4151
             +  DI  +  ++ L+ ++ LL+W+++  + YP + + +F++SW+DG AF A+IH+ RPDLID  S+S+++ ++NLE  FN A++EL V ++++PEDV +   DEKS++TY++SL+ +       NP E++ +  I ++R+  + L              +    +EE+   + D+  FR         N     L + +    L+ D+ K+ R N    ++Q ++  + T W K     +++   L +E  ++++ E+++  +  E  T   K+++IE++IR++   + +   ++         ++L   E  I  +   VQ L  DG  Y + + +R++ N+  K + V+  +E+     L++         V+  RQ ++    +E  D   +  L +   W+ EK   + +  + NDL  +      +KI  K    F +  D+    K   + +     ++DF+      L+  ++++ +  +K  +D  + LEF+ +++E I W+  +E+ +I+  W  T +I L E +    +L  +LE RE   +  +  G+ L    H A   I + L+ +   W W++ L H L+ HL     Y+Q+F EA E +  +  +  +LN+ F R +   +DEGE L +++ DM E I  Y   VN +I  S+ +  L  R   +    RVN  A+C+  +       +  + E   L +NS    W++ N +      P + F I   +P+A   A +L   +  L  LWTK++ +LR  ++ +T+D+VK W  + F  +EP  R+ I+  LN DA++L+ +    + ++ ++ +    +   N  + +L    +  ++     N  +SP +      F      LD L+    ++L +   +L  P+  D+D L++    HK+FE +L +YE  + ++ +  K    +T   + K ++++ LW++LW    ++  +LK+ E+  S L E  Q +  +E++L +  E+ P   + ++     +L  QLE  Q                 DQL++ VTT    + +++ +V ++ D+++L  + K V  R+    NQI +RL      S      +N++   + W    Q T+K  +N    V  S++ E   ++  +    + + KP ++++N     ++   + Y+   KNY++ ++
Sbjct:   21 MEISDITFNQNNEVLTSREALLRWAQRTTQGYPGVKVRDFTSSWRDGLAFNAIIHRNRPDLIDWHSLSRHTVRENLENVFNVAERELAVTRLLDPEDVDTAHPDEKSLITYLSSLYSVFPEPATRNPFEDEKQRVIDEYRDLSSSLLLWLKQNVPRLQSRSFPDRIEEVKQLYQDNAAFRT--------NEMPPRLSEKQRLQTLWRDMQKMMRENRVQMDDQLRYDFLDTQWKKMLHAHEDRDRALQDEIARLEKLERLAEKVQREVRTTDGKLDDIEARIREVEKDLPRLRPEDAKRTCEVFERDLRRIEETIRMLFKDVQVLM-DGRYYRSRELHRLVQNLQQKWENVRISYERRLIDALNNRQYKIEEKKVVKERQVFSEARLLETNDAFRF--LQQCLEWVKEKMKYLDDAEYGNDLPSIQSLVSQHKIEHKLIDQFQKNVDTCVSRKKHFQGQ-----ELDFYARLLAQLERGYSDIVVQSNKRMSDLDTLLEFVRRAHEEITWLNEREETEINRDWAAT-NINLVELEAHQNSLCHQLEDRELQFDSVLDRGSNLISQRHPAHKTIDQFLSAMHHTWSWMIELVHGLQIHLRHSQDYQQYFREAKECEQWMQTVEERLNTTFSRTV-FSIDEGERLLKQMHDMREDIPRYSAIVNSLIDRSKDILPLKQRRQPLPRPLRVN--AVCNYSQG----NMKIFKNEQCWLHDNSQRTRWKIINQKGAEGMVPGVVFAIPPPNPEAIDLAESLKRKYELLIKLWTKKQHKLRLNMIFATIDIVKGWDLKTFKAMEPSQRESIIRALNDDADKLLAE---GDKNDPDMKRLRDEIKFINKLYQDL----LRQLKEEEAENSPNSPAR-----RFQETSTNLDQLLREKERLLVQ---RLNDPIPRDLDALDELHSLHKDFERDLGSYESMIAEMKVAFKQMTKKTPTQQDKHDKIVALWDKLWTLCRVYAERLKAVELAISSLKESTQAVSNVEISLAS-YENLPQDEEALRKIHDDLLAIQLEMQQQQ------------PLFDQLVTNVTTVKKVAEKSRPNVYTHPDLRRLDDDAKKVLKRWSDALNQIAERLRSCEAASEMLRAYRNKMDEEKQW--ANQMTIK--VNTIKEVKSSRDAEREYQQALSLFTSLTERKPALEDLNLVGGRYIREAKIYDLRNKNYRDSLE 1159          

HSP 3 Score: 110.538 bits (275), Expect = 1.856e-19
Identity = 192/954 (20.13%), Postives = 408/954 (42.77%), Query Frame = 3
Query: 8775 VEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDK----INKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICE-------NSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEIS---NDDTVYSINNLDLWLKEIDQRIK-NIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNN-----ASRNEPKLKELD---DKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKC----------LSF--------------------DQEY---KEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFD----WEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSR 11456
            V +L+ ++   +    +  S+  D+R L  +  KF+D+    + +L E R    D +            + E+   +NEVT+        Y+T L+++  + + L  L E ++   +  E       +++++ +K+L          +    D +   N +++  S++I     + ++ I  L A    +  I    K    +L + Y   + ++ I ++ NE +++   + D    +N L  W+ +++ ++K      SL  + ++EQ    + +  EI S++  LE +         A + E KL+++    DK+  KL     +   +++    L  F        DW++   + + +    R   E+ + +L+++      K+ D E   +  +EL  + +  D + I+  +  LE++W  ++  +  + +    R      Y  L+AK++E L+  E  +    P+++D  A+  Q  +I+  + E    +P I++  ++G  YDS++           K +SP RK + +  E+ + PL+ TS +     ++RQS               + ++  + S    ++++I  RY  IG +L +R+ D+  L ++           L+F                    D++Y   KE  + L    NE+  V+++                                 +LLR +    G   L+  L  L  K+ SL+   +  L+L  +     + F +  K ++N + +K++M  VLGP+        AQ+QQV+ + DE    E  ++ +   G EI   +   +    ++++ +D + K+ D L   L++RE N+ +  G +++F++ IN + D L  + +  ++   +     D       ++ +L+  + +L E E++   L + +SD  +  EIK+K +   R
Sbjct: 4822 VSNLRDNMDQFRQFSTDVISHQADLRFLTMAAQKFMDESKTYLRQLNEIRTAHPDRL------GHIEAYESEVKSQVNEVTNA-------YQTLLTRVNKLSDQLGGLGESKRNYHEAVEKATVWLNDAQKQAKKLLEEPTGAEPRQIQDQLDRVRSFNMDIIQQSRLIDNARHAGESLINMLPAGSPEKSQIQETVK----NLQDVY--QQMVNLIGEKTNELQMALVHSQDKEDGLNRLLKWMDDVESQLKLQSRPASLIRERLDEQIHEHRVLTQEIESQRSVLEAMSQTAQQTRLAKKVEQKLRDMHSRYDKVLDKLRKNGQV---LDEVSTQLDQFNDQCSRFEDWLSQLIDAIEEAGAAR-SAEEVQTRLEDVIRRKNQKKSDFEDVVRAGRELTGRRDVTDTSIIKDRLRQLEQLWKEMDVRLTEQERSNRQRMEQLSAYETLRAKVLEWLSTMENKIERLEPVSLDKDAIRRQAMEIKPLVKEHADYRPTIDKVNELGRIYDSLVSEERASSRMSIK-SSPTRK-TAMMPEVRS-PLAETSGSTS-GFSSRQSSVEQ-----------FASIELDVSPVQQQLSEINHRYQIIGVKLSDRQRDLDGLADEVKRHHDTIKSLLAFVQTKERQMPKEVSPASKELADKQYSILKEIQNNLADRQNEMDRVKIEVT-------------------------------ELLRRKPNAIGADSLQQSLHELVSKWSSLQAQIRDQLSLLND----FRDFQDTHKLLDNWLNQKDKMFQVLGPIAHEPRMITAQMQQVHVMRDEFTSQEPLMRRMNQSGNEICSKLGQANPAARKVKDGMDDIRKRWDELLGRLEERERNLDAATGATQEFHQAINKLQDALQNISDNFERLGDDGADVHDQLRRLGGLEDDLERQRPLLAEVESMCDHLCDILSDPASKSEIKSKFAAADR 5702          

HSP 4 Score: 104.76 bits (260), Expect = 1.053e-17
Identity = 142/638 (22.26%), Postives = 261/638 (40.91%), Query Frame = 3
Query: 5349 NNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTEN--------GKIIVDKNKPSLSFLDAFN--------------KG-YIKLNESLISG----PNQEIIHPNLTQ--KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFIN--------------DDMG--MYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDP-----IRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNK------ITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNIL 7094
             +++ S+  AL  GIID  S   +     ++ S  EAV+ GLVT            ++  +++  L+ LDA                KG  + + +++ +G    P+  +    L Q  +L++  A   G++D +  + I+ IT E +++++A+  K I                 N+E LT+  A++  ++D K G++ D  +     +NE     ++       +   +  ++    +I +  IN+   +                 D +  E + L  ARKR  I               DD G  +  H K RI  S  +A+    +  N                       I  + +PI++E +S  +A+  GII   + + K +N       + I EA+  G I ++ + +       ++ GF+D  SG  +S   A+++G +  K   F +T S + +T+ EA     +L +  E+    I      GL D D+G       E+S  L +A+ +  ID     L+HP     I LR+A++  +  P     +R  +R      IT++ A        +V            I+F+EA+ +G I+    TF+ P++  V  +EEA+   +L
Sbjct: 1385 TDQRVSLKVALRCGIIDSKSGKFVDTKTGRQYSPDEAVEVGLVTRQYLDVLQAPCGLVDTRSQQELTLLDAIRFRFYDPQRQTLLDPKGNPVSIQKAVQTGLLRDPDVMVRKLKLIQVSRLSITEAFDAGLLDPQENRVIDPITGESYTIEQAFARKLIEPK------------RENDEGLTLTYALDRGMVDDK-GRLMDNCSGGVYDLNEALTRGVLCSETREVVNRKSGKVVNVPTAIQDGLINVRNGQ---------------YVDEQTRERLPLSAARKRGLITPSLTLKDAEAQDLLDDSGTILNPHTKRRI--SLLEAVSLGLLDAN-----------------------IKCILHPISQEAMSLTEAMHQGII---TPDGKFVNPRTHET-MSIIEAVHRGLISSVCQKMI-----FEVEGFQDTKSGDNVSFNQAVQQGTISMKNRTFKDTYSGKTMTLREAVSKKLILEQVYEMLTKPI------GLRD-DNG------EEIS--LLDAVFARRIDHKTGQLRHPKTLMPISLRDAVKEGIITPEGAALLRGLLR------ITVSTATVTKTITRYVTVQSQGSSAEVGISFQEAVRKGLINEHNATFKHPKSGRVVSLEEAINDGLL 1939          

HSP 5 Score: 100.908 bits (250), Expect = 1.466e-16
Identity = 158/769 (20.55%), Postives = 326/769 (42.39%), Query Frame = 3
Query: 15804 LDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTK--GSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDIN-------SLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEM-FKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGK------AIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILE----------RDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSE-EDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMK-INDFQQFGHEILVSAYPEA--EGSIKHYINIIKSQWSDL 18017
            LD W  + +    +LGP+  E R +  Q+Q+   ++++   +   +  +NQ G ++    G       +V   +  I   W  LL  L +R+  L     +  EFH+A+++  + +    ++   +  +  D++        LE  L + + + A+       V  M     +I+ +  S    E   +     + +  L      +  ELE++LKE   F    +E+    D++  KL   F+ S       ++Q++R+  +YR      +  E  +        +  Q +G+       ++  M+++ K W+ +K  A  R +RL+ A+E  + F+  + KF  WL  TE   N+ RP S   + + +Q+   +  K ++T H  ++ N+  +       +   D   +R+ + ++  RWE++      R+++LD        F D  R    D+A  L+ +E          RD    +T  K++  + + +EFH +L       D  R  G  L D API  D++ I + +  L+ + + L NK  ++   L+ A  +   + + + ++ +    +E + ++       D+ T+   ++E    + +L      +E+   +A  ++ Q   +D+  +  QL  LK     +N+ AN+++  +E    +  +F      ++   S + +E R F   P     E I         F +N +    K I +  + G  ++ +A P       +++ I  + S+W+ L
Sbjct: 5517 LDNWLNQKDKMFQVLGPIAHEPRMITAQMQQVHVMRDEFTSQEPLMRRMNQSGNEICSKLGQANPAARKVKDGMDDIRKRWDELLGRLEERERNLDAATGATQEFHQAINKLQDALQNISDNFERLGDDGADVHDQLRRLGGLEDDLERQRPLLAE-------VESMCDHLCDILSDPASK--SEIKSKFAAADRLYNNLNRKMSNRRAELENSLKEDREFVESLKEVQGWFDDIEHKLSSDFRISAD-EHILRQQIERYEPVYREV----LDKEHEVHILLSKGNEVIQKLGRNKPEAQQLKSKMDVMRKNWEKIKREATERHTRLQTAMENCKRFYSVLNKFGPWLQGTEAKFNELRPPSYQRAELDKQIREIQTFKNEMTRHAIDLENVRTLGDVFLGCTDV-DKEKVRDDLENLMRRWEQLSKAIMNRAQDLDDIAARLGEFNDKAR----DVAHTLQRMEDRAASHDDGARD---ARTLEKMKALLREAEEFHKDL-------DRLRAYGDSLIDGAPIGCDTRHISDTMDELERRHRDLTNKLEDKCHELDAAAGVMAQFNNRLKSIQTNFGHLEDEFNEFGP-IARDVRTLNAQMSEIRTFKGKLHSATDELEESEREARNIIAQGYIQDAKGLRTQLDNLKKQLGRLNEKANKRESGIEAMLEKLQKFYEDLGDVQRSLSDASNEERNF--RPVAADVETIRQQQEEFKHFRRNFVEPLGKAIEEMNRVGQGLIQTA-PAGVNTAQLENDIEKLNSEWNQL 6252          

HSP 6 Score: 100.523 bits (249), Expect = 2.421e-16
Identity = 87/362 (24.03%), Postives = 166/362 (45.86%), Query Frame = 3
Query: 5181 AVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISI----LQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLG-------AIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKE 6233
            A+++   +  +G   D      +PL  AR+ G+++  +++     Q +L+ D    L      + S+ EA+  G++D N +  + P   + +SL EA+  G++T +GK +  +   ++S ++A ++G       LIS   Q++I      + T  G       A+Q G I  KN  F +T + +  +L+EA   K I + + + LT   G+ + N E++++L A+    ID KTGQ+        IS+ +   + IIT         L   L++ ++S   +   I +           Y T+ +   S +   IS  EA ++  IN+    + H K     S  +AI+   +  + E +++
Sbjct: 1611 AIQDGLINVRNGQYVDEQTRERLPLSAARKRGLITPSLTLKDAEAQDLLD-DSGTILNPHTKRRISLLEAVSLGLLDANIKCILHPISQEAMSLTEAMHQGIITPDGKFVNPRTHETMSIIEAVHRG-------LISSVCQKMIFEVEGFQDTKSGDNVSFNQAVQQGTISMKNRTFKDTYSGKTMTLREAVSKKLILEQVYEMLTKPIGLRDDNGEEISLLDAVFARRIDHKTGQLRHPKTLMPISLRDAVKEGIITPEG----AALLRGLLRITVSTATVTKTITR-----------YVTVQSQGSSAEV-GISFQEAVRKGLINEHNATFKHPKSGRVVSLEEAINDGLLVLSAESTRD 1948          

HSP 7 Score: 68.1662 bits (165), Expect = 1.093e-6
Identity = 105/523 (20.08%), Postives = 219/523 (41.87%), Query Frame = 3
Query: 5625 TLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEK----DRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIID-------HLSGNYKI----INDFGFVID------IPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFV------------PTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNIL 7094
            TL G+  L I + K+ K + T  +   +        F+ ++ LKD +         ++++++  A+   +ID K+G+  D    +  S +E     ++T  QY  ++   C L+  + S  E+ + +D      ++ ++      T+ D K N  +S+ +A +   + D   M    K     R+  S T+A DA  +     +                       V +PIT E  +  QA    +I+        L+  Y +    ++D G ++D        +NEA+  G +          +   +++  K   SG +++   AI+ GL++ +   + + ++ + L ++ A   G + T  L     T+ D   Q L+D DSG +  P+ +  ++L EA++   +D +   + HP +   + L EA+   +  P    +       +++ +A++  L                     + ++F +A++QG I +K  TF+D  +     + EA++K ++
Sbjct: 1346 TLRGS-SLTITEVKSTKLVRTHEDNPNA-------DFLMRTALKDTST--------DQRVSLKVALRCGIIDSKSGKFVDTKTGRQYSPDEAVEVGLVT-RQYLDVLQAPCGLVD-TRSQQELTL-LDAIRFRFYDPQR-----QTLLDPKGNP-VSIQKAVQTGLLRDPDVMVRKLKLIQVSRL--SITEAFDAGLLDPQENR-----------------------VIDPITGESYTIEQAFARKLIEPKRENDEGLTLTYALDRGMVDDKGRLMDNCSGGVYDLNEALTRGVL---------CSETREVVNRK---SGKVVNVPTAIQDGLINVRNGQYVDEQTRERLPLSAARKRGLI-TPSL-----TLKDAEAQDLLD-DSGTILNPHTKRRISLLEAVSLGLLDANIKCILHPISQEAMSLTEAMHQGIITPDGKFVNPRTHETMSIIEAVHRGLISSVCQKMIFEVEGFQDTKSGDNVSFNQAVQQGTISMKNRTFKDTYSGKTMTLREAVSKKLI 1799          
BLAST of Dystonin vs. TrEMBL
Match: T1IVF3 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 666/2371 (28.09%), Postives = 1237/2371 (52.17%), Query Frame = 3
Query: 12444 NRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGA--------------FSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSD--------LKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVE-ILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLD------EWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR-LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALM-IQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPL-------------------IPIFDRSKRM-ETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFK----PATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQ----PVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGL 19379
            +R++ L+ +L  +   L S   A+ +   +++       +L E +D+      DL+ ++ Q+ ++       +  +  L +L+    ++ ++      K + K   L ++  ++   I+DR  S   + K +    +K ++F    D    + E       + K IG               F ++ ++PL KQL+++  IG     +  S +  +++E +++ +   ++ L + +++ E  +D+ L++  K+  +L+   +++ +    +  ++ PS +Y   K+QL   + L   L  RQ+S+  L + G ++  N +  ++ Q++ +L++L  +++ L   A+ +    ++ + ++K F+D + P + WLD  EK LA+ +T  T D  +++K+I ++++L +D      +  +L  +   +  +  ++ + +  +K+  L D+++   +        L +    L ++   +N     +   E  +   ++  V   + +D  +E   + +E+  H++ ++ +   G ++ + S+ +D+  +  K++ L   F E++  A   L   + ++P++++F  ++ +L   L  + + +   DS    + ++ ++ LENE    + ++    +   +L  +   E +   VE +   + KRF  +  ++ +KA +I  ++ ++     ++++ ++   + E++I E +D +  D  +L     +   L    N Q+  +    + +KK++R+   ++        L +LK  +  V + S     +LE       +A+PLA+ F  ++  L  W+ E E+          +  Q+ K + + K L  S  + KPLLD + K+G  L ++    +   +   ++    RY  +K  ++     LE L+   ++  +K+D   N L N  D++ ++   S HPEK+ E++     ++ DLDK     + ++   +      K    +D +V+ I +KL K++     +Q  T +  + + + + +A+ FW++L  + +   E+   L +     +  +++  +++ + +L+ EID  + ++ +  + G++L+     P++ P+V++  E+L   +E V +   +      R+Q+LI  +E+     D      E+ +    +   LGPL ++   V  QI + K+ K++++P    +E +N+   +LT+ + P     +   L  IN  W  LL G+ +RQ +L+  LL LG+F  A+DE I WI  TE +L ++K   GD  ++E+ LA+ K++  DM+  Q SV  +     ++I++D  S     TQ+ L +L   W EL++ A A+  ELEDALKE   F  + Q++   + ++ S L   K  GGLP++A+EQL RFM++Y        ++E   ++  +  K+S++     ++ +++ L ++WD V N A  +K +LE A++    FH  +  FI+WLT  E +++  +PVSR++ TIL+Q+E H++ ++D+ +HRE MLNLDK  THLKY SQK D++LI+NL+ S+ HRWE+VVS+S+ER+R LD+GYKEAK F D    L++ +  +   L+  T+I   P KI+ Q++KHKEF   LG     YD+  R G  L+++AP  D+  I  ++++L+ KW S+C KS++R++ L +ALL SG +KDA+  LL WL  +E  L +  +   GD++TV T++++H   +++LR R   ++ +   +  L    S ED   I+ Q+ EL++ W+ + KL++ K++RL+ A  QA E  +  N L E+ S +E +LR     P  E   L    I+ H  F   +   E   +       EIL  A+P+A   IKH+I II+++W ++  W++QR   L DH+  L +    L +LL WL   E TL+  E++ L   +   +    EH+ F   +T KQ + + I   +K + PP                         R +RM +T+       +P   NP+  +L  KW+ VW + + R++RLL+ ++Y KE++ MK+FNF++WRRR++  MNH KSR+MDFF + D D+DG++ R EF+DGI        + SKF+TTR+E+  VAD+FD  + G+ID ++F+ ALRPDRE  + +PA ++E I DEV++ + KCTC   +K+ Q G+GKY+FG+++KLRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELRE+    +G   +M+PFK K      +    T+  T+  +P+   + P++  R       P+  PR      S  +S    S   S  + S RT +   +P  
Sbjct: 1385 DRFRQLAKNLEDRCSGLESASHAVAQFNEQVKSVHHDLTSLEEALDSMGPVGRDLNIVKKQVDEIKKFLNSVDSEKGDLDDLERSARDMIDRGFAPDPKGLKK--QLESLRRQL-GRIEDRAQS---REKDLDGMMTKLSNFYEDYDMVTGEIEGGVNEEKSFKPIGGDIDTVKAQKEEFKLFCKRHMEPLTKQLDDMNKIGQGLIQSAASNVSTQNLESDLEKMNDKWNDLKEKLNERERRLDVALLQSGKYQEALQGFLQWLNDTEDMVAHQKAPSADYKVVKAQLQEQKFLNKMLLDRQNSMSSLFQMGEEIASNAEASERHQVEGQLNDLVQRFDALTTTAQDRMENLEKTLPIAKEFQDKFTPLVDWLDRTEKKLASMETIAT-DEKKIQKQIAQHQNLHDDILGHKPAFDQLADVAQILMSLVGDDEAQNLADKLQDLTDKYARVVEDSENLGLFLAQSREGLGHFSLNLNDLLAWIDEIEHRLTRFRVLSVFVDKLQDQLDELTEVTEEIADHQQQVEGVIANGHEIMKHSTGDDALLVKEKLDTLQQRFLEMTNRAADLLRHAQEALPLSQQFHQSHTRLVEWLIEVESQLPSIDSAGLVLQDKEIQRLENEIQEFKPILENVNHVGPQLCQISPGEGA-STVETLMSRDNKRFDAICEQIQRKAERIQLSKQRSSEVIGDIEEFLDWFRDVERQILE-ADPVIPDPDQLLMLLKEHKALNDDINSQRGRVRDVTSTAKKVMREQTSNENTPFINEKLNNLKDLIANVSQLSSDRLSSLE-------QALPLAEHFYDTHLELVQWMDELEQEAMLLGTPVANATQIKKQQDKTKTLLQSIAEHKPLLDKLNKTGSALVKLCGEDECGKVREILDADNARYGGLKVGLRDHQNALEQLMQETSQFADKLDGLLNALTNTADQVNNAEPISAHPEKIQEQISENKAVVEDLDKRSSAFEAVKRAADEVIS--KAGGTRDPAVQDIKKKLDKLNKLWDQIQFVTGDRGKSLEDAMDVADRFWDELNAVMNALKELQDSLVSQEPAAVEPQAIQQQQEALHELKQEIDQTKPEVEQCMKTGQKLMTLCGEPDK-PEVKKNMEDLDHAWENVTTLYAR------REQNLIEAMEKAMTFHDTLQNILEFLETAEEKFGNLGPLGSDIDAVKKQIAQLKDFKSEVDPHMVHVEALNRQAQELTENTSPEQAQAIKEPLKDINRRWDDLLRGVVERQRELEHALLKLGQFQHALDELIVWIAKTERTLKSMKPVFGDPQTIEVELAKLKVLVNDMHAHQNSVDTLNDAGRQLIEQDKGSEESSKTQKKLTELNVRWTELQQCASARQRELEDALKEGQAFNQEIQDLLLWLSDVDSVLSTSKPVGGLPESAREQLHRFMEVYNELEATRPRVESMQQQGTDFVKRSTEGAATNLQHNLKTLRQRWDNVTNRANDKKIKLEIALKEATEFHEALQNFIDWLTKAEHSISGLKPVSRVMDTILQQIEEHKSFQKDVGTHREVMLNLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKSAERTRALDHGYKEAKEFNDEYSELINWLDKSQTALDDLTTISNDPEKIKHQLSKHKEFQRTLGTKQPDYDACMRHGRTLKERAPKSDAPTIQGMMNDLKSKWNSVCAKSVDRQRKLEEALLFSGQFKDAVQALLDWLYKVEKNL-EPEQPVHGDLDTVTTMVDQHKSFKEELRGRSTNMDSVRKTSRELSKTASPEDVKNIQAQMGELENMWDKIGKLSDTKQKRLDGALKQAEELHKKVNILLEWLSDAEMKLRFAGALP--ENVSLTQEQITEHRKFLNEMTDRERDKDSTIALAQEILKKAHPDAVPVIKHWITIIQTRWEEISMWAKQRKQRLDDHVASLRDLADTLTELLDWLKKKEKTLVDLEAKPLPDDIPVIERLIEEHKEFTEQLTEKQPEVERI---TKTRRPPARDPSPKGRKDTKDRLGKDPTGSLKRGQRMPKTSTPAKPSTDPYIKNPQARELFDKWRHVWLLTMERQRRLLEKLKYSKELDKMKSFNFDEWRRRFLRHMNHKKSRIMDFFNKLDKDNDGKLIRDEFVDGI--------LRSKFETTRMELNAVADMFD--RGGYIDIKEFVDALRPDRE--RDRPATDSEKIEDEVQRLVMKCTCQYRFKVHQVGEGKYRFGESQKLRLVRILRSTVMVRVGGGWVALDEFLVKNDPCR----------------------AKGRTNIELREQFILAEGVSQSMSPFKAKSPTSSHSSQSGTRSGTSGSLPA---AGPITKIREKSSRSVPMGQPRSSSTAGSSDLSGQSFSEGDSSGIGS-RTTRKTPTPSF 3686          

HSP 2 Score: 150.984 bits (380), Expect = 1.110e-31
Identity = 262/1253 (20.91%), Postives = 562/1253 (44.85%), Query Frame = 3
Query: 8358 IEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDL--EETTNLLKTHT---NQTHKELNNR-SRLLIAI---IDEFDQFINRLNDCTSAHDKLKLS-IDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDK-------INKLEEQ-RKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSRE-------ELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIE-------DSLQNSIKSLE--AIGNT----RENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIG-SLSLDPKYINEQ---ERLIQTILAEISSRQPFLENVLMNN-----ASRNEPKLKELDDKIK------QKLLVASNIEAK-VNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQG-FPLGGDQQAKLTSPQRK--------PSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELL---SVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDK----NDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNE--EKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWI 11900
            +E +   +E ++ +E++L  +  V  NE + +  ++  + +  E   QQ  V   + ++ + +         E  K++   E  N L+ H+   N+ ++  N+  SRLL A+   +DE ++F N L        + +++ IDK  ++  ++ L+K++  +K   ++  ++  D+R +  +  KF+D+       IN    Q  ++FS L + PL        D EI   +NEV+   +DL       L++   + + +  L +++++  +  E ++        ++ K+++        ++    D    L+ ++V+  ++++ ++       D+L + I   E  AI NT     +   L +  +    NE       L   L Q+  Q + +      I+ +  WL +++ + +N     SL  + ++EQ    RL+Q   A+I  R+  + ++ + +     +S N    K+L+ K+K      +KL   ++   + +N     L SF V V    DW+   TE L +    R D ++F  +++EI      K+ D +      K L+++ +  D   I   +++LE+ W  L + ++ R+K+     +    Y  L+ ++++ L   E  +    P+A+DL + + Q ++++  + E+      I +   +G+ YD + +G  P    ++   TSP +K        P+  K+   T+  SPT ++ Q   ++  SG  S   S      D +   ++ +    ++ +I  RY  IG +L +R S++  +  +        ++ S  L  +   LL   SV          +  ++ I +++   +P    + T   +LL+ +  VPG   L+ ++      +  ++++ K   +   +    MK F +   +++N + +K++M+ VLGPV +       Q+QQV  L DE+ G +  +  L   G+  +    PTS +   I  TL+ ++   + L   L +RE N+ ++ G ++DFY  IN + + L  + +  D          L       ++ +L++ + +L + E+L + L   + D  +  EIK+K++NL +   ++  KID+    +        V   K ++ + W++  Q  + L  L V      +   +++ + +  ++  K+ +V   +  LN+  +   K+P   ++ + DKLA +    + +  +  + +   Q A+    K ++  +K   W+
Sbjct:   11 VESISKFLEWIAQVERRLANQEPVRENENDLRSQINTLKTLKEELDDQQRPVAACLDQVRQVV---------EFGKEVLSAEEMNQLQRHSTDLNRRYQTCNDECSRLLKALASALDELNKFKNELLPFQKWLREAQVTLIDKERSLGDLDRLKKNVDSIKSFSSDVIAHQADLRFITMAAQKFLDESKEYLKEINTYRTQLPQRFSHLQQ-PL--------DSEIKRTVNEVSIAFQDL-------LARANKLSDRVSGLTDRERQYKESVERAKSWVTETQNKMTKLMNEPVGSDPTTVQEQVDRTKALSVDIVAQKRLVENVQQMGKALMDALSSDISDAERDAIYNTLQWLEDQYSLIQADVSARSNE-------LEMALVQL--QGVQD-----GIDGVLTWLNDVEAQSRNASKPASLIREKLDEQIQEHRLLQ---ADIEGRRHTVNSIAVESQDLIRSSSNVRVAKKLESKVKDMTGRYEKLADKNSKRGEFLNQVSVQLDSFLVLVTRISDWLLEATESLDE--TARSDADEFGRRIEEITRQKNSKKTDFDGLVHDGKTLIAKKDVTDSTYIRDLLKSLEQQWKELTDALSDRAKQTKQMADQLNAYEVLRVQVLQWLKTMEIRVDGLEPVAVDLDSCKKQADEVKVIVREYQGYSSTIEKVNDLGNNYDRLSRGDRPESPTRRRVTTSPTKKATSPVKKTPTSRKSPDDTRSPSPTKVSAQSPLSSASSGFSSRRSSQ-----DNIGNLEDLTPIQQQLTEINHRYEMIGVKLNDRTSELDTIREQVKKHLDVLRQLSTWLTGK-ERLLPKDSVPSTREEAERHLKNVKNILDEMAEKQPQTDTLKTQTNELLKQKPNVPGASNLRQQVTDFVVHWEEVQNACKSRCDFMDD----MKNFFDSAGNLQNWLEQKDKMMAVLGPVASEPRLVMNQMQQVEVLRDELSGQQPQLNRLNEYGEAALDKCLPTSPDGRRINATLNTMNDHWNKLMAQLDERENNLEAVSGSNRDFYAKINQLQENLQKISDDFDNLGDIGPNKELQLNKLRNLEDQLENQRPLLADVESLGEELCNILEDSTSKNEIKSKLTNLEKTYNQLTKKIDNRKAELESTLRETKVFEDKCQEMQDWIEDFQHTV-LRDLHVSADKDIVRKQVQEYESVYREVLDKEHEV---HMLLNKGQDALAKTPVKDAQMLRDKLATMKTRWDRLKKEAVDRNTRLQNANEQAKKFHSLLDKFTPWL 1205          

HSP 3 Score: 130.954 bits (328), Expect = 1.289e-25
Identity = 361/1775 (20.34%), Postives = 703/1775 (39.61%), Query Frame = 3
Query: 13053 MEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVS-IDT---KNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAA--INCKINILHNYFDEISVSA--------------LKKL--SLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQV-----GERNMEILENETNSVE------KLVCQAR--------NDLDKLK-----------SVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCM-------EVLSNFEQKINEMSDQINN------DY----SELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQL-------ENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIE------DLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPD-VEQAEEELKRNFEAVRSSCEQ-----QITNIDRQQS--LITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQ-VNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATEN----------SLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKM-----ERKAAEIIKEDVSSLG------HEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIE---IDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQ--SEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHEL---RQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDL 18017
            +  ++ ++K  +DRL +   D    +     + +KF + L+    ++      L   +  S + ++   QL   +   + L +     D +   G D LIN  +  +  +Q  LDEL  ++  L   A  ++   +  ++    F D        L   E  LA+ D+    DA +  K ++  K L  +  ++   +  +K +    DG+  +  S  DT   K  +    DRF +  K+                         ED   G ESA           +      E+  ++  ++ S EE L ++  VG DL  +  + D     +N  ++      D++  SA              LKK   SL      I +R       LD ++  L+    + D +TG++      E++ + +  + ++V+      KL C+          +D++K+            S    E+ LEK+ D + +     KE LNE                 +E  LD  +       E L  F Q +N+  D + +      DY    ++L+E K     LL   N    S++S     +++   A  S+   ++  ++ + ++ ++ T   + + + L++ +P+AKEF   +  L DWL  TE+ +   +    D  ++ K   + + L +     KP  D +      L  +V   + +N+   ++D   +Y  + E       D E+L L   +  E +   +  L       + I  R+T     SV  +KL ++L    E+  ++   Q  V+ +   I N     K++   DD++ + EKL         LQ + +E   +  +LL  A E       +  +FH+    L    IE       +++  +  + K I+ L  EI   +  +  ++  G QL +   +P E    VE       + F+A+   CEQ     +   + +Q+S  +I  +EE    LD WF++V  ++    P+  +   +L  +++ K L +DI  +   +  +     ++ +    N     +N  L  + D  A +      R   L+  L     F+    E ++W+   E           + T IK +     +L   +A+HK +   +N + +++ K+       K  EI+  D +  G       +    LEQL +   +  +          D L  AL    DQ   ++ I                P+  +EQ+     +     K +   E     + E+  K+  +   A++     ++ L K WD ++ +   R   LE A++  + F  ++   +N L   + +L  Q P +     I +Q EA   LK++I   + E+    K    L  +  + D   ++  M  + H WE V +  + R +NL    ++A  F D  + +L+ + +  E       +G     +++QI + K+F   +  H +  ++  R   +L +    + ++ I E + ++  +W  L    +ER++ L  ALL  G ++ A+  L+ W+   E  L  S K   GD  T++  L +  +L   +    + ++ +N     L+ Q    E+SS  + +L EL   W  + + A+ ++R LE+A  +   F +    L  + S  +  L   +     PE  +E+L   M       +  L     ++   QQ G + +  +   A  +++H +  ++ +W ++
Sbjct: 1159 LRDKLATMKTRWDRLKKEAVDRNTRLQNANEQAKKFHSLLDKFTPWLVQAELKLVNLKPLSFKKNELDKQLREIQAFRNDLSRHSQEYDTVRSHG-DTLINMADIDQEVVQEILDELRDRWNRLNADAGDRSQSIEEILQRLGDFNDNLRDLQHGLQRCEDRLASHDS--LGDAAKDPKLLERMKSLLREAEAMATGVDSVKDV---ADGLIMDAPSECDTSHIKKSVGDADDRFRQLAKN------------------------LEDRCSGLESA----------SHAVAQFNEQVKSVHHDLTSLEEALDSMGPVGRDLNIVKKQVDEIKKFLNS-VDSEKGDLDDLERSARDMIDRGFAPDPKGLKKQLESLRRQLGRIEDRAQSREKDLDGMMTKLSNFYEDYDMVTGEIEGGVNEEKSFKPIGGDIDTVKAQKEEFKLFCKRHMEPLTKQLDDMNKIGQGLIQSAASNVSTQNLESDLEKMNDKWND----LKEKLNE-----------------RERRLDVALLQSGKYQEALQGFLQWLNDTEDMVAHQKAPSADYKVVKAQLQEQKFLNKMLLDRQN----SMSSLFQMGEEIASNAEASERHQVEGQLNDLVQRFDALTTTAQDRMENLEKTLPIAKEFQDKFTPLVDWLDRTEKKLASMETIATDEKKIQKQIAQHQNLHDDILGHKPAFDQLADVAQILMSLVGDDEAQNLADKLQDLTDKYARVVE-------DSENLGLFLAQSREGLGHFSLNLNDLLAWIDEIEHRLTRFRVLSVFVDKLQDQLDELTEVTEEIADHQQQVEGV---IANGHEIMKHSTG-DDALLVKEKL-------DTLQQRFLEMTNRAADLLRHAQEALP----LSQQFHQSHTRLVEWLIEVESQLPSIDSAGLVLQDKEIQRLENEIQEFKPILENVNHVGPQLCQI--SPGEGASTVETLMSRDNKRFDAI---CEQIQRKAERIQLSKQRSSEVIGDIEEF---LD-WFRDVERQILEADPVIPDPDQLLMLLKEHKALNDDINSQRGRVRDVTSTAKKVMREQTSNENTPFINEKLNNLKDLIANVSQLSSDRLSSLEQALPLAEHFYDTHLELVQWMDELEQEAMLLGTPVANATQIKKQQDKTKTLLQSIAEHKPLLDKLNKTGSALVKLCGEDECGKVREILDADNARYGGLKVGLRDHQNALEQLMQETSQFADKL--------DGLLNALTNTADQVNNAEPI-------------SAHPEKIQEQISENKAVVEDLDKRSSAFEAVKRAADEVISKAGGTRDPAVQDIKKKLDKLNKLWDQIQFVTGDRGKSLEDAMDVADRFWDELNAVMNALKELQDSLVSQEPAAVEPQAIQQQQEALHELKQEIDQTKPEVEQCMKTGQKLMTLCGEPDKPEVKKNMEDLDHAWENVTTLYARREQNLIEAMEKAMTFHDTLQNILEFLETAEEKFGNLGPLGSDIDAVKKQIAQLKDFKSEVDPHMVHVEALNRQAQELTENTSPEQAQAIKEPLKDINRRWDDLLRGVVERQRELEHALLKLGQFQHALDELIVWIAKTERTLK-SMKPVFGDPQTIEVELAKLKVLVNDMHAHQNSVDTLNDAGRQLIEQDKGSEESSKTQKKLTELNVRWTELQQCASARQRELEDALKEGQAFNQEIQDLLLWLSDVDSVLSTSKPVGGLPESAREQLHRFM-----EVYNELEATRPRVESMQQQGTDFVKRSTEGAATNLQHNLKTLRQRWDNV 2809          

HSP 4 Score: 92.0485 bits (227), Expect = 6.733e-14
Identity = 98/477 (20.55%), Postives = 224/477 (46.96%), Query Frame = 3
Query: 15621 SQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKN--QVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDIN-SLEMGLAQHKMIRADMNISQASVSKMERKAAEI--IKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDI--VLIRNLMSSIHHRWEKV 17030
            +Q  + L +K N P  + ++ Q   +   ++E V+++C+ +   +D  ++      +    L  W ++ +  + +LGP+ +E R V+ Q+Q+ + L++++  +   +  +N+ G        P   +  ++N+TL  +ND W +L+  L +R++ L+ +  S  +F+  +++  E +    +   N+    GDI  + E+ L + + +   +   +  ++ +E    E+  I ED +S  +E   +L  L K++ +L +    +  ELE  L+E  +F    QE+   I++    +          D  ++Q++ +  +YR       ++   + +  +   K+     + +   +  +  +WD +K  A  R +RL+ A E  + FH  + KF  WL   E  L   +P+S   + + +Q+   +A + D++ H +E    D + +H   +    DI   +++ ++  +  RW ++
Sbjct:  818 TQTNELLKQKPNVPGAS-NLRQQVTDFVVHWEEVQNACKSRCDFMDDMKNFF----DSAGNLQNWLEQKDKMMAVLGPVASEPRLVMNQMQQVEVLRDELSGQQPQLNRLNEYGEAALDKCLPTSPDGRRINATLNTMNDHWNKLMAQLDERENNLEAVSGSNRDFYAKINQLQENLQKISDDFDNL----GDIGPNKELQLNKLRNLEDQLENQRPLLADVESLGEELCNILEDSTS-KNEIKSKLTNLEKTYNQLTKKIDNRKAELESTLRETKVFEDKCQEMQDWIEDFQHTVLRDLHVSADKDIVRKQVQEYESVYREVLDKEHEVHMLLNKGQDALAKTPVKDAQMLRDKLATMKTRWDRLKKEAVDRNTRLQNANEQAKKFHSLLDKFTPWLVQAELKLVNLKPLSFKKNELDKQLREIQAFRNDLSRHSQEY---DTVRSHGDTLINMADIDQEVVQEILDELRDRWNRL 1281          
BLAST of Dystonin vs. Ensembl Cavefish
Match: DST (dystonin [Source:HGNC Symbol;Acc:HGNC:1090])

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 515/1634 (31.52%), Postives = 879/1634 (53.79%), Query Frame = 3
Query: 14346 EKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKL-QIGIENCSPSRKNANDKDDSVEILE-KLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWND-LKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELIN-QLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEAT---QRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQ-DSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTP--PL----IPIFDRS----KRMETNQGISKIQEPLF--VNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF 19145
            E ++ +  E+ +R++   + + +     G+   K+   E+  D  +  L+  E+K++ + D   +     ++L+E K    +++      K++++  +     ++     ++ ++LK+ V  + ++  + ++    +  QL+    LA +F  +Y  L  WL ET+ N  Q     ++ + L + ++E++ L     + KP +D + K+G  L ++ + VQG+ I    +   K Y  +K  +K RA  L++ I  +T+ ++K+D     LE I +R+      SV  EK+ E++     +  DL+KLQ   + L Q G E  +  R    DKD S + ++ KL ++      +Q+   E + K+++++ LA +FW D   LI      +TI  T   + +L    V+      +++ +E  R EID  ++++  +   G +L+     P++ P ++++ +E+   +E +  + ++++  ++       + ++    + +W   + ++L  + P+ T+   V  QI++ KE K +      ++E +N Q G  L K      +  +   +  +   W  L + L  RQH+L+  LL+LG+F  A+DE + W+  TE+ L   K   GD  ++E+ LA+H +++ D+   +++V  + +  +++++   SS G EA     +LE L   W  + E    +   L+ AL +A  F+G+ +++ + + +   +L   K  GGLPDTA+EQL   +++  T        +  +    ++   + +      E D+  L  KW+ V+     RK +LE+A      FH  +  FINWLT  E+ L    P S I+ TIL Q++ H+    ++ SHR++++ LDK  THLKY SQK D+VLI+NL+ S+  RWEKVV RS ER R LD   K AK+F +    L++ +  +   L+ +  I   P KI+ Q+ +HKEF   LG  +  YD+T R G  L+DK  ++ D++K+D+++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++  +   GD++ V  L++ H + +K+L  R   ++ +   A  L+  + +DSS+++ Q+ EL + W  V  L+  K+ RLE+A  QA EF    + L E+ +++E  LR     P++  EE + ++I  H  F K L    + +      G  IL   +P++  ++KH+  IIK+++ ++ +W+ Q    L      L   + LL+ LL WL  AE TL   +   L   + E K   +EH+ F+ +MT KQ D D++    K+K    PL    IP+ ++     KR  T        +P     NP++N L SKW+QVW + L+RR++L D ++ L+E++   NF+F+ WR+RYM WMNH KSRVMDFFRR D D DG+VTR+EFI+GI+         SKF T+R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  KP  + + I DEV +Q++KC C   +++ Q G  KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELREK   P+GT   MA F
Sbjct:   29 EGLDKLVTEDNERYRSATDAIAQHVDHTGAAILKSLQFEQAADTELAWLTEAERKLSSLGDIKLEPEQTTAQLQEQKSFSMDIM----RHKDAVDDIVKTGDAIMSSKDKAEKQALKAKVQSLLEKYSAVSQLNSERCLQLERTHSLACQFWETYEELWPWLQETQANFTQLPHLAIEYEALRQQQEELRQLRELIAEHKPHIDKMNKTGPQLVEL-SPVQGEPIRDKYQATDKLYAQLKADVKHRAAALDEAISKSTQFHDKIDPMLESLERIVERLRQPPSISVEVEKIREQISENKAVNMDLEKLQPAYETLKQRGEEMIT--RSEGADKDLSAKAVQDKLDQMVFLWNDIQALLEEREAKLLDVMDLAEKFWCDHCALI------VTIKDTQDLLRELEEPGVDPSVVKQQQESVESYREEIDGLQEELNVVQNLGTELMTACGEPDK-PVIKKSLDEVNVAWETLNKTWKERVERLEEAMQAAVQFQDGLQGMFDWVDIMESKLDSMSPVGTDLETVKQQIKELKEFKGEAYQLQIEMERLNHQAGLLLKKVLEEGDRVAIQEPINELKMLWDGLDEKLINRQHKLEGALLALGQFQHALDELLAWLTHTEDLLNEQKKNSGDPKAIEIELAKHHVLQNDVLAHKSTVEAVNKAGSDLME---SSAGEEACGLQSKLENLNLRWRGILEKTEQRRQLLDSALLQAQGFHGEIEDMQQWLKDTERQLLASKAVGGLPDTAREQLNAHLELCGTVEVKEELYQNLLHRGQQLIALTPEGQDSTTEQDLRNLKDKWECVQTKVAERKVKLEEAFAMATDFHNSLQDFINWLTQAEQTLTMVSPASLILETILFQIDEHKVFVTEVNSHRDQIIELDKTGTHLKYFSQKQDVVLIKNLLLSVQSRWEKVVQRSVERGRLLDDARKRAKQFHESWTKLMEWLEESERALDSELEIANDPDKIKLQLAQHKEFQKALGGKHSVYDTTGRTGRALKDKTSLKDDNQKLDDMLCELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAE-DQPVHGDIDLVLNLIDSHKVFQKELGKRTGSVQALKRSARDLVENTHDDSSWVKVQMQELSTRWETVCALSVSKQTRLEQALCQAEEFHSTVHILLEWLAEAEQSLRFHGSLPDD--EEALRSLIEQHKEFMKKLEEKRVALGKAISMGEAILAICHPDSITTVKHWNTIIKARFEEVTAWARQHDQRLSTAFTELLATQELLESLLSWLQWAETTLTEKDKEPLPQEIEEVKALISEHQTFMEEMTRKQPDVDKVTKTHKRKATAEPLVQSQIPVLEKGRTCRKRSPTQNMYPATAQPQIETKNPRVNLLVSKWQQVWLLALDRRRKLNDALDRLEELKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQDGKVTRQEFIEGILS--------SKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAY--KPLTDADKIEDEVTRQVAKCKCPKRFQVEQIGANKYRFYLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------AKGRTNVELREKFILPEGTTQVMASF 1610          

HSP 2 Score: 94.3597 bits (233), Expect = 4.540e-18
Identity = 253/1301 (19.45%), Postives = 540/1301 (41.51%), Query Frame = 3
Query: 12987 EELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVD---IKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFED----TLYGFESAMKDLKLNIVDPYQTRDIWEE-----SLNL-VKEVKSHEETLKNLDQVGEDLKQISSEND----SAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRE------NDSLTGQVGE------RNMEILENETNSVEKL---VCQARNDLDKL---KSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFE---QKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKE-SINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLD-KLQIFVDKLQIGIE--NCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEE--LKRNFEAVRSSCEQQITN-------IDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQ-VNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEIL----------VKKWDTV 16703
            ++++D  N+  S ++  + ++  E     V    +R       I  HVD     ++K  +F+ + +    ++    R L +  +  +E  ++ +QL   +     + + + ++D++ K G  ++ +  + +K  L+ ++  L  KY  +  L   +  + +R   L+  F + YE    WL   ++  ANF   P + AIE E   Q+ + L+     + E I + K  I+K++    + V + +  +   + D++    K + +    +      L   + +   F D     L   E  ++ L+       +   I E+     ++N+ +++++   ETLK   Q GE++   S   D    + A+  K++ +   +++I     ++ +   + + +AE+F   +  L + +     L+RE      + S+  Q  E        ++ L+ E N V+ L   +  A  + DK    KS+D    + E +   + E  +R +E +    +    +        I E  LD    V ++ E   Q+I E+ +     Y    + +I+   L    N Q    +   + +  ++  Q P ++LK L   +D          + L ++Q +L+ A+    +F  + + L  WL  TE+ + + K N+ DP  +     +   L N     K  ++ + K+G  L +     +   + + +E+   R+  I E  + R   L+  +L     + +++     L++   ++  S      P+   E+L    E+   ++ K +++ + L  G +    +P  +++  + D       L  +    + +Q++  E K K+    ++A +F N L   +D  + +T      T+       V+    ++E +  +ID H+  + +++    Q+IE            Q ++   +K    +V+S  E+ +         +D  +    +  E   KL EW +E    L     +  +   +  Q+ + KE +  +  KH   +   + G  L   +     NQ ++  L  + D W  +     +RQ++L+  LL  G+F  A+   I+W+   E  L   +  HGDI+ +   +  HK+ + ++     SV  ++R A +++ E+          ++++L   WE +   + +K   LE AL +A  F+     +   ++ L    +  +F G LPD  +E L+  ++ ++ F K                ++   ++GKAI +   IL          VK W+T+
Sbjct:    6 QKVLDTLNEVSSALLELVPWRAREGLDKLVTEDNERYRSATDAIAQHVDHTGAAILKSLQFEQAADTELAWLTEAERKLSSLGDIKLEPEQTTAQLQEQKSFSMDIMRHKDAVDDIVKTGDAIMSSKDKAEKQALKAKVQSLLEKYSAVSQLNSERCLQLERTHSLACQFWETYEELWPWL---QETQANFTQLPHL-AIEYEALRQQQEELRQ----LRELIAEHKPHIDKMNKTGPQLVEL-SPVQGEPIRDKYQATDKLYAQLKADVKHRAAALDEAISKSTQFHDKIDPMLESLERIVERLRQPPSISVEVEKIREQISENKAVNMDLEKLQPAYETLK---QRGEEMITRSEGADKDLSAKAVQDKLDQMVFLWNDIQALLEEREAKLLDVMDLAEKFWCDHCALIVTIKDTQDLLRELEEPGVDPSVVKQQQESVESYREEIDGLQEELNVVQNLGTELMTACGEPDKPVIKKSLDEVNVAWETLNKTWKERVERLEEAMQAAVQFQDGLQGMFDWVDIMESKLDSMSPVGTDLETVKQQIKELKEFKGEAY----QLQIEMERL----NHQAGLLLKKVLEEGDRVAIQEPINELKMLWDGLD----------EKLINRQHKLEGALLALGQFQHALDELLAWLTHTEDLLNEQKKNSGDPKAIEIELAKHHVLQNDVLAHKSTVEAVNKAGSDLMESSAGEEACGLQSKLENLNLRWRGILEKTEQRRQLLDSALLQAQGFHGEIEDMQQWLKDTERQLLASKAVGGLPDTAREQLNAHLELCGTVEVKEELYQNLLHRGQQLIALTPEGQDSTTEQD-------LRNLKDKWECVQTKVAERKVKLEEAFAMATDFHNSL---QDFINWLTQAEQTLTM-------VSPASLILETILFQIDEHKVFVTEVNSHRDQIIELDKTGTHLKYFSQKQDVVLIKNLLLSVQSRWEKVVQRSVERGRLLDDARKRAKQFHESWTKLMEWLEESERALDSELEIANDPDKIKLQLAQHKEFQKALGGKHSVYDTTGRTGRALKDKTSLKDDNQKLDDMLCELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAEDQPVHGDIDLVLNLIDSHKVFQKELGKRTGSVQALKRSARDLV-ENTHDDSSWVKVQMQELSTRWETVCALSVSKQTRLEQALCQAEEFHST---VHILLEWLAEAEQSLRFHGSLPDD-EEALRSLIEQHKEFMK--------------KLEEKRVALGKAISMGEAILAICHPDSITTVKHWNTI 1240          
BLAST of Dystonin vs. Ensembl Cavefish
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 646/2522 (25.61%), Postives = 1218/2522 (48.30%), Query Frame = 3
Query: 12240 AEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNR-------YQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLA------AINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIG--------------AFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFED----TLYGFESAMKDLKLNIVDPYQTRDIWEE---SLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDS-LTGQVGERNMEILENETNSVEK-LVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSR----KNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIE-LINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXX-XXXXXXXXXXXQSIGKAI---EIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPI-QDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFV------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------------------LPIPTKKPTT-------------------AKIPSPRVSQPLSSP-RIHQP----VSSPRIPQPV-TSPRIS------QNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            A+  L+  E+   Q      LE  +++ Q  ++ ++P +   + L   + Q  P          +++VN+       +  ++  + Q    L S+ + + E +S +    +R  +L +++D+      D+DSL  Q   + +           L+ L++E+E    +      +     D LA      A+N +  +  +  Q  L L    +   E +  +F  ++ E     +L +   N    +G              A   ++VD ++ +++ +  +G     +       + +E ++++    ++ L + + +   H         KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R+++++ +   G  +    +   + ++Q +L  L  ++ +LL  A  +  + +    L+  F +  EP   WL   E+ L++ +   T  + ++ ++I  +K LQ +  S    +  L+ +   +  +   + + D     + L +R    +  H +  +   +   LL   L    LF +     L       + L    V  YQ   + E+   +L+L +E+ S ++T+    + G+ L + ++  +   I  K++ + + + E++  + K L   E ++ ++ RF  A+  ++  L S+ A +   +S  T    +R  E+   +  S EK LV    N++           + E ++ +  +  +R+++    +T++   +     +A IQ     Q + ++   E  +     Q+   ++      ID           K++++  +N  + ++        ++LK   D +  + E+ ++    +   L++A  L   F  +Y  L+ WL ETE  + Q     +D + L + + +++ L  S  + KP +D I+K G  L+++  + +G  +     +A++RY  IKE +K RA  L++    + + ++K+D     LE    R+      +   EK+ E+L        +LDKL      L      CS       +  +D   +  +  +L ++ S    ++ +  E + K+ ++L LA +FW D+  +       T+  +   +++L    V+      + +  E ++ E D   +++  +   G  LI       E P+V++  +E+   +E +  +  +++  ++   +   + ++    + ++      +L  +  + T+   V  QI++ K+ K ++  +  D+E L +Q    L K +    ++ +   L  +   W  L + +  RQH+L+  LL+LG+F  A+ E   W+  T  +L   +    D  ++E+ LA+H ++R D+   +A+V  +    +E++    SS G EA+    +L++L +SW+ L    + +   LE AL++A  F+G+ +E  + +    S+L   K +GGLP+TA+EQL++ M++     +   +  + + +  + +  +  +  G      + ++ +L  KW ++    + R+++LE+A+     F   +   INWLT  E+ LN  +P S I+ T+L Q++ H+    ++ +HRE++L L+K  + L++ S K D+VLI+NL+ S+  RW+K+V RS +R R+LD   K AK+F +  R L D +      L+ +  I   P KI+ Q+TKHKEF   LG     YD+T R G  +RDKA +  D++K+D ++  ++ KW ++C KS+ER+  L +ALL SG + +A+  L+ WL  +EP+L++  +   GD++ V  L++ H   +K+L  R   ++ +   A  LM    +D+++++ QL EL + W+ V  L+  K+ RL++A  QA EF      L E+ S++E  LR   + PEE   E +  ++  H  F + +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL WL  AE TL+  ++  L   + + K   +EH+ F+ +MT KQ D D++    K+K  P  P    ++R  T +     Q+          NP++ QL S+W+QVW + L+R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF T+++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCRV       C C           A+GRTN ELREK   P+G    +A F     + KP++                     +P     PTT                   +K P+P   Q  S P   H P     S+ ++ +P   S R S         P+++  +S  + RTP   + P  +  SR  +R +S++GS AS
Sbjct: 2895 AKHQLEVQEALGPQACSNKSLE-RLRSQQELLNSLQPQVVYLRDLAQGLVQDMPQAGGDNGDGGQQLVNQACDTEREFGEVTEKIEQCCTSLESRLQGVGEVQSSVRDVFSRLADLDDELDSLSPVGRDVDSLASQAEAVKSFL-------GRLATLRTELEGHGGECTTMLRREGSSPDLLALRRETEALNRQAGKLAERGQGRLAL----IEAAEERVREFYARLTELQGLLDLGEDGVNAQGVVGSEVEVIKQQLQEFKAVEREQVDSIQPKVQHVNAVGQGLIQSAAKHTDTQALEHDLETTNLRWNSLNKRLQEALLHCG-------KFQDALEPLLSWLSDTEELIANQKPPSAEYRVVKAQIQEQKLLQRLLDDRRATVEMIRVEGERIASTAETQDRDKIQKQLQSLGERWTDLLEKASSRQKQLEELQVLALQFHETVEPLGEWLSATERRLSSAEPMGTQTS-KITQQISRHKALQEEVLSRGAEVDHLETLGQSLSPL---SCTADR----DWLKERVGAMRSGHTDLRDWCARRETLLEQALANAQLFGEEEVEVLNWLAEVAQRLAEVSVQSYQPELLAEQHKHTLSLNEEIVSRKKTVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKSRYAEMTAGSSKALRTLEQALQLSTRFASAHEDINQWLDSVEAELNNMESDTTPAYQDRQKEL---KCVSAEKRLVLDTINEVGSALLDLVPWRAREGLDRLVADANQRYRQADETITQRVQLV-----QAAIQR---SQQVLLMLCLEPDVTVAQLQVQRAFN------IDIIR-------HKDTVDQLLNTREDILESCSEQQREALKVKTDSLSARYEAVSQNHAERFSALEQAQVLVARFWETYEELEPWLGETETLISQLPPPAIDTEALRQQQDQMRLLRESIAEHKPHIDKILKIGPQLAELSAQ-EGSTVRQRYSEAERRYLAIKEEVKNRAASLDEAFSQSAQFHDKMDPLLETLEGAVQRLRQPPPVAAEVEKIREQLAEHRAAGLELDKLLPSFSAL------CSRGEELITRAPHDDPAAQAVRSRLLRLRSLWDEIRQRAEEREGKLQDVLDLAGKFWADMAALLS-----TLRDSQDIVKELEDPGVDPSLIKQQIEAAEAIKAETDGLREELEIVRTLGADLIFACGE-TEKPEVKKTIDEMNAAWEGLNRTWRERMEKLEEAMTASVQYQDALQGMFDYLDNAVIKLCEMQTIGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLCHQGELLLKKVTDQTDRDMIQEPLTELRHLWDNLGEKITLRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPVSSDPKAIEIELAKHHVLRNDVLSHRATVETVNSAGSELLD---SSPGDEASHLRDQLDELNRSWDSLLLKTKERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQSQLSQRGEQYHRLLDQGESMLLARGGEEAGPGTTQTQQNLALLQNKWASLNTKMDDRRAKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDVVLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKVQLTKHKEFQKALGSKQPVYDTTVRSGRAMRDKATLPADTEKLDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAE-DQPVHGDLDLVSNLMDSHKAFQKELGKRTSSVQALKRSARELMDTGRDDTAWVKVQLQELSNRWDTVCTLSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEE--SETLQELLHTHRDFMQTVEEKRVDVNKAAGMGEGILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLPQDIPQLKTLMSEHQMFMEEMTRKQPDVDKVTKTYKRK--PAEPPSSLAERRGTRKQQQSQQQQQHAVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLHDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTSKLEMMAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVTVTPGYFC-CR----------ARGRTNLELREKFILPEGASQGLAAFRSRGRRSKPSSRTASPTRSSSSASHSAQSCASVPSAPATPTTSSRSSQSHSRGYAKPWLAHSKTPTPTKCQ--SGPEHCHTPGHEGGSTSKLKRPTFHSSRGSLTGENGGATPAAKPGRS-DNKRTPSSASGPASRAGSRAGSRASSRRGSDAS 5320          

HSP 2 Score: 233.802 bits (595), Expect = 4.323e-60
Identity = 116/256 (45.31%), Postives = 176/256 (68.75%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI--YQFRNQYADLYANLNSALE 1166
            DERD +QK+TF  W+N HL+K+ K + D++ DLRDG  L++LLEVLS  +L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  +I  S +S DL+ K+ LL W+++A E YP +   NFS+SW +G+ F AL+H+ RPDLID++ +++ S ++NLE AF  A+  LGV ++++ EDV     DEKS++TYV+S+++  PK  +  E I  ++   ++A+  +  +S L+
Sbjct:   23 DERDRVQKKTFTKWVNKHLIKVRKHITDLYEDLRDGHNLISLLEVLSGVQLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISEIYVSGESGDLTAKEKLLLWTQQATEGYPGLRCSNFSSSWSNGRMFNALLHRYRPDLIDMEVVARQSNRENLEQAFEIAES-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKIPEGGEGITPHEVDQRWAEYQSRFSSLLQ 277          

HSP 3 Score: 109.383 bits (272), Expect = 1.847e-22
Identity = 150/791 (18.96%), Postives = 336/791 (42.48%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQ--MDMDFHQSKND----LKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTPEDFCNLEPVHRQKIVEILNQDANRLILDLK-CANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLI-----LFVKNGMSETVG-LKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEA------AQD----TISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYE 4118
             W++E   ++    + +DL  + +  ++  T    I  +V+E    L+    Y+  +  +F  S ++    L+ ++ +L  + S      +S   F+ +  E + W+  KE++++ + W +  +  ++ K+E+F    +EL+ ++  +         L + NH A   ++   A L+++WQW+  L  C++ HL+    Y QF  +A E +  + +L + +  ++       L + E L ++  +  E + +Y+ +V  ++  ++++  L  R+   +      ++AIC  K+      +    GE   L +NS    W++ +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    L   +  + +WT +   +  P  RQ+ +E L+   +    D +  A    +E+ +       C+       H+      M TV    S     ++R   + +      L     ++L+ ++    S +  D       + + ++ + +LK  +  + D+       F +   S +V  L+ +L   ++  E+L + + +++ KLK+ +V    L   +  + + E  L ++ +  PA    I+ L  QL+        QD    ++SS V   ++  T L QL       R  + D   E  Q+L +       R+  ++ Q++ R + +    S     +    A+  WI   + T + Q N      +SK +   + +      EI + + ++DE  K + ++   ++ YE
Sbjct:  548 GWVEETQELLERAEWGSDLPSVEQHLQEHHT----IHTAVEELLHSLKEARSYEPRVSPNFRSSYSETLAKLENQYCKLLEHSSWRLRCLESLRAFVSQCTEELIWLNEKEEEELAFDWSEN-NTNMAAKREQFAETREELDEKQEVMRSLQETADQLCLVNHPAKQTLEAYSAALQTQWQWVRQLCVCVEQHLKDNTAYFQFMSDARECETYLRQLQDTIKRQYTCDRNSRLGKLEDLLQDSMEEKEQLIEYRSSVASLVGRAKTIVQLRPRSVDCIVGTTTPIRAICDYKQIEITVNK----GEECVLEDNSQRTKWKIISPTGNEAMVPSVCFTVPPPNQEAIDIASRMEQQYQNVMSLWHQLHMNMKSVVSWHYLQKDISNISSWTLDKMRSQPPAERQQALEHLDNHLSDFQTDCRESAFFTPSEVRELEREAESCH------QHAQSLLTSMETVEKDES-----MSRSYLSELQSIKSHLQEAEQRLLRGMNTSPPSGLSGDGADTAVHIAEQEKLQQDLKGLQSNIGDVSRRCVNFFEEKPTSSSVPVLRSELNLAVEKIEKLDSLSSVYLHKLKTVDVLMRSLQIAESHLKKYEGRL-SEEDIVPADTTAIQALREQLKKWYSELEDQDHVFHSLSSEVLRAREAGTQLSQL----HPDRSPELDRYQEKAQQLIE-------RWNGVRRQMETRQADLEMLGSVLQQYREGHSALIHWI---EETTEKQENTQPEQTDSKALSEQLAQQTALVAEIEQNQVKLDECQKHSKHYCTAVKDYE 1303          

HSP 4 Score: 75.0998 bits (183), Expect = 3.871e-12
Identity = 270/1417 (19.05%), Postives = 579/1417 (40.86%), Query Frame = 3
Query: 13308 SSLDELNKAGSDLLINTKEPKK--SQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDT-SPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENV-SIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAM---------KDLKLNI-----VDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDL-----KQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENE--KRFKEV---LNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNF-EQKINEMSDQINNDYSELEECKIDFTN----LLSAWNEQKESINSTINDSKKLIRQAPGSDLKS-LKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAK----KRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDR--ITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDK----------DDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKL--IEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPD---VEQAEEELKRNFEAVRSSCEQQITNI----DRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKND----IEPKHRDIELINQLGYQLTKGSHPNIKNQ-VNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR-LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRF----EDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQ 17351
            + + +LN AGS   +N     K  +++Q  + E+N++YE L    + +  +   +++L +  +   E  L WL   E++L      SP+   + +  + QE K L ++ +     ++ LK  + +   + +EN  S + +    +L D  + ++K++    +              ++    D L  F SA          K+L +++     +DP       ++   +++E ++       L Q  E +     +Q S + D A +  ++  +   +D+++     +    + +   +ERF     +L + +  L   +    SL+ Q       +   ET  +   + Q +  L + + +    +++  V + ++ +E  KR + V   LN + ++A    S    A    +   Q  E L ++ +QK  E     N+      E      +    LL    +Q+ S +    +   L+   P  D +S L+S +  +++  E   + L  +Q ++ E +  A+++    + L  W+ + E+   + +  +LDP  L +A Q+ + L    + ++PLL+ +  +   L +     Q +     + D K    +R +++ E +  R   LE+L     E  E       +LE  + +  + ++  P     K  E L    E+L  L    +++  L  G+    P     N            D   E  E   KI      L+S+     + +  + S   + ++ L  ++D+   ++       ++ L +++   K  L  +  LR E++ H          G +    +     +PD   + +  E L R    +    + ++  I    +R +    +L E++  LD     VN +    G + +E   +  Q+Q+ K ++ +    I+PK   ++ +N +G  L + +  +   Q +   L   N  W    + L +R   LQ  LL  G+F  A++  + W+  TE  + N K    +   ++  + + K+++  ++  +A+V +M R   E I     +   +  Q+ L+ L + W +L E A ++  +LE+    AL F+   + + + +     +L   +  G       +Q+ R   +         +++        +S  S  +    ++  +  +      +++    R++ LE+A+   + F  +  + +NWL    + L +    S     + EQ +   +L  +I S ++ +    K    L   +   +++LI+  +  I  R+ ++ + SS+  R L+   + + RF    ED+N+  LD + + L  +E DT    TP+    Q    KE  C      L  D+   +G  L D  P +  + +D +V +   +++
Sbjct: 2266 TGVSQLNGAGSSSSVNGIHTCKDLTEIQVAVAEVNSRYEQLGKNLQDRQGKQQASLELRQKARQDTETLLQWLGPREQSLTQGQAGSPSRPEV-VRAQAQENKALLSELAEHSGKVEDLKKTLKQ---LITENQDSPEAETWKQQLTDIDTRWEKANTTAAQRQT-----------ELETCADRLGSFASAANQLGPWLREKELMMSVLGPLSIDPNMLNTQKQQVQFMLREFETRRPQFHQLTQAAEGILSPAGEQGSGDKDLAEVQQELAAITKQWDDLTSRLSGRSGKIDQAQGTSERFQTLLRELSMSIADLGERLDAQASLSVQPEALRRRL--QETGEIRAELEQRKGQLAQAEQLCTELSTI--VAEPYLRDELQKRLESVSSPLNSLEERAADGLSQLQSALSSTQQFQQMFEELRSWLDQKAGERIGGANDPLPCWPEALQTLLSQQEELLRGVAQQRGSYDLIQAEGTSLLASLPAGDERSALQSRLSSLRQDWEGLNQRLNERQARIKETLSRAEQYRQHRDELAPWVTDCEQREAEIQ-PSLDPAALEEALQKGRQLGLDLDRRRPLLENLNSAADQLLE-----QSRTGEEEVRDEKAQLNRRVDSLSERLHGRTAQLEELGSRLKEFEEGRQAVERRLEAAKHQLEVQEALGPQACSNKSLERLRSQQELLNSLQPQVVYLRDLAQGLVQDMPQAGGDNGDGGQQLVNQACDTEREFGEVTEKIEQCCTSLESRL----QGVGEVQSSVRDVFSRLADLDDELDSLSP--VGRDVDSLASQAEAVKSFLGRLATLRTELEGH----------GGECTTMLRREGSSPDLLALRRETEALNRQAGKLAERGQGRLALIEAAEERVREFYARLTELQGLLDLGEDGVNAQ----GVVGSEVEVIKQQLQEFKAVEREQVDSIQPK---VQHVNAVGQGLIQSAAKHTDTQALEHDLETTNLRW----NSLNKR---LQEALLHCGKFQDALEPLLSWLSDTEELIANQKPPSAEYRVVKAQIQEQKLLQRLLDDRRATV-EMIRVEGERIASTAETQDRDKIQKQLQSLGERWTDLLEKASSRQKQLEELQVLALQFHETVEPLGEWLSATERRLSSAEPMGTQTSKITQQISRHKALQEEVLSRGAEVDHLETLGQSLSPLSCTADRDWLKERVGAMRSGHTDLRDWCARRETLLEQALANAQLFGEEEVEVLNWLAEVAQRLAEVSVQSYQPELLAEQHKHTLSLNEEIVSRKKTVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKSRYAEMTAGSSKALRTLEQALQLSTRFASAHEDINQ-WLDSVEAELNNMESDT----TPAYQDRQ----KELKCVSAEKRLVLDTINEVGSALLDLVPWRAREGLDRLVADANQRYR 3617          
BLAST of Dystonin vs. Ensembl Cavefish
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 646/2521 (25.62%), Postives = 1220/2521 (48.39%), Query Frame = 3
Query: 12240 AEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNR-------YQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLA------AINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTV------ISGLG-------FKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFED----TLYGFESAMKDLKLNIVDPYQTRDIWEE---SLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDS-LTGQVGERNMEILENETNSVEK-LVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSR----KNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVN-----DKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIE-LINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXX-XXXXXXXXXXXQSIGKAI---EIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPI-QDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFV------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPF-----KFKPAT---------------------LPIPTKKPTT-------------------AKIPSPRVSQPLSSP-RIHQP----VSSPRIPQPV-TSPRIS------QNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQAS 19436
            A+  L+  E+   Q      LE  +++ Q  ++ ++P +   + L   + Q  P          +++VN+       +  ++  + Q    L S+ + + E +S +    +R  +L +++D+      D+DSL  Q   + +           L+ L++E+E    +      +     D LA      A+N +  +  +  Q  L L    +   E +  +F  ++ E     +L +   N    +G+    +V+ +K+QL+E   +  +   ++      ++ +G        KH + +  +++H  +      + +   +   L+   KF  +LE L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R+++++ +   G  +    +   + ++Q +L  L  ++ +LL  A  +  + +    L+  F +  EP   WL   E+ L++ +   T  + ++ ++I  +K LQ +  S    +  L+ +   +  +   + + D     + L +R    +  H +  +   +   LL   L    LF +     L       + L    V  YQ   + E+   +L+L +E+ S ++T+    + G+ L + ++  +   I  K++ + + + E++  + K L   E ++ ++ RF  A+  ++  L S+ A +   +S  T    +R  E+   +  S EK LV    N++           + E ++ +  +  +R+++    +T++   +     +A IQ     Q + ++   E  +     Q+   ++      ID           K++++  +N  + ++        ++LK   D +  + E+ ++    +   L++A  L   F  +Y  L+ WL ETE  + Q     +D + L + + +++ L  S  + KP +D I+K G  L+++  + +G  +     +A++RY  IKE +K RA  L++    + + ++K+D     LE    R+      +   EK+ E+L        +LDKL      L      CS       +  +D   +  +  +L ++ S    ++ +  E + K+ ++L LA +FW D+  +       T+  +   +++L    V+      + +  E ++ E D   +++  +   G  LI       E P+V++  +E+   +E +  +  +++  ++   +   + ++    + ++      +L  +  + T+   V  QI++ K+ K ++  +  D+E L +Q    L K +    ++ +   L  +   W  L + +  RQH+L+  LL+LG+F  A+ E   W+  T  +L   +    D  ++E+ LA+H ++R D+   +A+V  +    +E++    SS G EA+    +L++L +SW+ L    + +   LE AL++A  F+G+ +E  + +    S+L   K +GGLP+TA+EQL++ M++     +   +  + + +  + +  +  +  G      + ++ +L  KW ++    + R+++LE+A+     F   +   INWLT  E+ LN  +P S I+ T+L Q++ H+    ++ +HRE++L L+K  + L++ S K D+VLI+NL+ S+  RW+K+V RS +R R+LD   K AK+F +  R L D +      L+ +  I   P KI+ Q+TKHKEF   LG     YD+T R G  +RDKA +  D++K+D ++  ++ KW ++C KS+ER+  L +ALL SG + +A+  L+ WL  +EP+L++  +   GD++ V  L++ H   +K+L  R   ++ +   A  LM    +D+++++ QL EL + W+ V  L+  K+ RL++A  QA EF      L E+ S++E  LR   + PEE   E +  ++  H  F + +    + +N     G  IL   +P+   +IKH+I II++++ ++L+W++Q    L+  L  L     LL++LL WL  AE TL+  ++  L   + + K   +EH+ F+ +MT KQ D D++    K+K  P  P    ++R  T +     Q+          NP++ QL S+W+QVW + L+R+++L D ++ L+E++   NF+F+ WR++YM WMNH KSRVMDFFRR D D DG++TR+EFIDGI        + SKF T+++EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q+++C C+  +++ Q G+ KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      A+GRTN ELREK   P+G    +A F     + KP++                     +P     PTT                   +K P+P   Q  S P   H P     S+ ++ +P   S R S         P+++  +S  + RTP   + P  +  SR  +R +S++GS AS
Sbjct: 3243 AKHQLEVQEALGPQACSNKSLE-RLRSQQELLNSLQPQVVYLRDLAQGLVQDMPQAGGDNGDGGQQLVNQACDTEREFGEVTEKIEQCCTSLESRLQGVGEVQSSVRDVFSRLADLDDELDSLSPVGRDVDSLASQAEAVKSFL-------GRLATLRTELEGHGGECTTMLRREGSSPDLLALRRETEALNRQAGKLAERGQGRLAL----IEAAEERVREFYARLTELQGLLDLGEDGVNAQGVVGS----EVEVIKQQLQEFKAVEREQVDSIQPKVQHVNAVGQGLIQSAAKHTDTQ--ALEHDLETTNLRWNSLNKRLQEALLHCGKFQDALEPLLSWLSDTEELIANQKPPSAEYRVVKAQIQEQKLLQRLLDDRRATVEMIRVEGERIASTAETQDRDKIQKQLQSLGERWTDLLEKASSRQKQLEELQVLALQFHETVEPLGEWLSATERRLSSAEPMGTQTS-KITQQISRHKALQEEVLSRGAEVDHLETLGQSLSPL---SCTADR----DWLKERVGAMRSGHTDLRDWCARRETLLEQALANAQLFGEEEVEVLNWLAEVAQRLAEVSVQSYQPELLAEQHKHTLSLNEEIVSRKKTVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKSRYAEMTAGSSKALRTLEQALQLSTRFASAHEDINQWLDSVEAELNNMESDTTPAYQDRQKEL---KCVSAEKRLVLDTINEVGSALLDLVPWRAREGLDRLVADANQRYRQADETITQRVQLV-----QAAIQR---SQQVLLMLCLEPDVTVAQLQVQRAFN------IDIIR-------HKDTVDQLLNTREDILESCSEQQREALKVKTDSLSARYEAVSQNHAERFSALEQAQVLVARFWETYEELEPWLGETETLISQLPPPAIDTEALRQQQDQMRLLRESIAEHKPHIDKILKIGPQLAELSAQ-EGSTVRQRYSEAERRYLAIKEEVKNRAASLDEAFSQSAQFHDKMDPLLETLEGAVQRLRQPPPVAAEVEKIREQLAEHRAAGLELDKLLPSFSAL------CSRGEELITRAPHDDPAAQAVRSRLLRLRSLWDEIRQRAEEREGKLQDVLDLAGKFWADMAALLS-----TLRDSQDIVKELEDPGVDPSLIKQQIEAAEAIKAETDGLREELEIVRTLGADLIFACGE-TEKPEVKKTIDEMNAAWEGLNRTWRERMEKLEEAMTASVQYQDALQGMFDYLDNAVIKLCEMQTIGTDLSTVKQQIEELKQYKVEVYQQQIDMEKLCHQGELLLKKVTDQTDRDMIQEPLTELRHLWDNLGEKITLRQHKLEGALLALGQFQHALSELQSWLSHTHATLDTQRPVSSDPKAIEIELAKHHVLRNDVLSHRATVETVNSAGSELLD---SSPGDEASHLRDQLDELNRSWDSLLLKTKERQKLLEAALQQAEGFHGELEEFLQWLRRTESQLSAAKPTGGLPETAREQLQQHMELQSQLSQRGEQYHRLLDQGESMLLARGGEEAGPGTTQTQQNLALLQNKWASLNTKMDDRRAKLEEAVSLATGFQSSLQDTINWLTQAEQTLNMAQPPSLILDTVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFASLKQDVVLIKNLLLSVQARWDKLVQRSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAESRLDSELEISNEPDKIKVQLTKHKEFQKALGSKQPVYDTTVRSGRAMRDKATLPADTEKLDHLLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFAEALQALVDWLYRVEPQLAE-DQPVHGDLDLVSNLMDSHKAFQKELGKRTSSVQALKRSARELMDTGRDDTAWVKVQLQELSNRWDTVCTLSVSKQTRLQQALKQAEEFRTAVQMLLEWLSEAEQTLRFRGVLPEE--SETLQELLHTHRDFMQTVEEKRVDVNKAAGMGEGILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHEQRLETALTELLNNAALLEELLSWLQWAETTLVQRDTEPLPQDIPQLKTLMSEHQMFMEEMTRKQPDVDKVTKTYKRK--PAEPPSSLAERRGTRKQQQSQQQQQHAVQVTGGNPRLTQLCSRWQQVWLLALDRQRKLHDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI--------LASKFPTSKLEMMAVADIFDRDGDGYIDYYEFVAALHPNKDAY--RPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------ARGRTNLELREKFILPEGASQGLAAFRSRGRRSKPSSRTASPTRSSSSASHSAQSCASVPSAPATPTTSSRSSQSHSRGYAKPWLAHSKTPTPTKCQ--SGPEHCHTPGHEGGSTSKLKRPTFHSSRGSLTGENGGATPAAKPGRS-DNKRTPSSASGPASRAGSRAGSRASSRRGSDAS 5657          

HSP 2 Score: 255.373 bits (651), Expect = 1.492e-66
Identity = 147/352 (41.76%), Postives = 216/352 (61.36%), Query Frame = 3
Query:  120 MSGEHFSRYSERLNISEHREKRRKLHAQQSN-SLPPKYRGVNTAPIIDIYSKSNLSVKSPRRSESHSQNRLDLNEVQLSINLLQLDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI--YQFRNQYADLYANLNSALE 1166
            MS       SER  +SE     R   +++S  SL P     NT P  D     NLS    R+ +S           Q S+    LDP +R V+RVADERD +QK+TF  W+N HL+K+ K + D++ DLRDG  L++LLEVLS  +L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  +I  S +S DL+ K+ LL W+++A E YP +   NFS+SW +G+ F AL+H+ RPDLID++ +++ S ++NLE AF  A+  LGV ++++ EDV     DEKS++TYV+S+++  PK  +  E I  ++   ++A+  +  +S L+
Sbjct:    1 MSSSDEETLSERSCVSE-----RSFRSERSGGSLSPCSHATNTGPKGDTLP-WNLSRHERRKRKS-----------QDSV----LDPAERAVVRVADERDRVQKKTFTKWVNKHLIKVRKHITDLYEDLRDGHNLISLLEVLSGVQLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISEIYVSGESGDLTAKEKLLLWTQQATEGYPGLRCSNFSSSWSNGRMFNALLHRYRPDLIDMEVVARQSNRENLEQAFEIAES-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKIPEGGEGITPHEVDQRWAEYQSRFSSLLQ 330          

HSP 3 Score: 97.8265 bits (242), Expect = 4.554e-19
Identity = 149/790 (18.86%), Postives = 336/790 (42.53%), Query Frame = 3
Query: 1827 NWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQ--MDMDFHQSKND----LKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQVLLSTM--DLVKNWTPEDFCNLEPV-HRQKIVEILNQDANRLILDLK-CANIDENEINKFHFALNQCNARFAELAHSSVFSVQMRTVSNQSSSPVKAVNRESFTSVDLQLDDLISVFTKMLQELSIKLASPXXXXXXXXXXQVCKHKEFETNLKNYEPQVNDLI-----LFVKNGMSETVG-LKVKLERMIDLWEQLWNEAHMFVIKLKSTEVFFSQLDEIDQVICEMELTLINQNESFPAGIDQIKILIAQLEA------AQD----TISSVVGNLKDVPTNLDQLISAVTTSRQNQKDVSYEDIQKLKKELKSVEYRYELLKNQIKKRLSHVNECSSQYLGLKNELKAIQAWIIGLQTTVKSQINVPNNVFESKNIESLMKKINNFQLEINKYKPEIDEINKSATYFLNLLQKYE 4118
             W++E   ++    + +DL  + +  ++  T    I  +V+E    L+    Y+  +  +F  S ++    L+ ++ +L  + S      +S   F+ +  E + W+  KE++++ + W +  +  ++ K+E+F    +EL+ ++  +         L + NH A   ++   A L+++WQW+  L  C++ HL+    Y QF  +A E +  + +L + +  ++       L + E L ++  +  E + +Y+ +V  ++  ++++  L  R+   +      ++AIC  K+      +    GE   L +NS    W++ +        P++CF +   + +A   A  ++  +  +  LW +  + ++  V    +  D++++     F  L  +  RQ+ +E L+   +    D +  A    +E+ +       C+       H+      M TV    S     ++R   + +      L     ++L+ ++    S +  D       + + ++ + +LK  +  + D+       F +   S +V  L+ +L   ++  E+L + + +++ KLK+ +V    L   +  + + E  L ++ +  PA    I+ L  QL+        QD    ++SS V   ++  T L QL       R  + D   E  Q+L +       R+  ++ Q++ R + +    S     +    A+  WI   + T + Q N      +SK +   + +      EI + + ++DE  K + ++   ++ YE
Sbjct:  601 GWVEETQELLERAEWGSDLPSVEQHLQEHHT----IHTAVEELLHSLKEARSYEPRVSPNFRSSYSETLAKLENQYCKLLEHSSWRLRCLESLRAFVSQCTEELIWLNEKEEEELAFDWSEN-NTNMAAKREQFAETREELDEKQEVMRSLQETADQLCLVNHPAKQTLEAYSAALQTQWQWVRQLCVCVEQHLKDNTAYFQFMSDARECETYLRQLQDTIKRQYTCDRNSRLGKLEDLLQDSMEEKEQLIEYRSSVASLVGRAKTIVQLRPRSVDCIVGTTTPIRAICDYKQIEITVNK----GEECVLEDNSQRTKWKIISPTGNEAMVPSVCFTVPPPNQEAIDIASRMEQQYQNVMSLWHQLHMNMKSVVSWHYLQKDIIQS-----FHRLSLISERQQALEHLDNHLSDFQTDCRESAFFTPSEVRELEREAESCH------QHAQSLLTSMETVEKDES-----MSRSYLSELQSIKSHLQEAEQRLLRGMNTSPPSGLSGDGADTAVHIAEQEKLQQDLKGLQSNIGDVSRRCVNFFEEKPTSSSVPVLRSELNLAVEKIEKLDSLSSVYLHKLKTVDVLMRSLQIAESHLKKYEGRL-SEEDIVPADTTAIQALREQLKKWYSELEDQDHVFHSLSSEVLRAREAGTQLSQL----HPDRSPELDRYQEKAQQLIE-------RWNGVRRQMETRQADLEMLGSVLQQYREGHSALIHWI---EETTEKQENTQPEQTDSKALSEQLAQQTALVAEIEQNQVKLDECQKHSKHYCTAVKDYE 1350          

HSP 4 Score: 75.485 bits (184), Expect = 2.781e-12
Identity = 270/1417 (19.05%), Postives = 579/1417 (40.86%), Query Frame = 3
Query: 13308 SSLDELNKAGSDLLINTKEPKK--SQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDT-SPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENV-SIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAM---------KDLKLNI-----VDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDL-----KQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENE--KRFKEV---LNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNF-EQKINEMSDQINNDYSELEECKIDFTN----LLSAWNEQKESINSTINDSKKLIRQAPGSDLKS-LKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAK----KRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDR--ITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDK----------DDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKL--IEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPD---VEQAEEELKRNFEAVRSSCEQQITNI----DRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKND----IEPKHRDIELINQLGYQLTKGSHPNIKNQ-VNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQR-LEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRF----EDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQ 17351
            + + +LN AGS   +N     K  +++Q  + E+N++YE L    + +  +   +++L +  +   E  L WL   E++L      SP+   + +  + QE K L ++ +     ++ LK  + +   + +EN  S + +    +L D  + ++K++    +              ++    D L  F SA          K+L +++     +DP       ++   +++E ++       L Q  E +     +Q S + D A +  ++  +   +D+++     +    + +   +ERF     +L + +  L   +    SL+ Q       +   ET  +   + Q +  L + + +    +++  V + ++ +E  KR + V   LN + ++A    S    A    +   Q  E L ++ +QK  E     N+      E      +    LL    +Q+ S +    +   L+   P  D +S L+S +  +++  E   + L  +Q ++ E +  A+++    + L  W+ + E+   + +  +LDP  L +A Q+ + L    + ++PLL+ +  +   L +     Q +     + D K    +R +++ E +  R   LE+L     E  E       +LE  + +  + ++  P     K  E L    E+L  L    +++  L  G+    P     N            D   E  E   KI      L+S+     + +  + S   + ++ L  ++D+   ++       ++ L +++   K  L  +  LR E++ H          G +    +     +PD   + +  E L R    +    + ++  I    +R +    +L E++  LD     VN +    G + +E   +  Q+Q+ K ++ +    I+PK   ++ +N +G  L + +  +   Q +   L   N  W    + L +R   LQ  LL  G+F  A++  + W+  TE  + N K    +   ++  + + K+++  ++  +A+V +M R   E I     +   +  Q+ L+ L + W +L E A ++  +LE+    AL F+   + + + +     +L   +  G       +Q+ R   +         +++        +S  S  +    ++  +  +      +++    R++ LE+A+   + F  +  + +NWL    + L +    S     + EQ +   +L  +I S ++ +    K    L   +   +++LI+  +  I  R+ ++ + SS+  R L+   + + RF    ED+N+  LD + + L  +E DT    TP+    Q    KE  C      L  D+   +G  L D  P +  + +D +V +   +++
Sbjct: 2614 TGVSQLNGAGSSSSVNGIHTCKDLTEIQVAVAEVNSRYEQLGKNLQDRQGKQQASLELRQKARQDTETLLQWLGPREQSLTQGQAGSPSRPEV-VRAQAQENKALLSELAEHSGKVEDLKKTLKQ---LITENQDSPEAETWKQQLTDIDTRWEKANTTAAQRQT-----------ELETCADRLGSFASAANQLGPWLREKELMMSVLGPLSIDPNMLNTQKQQVQFMLREFETRRPQFHQLTQAAEGILSPAGEQGSGDKDLAEVQQELAAITKQWDDLTSRLSGRSGKIDQAQGTSERFQTLLRELSMSIADLGERLDAQASLSVQPEALRRRL--QETGEIRAELEQRKGQLAQAEQLCTELSTI--VAEPYLRDELQKRLESVSSPLNSLEERAADGLSQLQSALSSTQQFQQMFEELRSWLDQKAGERIGGANDPLPCWPEALQTLLSQQEELLRGVAQQRGSYDLIQAEGTSLLASLPAGDERSALQSRLSSLRQDWEGLNQRLNERQARIKETLSRAEQYRQHRDELAPWVTDCEQREAEIQ-PSLDPAALEEALQKGRQLGLDLDRRRPLLENLNSAADQLLE-----QSRTGEEEVRDEKAQLNRRVDSLSERLHGRTAQLEELGSRLKEFEEGRQAVERRLEAAKHQLEVQEALGPQACSNKSLERLRSQQELLNSLQPQVVYLRDLAQGLVQDMPQAGGDNGDGGQQLVNQACDTEREFGEVTEKIEQCCTSLESRL----QGVGEVQSSVRDVFSRLADLDDELDSLSP--VGRDVDSLASQAEAVKSFLGRLATLRTELEGH----------GGECTTMLRREGSSPDLLALRRETEALNRQAGKLAERGQGRLALIEAAEERVREFYARLTELQGLLDLGEDGVNAQ----GVVGSEVEVIKQQLQEFKAVEREQVDSIQPK---VQHVNAVGQGLIQSAAKHTDTQALEHDLETTNLRW----NSLNKR---LQEALLHCGKFQDALEPLLSWLSDTEELIANQKPPSAEYRVVKAQIQEQKLLQRLLDDRRATV-EMIRVEGERIASTAETQDRDKIQKQLQSLGERWTDLLEKASSRQKQLEELQVLALQFHETVEPLGEWLSATERRLSSAEPMGTQTSKITQQISRHKALQEEVLSRGAEVDHLETLGQSLSPLSCTADRDWLKERVGAMRSGHTDLRDWCARRETLLEQALANAQLFGEEEVEVLNWLAEVAQRLAEVSVQSYQPELLAEQHKHTLSLNEEIVSRKKTVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKSRYAEMTAGSSKALRTLEQALQLSTRFASAHEDINQ-WLDSVEAELNNMESDT----TPAYQDRQ----KELKCVSAEKRLVLDTINEVGSALLDLVPWRAREGLDRLVADANQRYR 3965          
BLAST of Dystonin vs. Ensembl Cavefish
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 348.591 bits (893), Expect = 7.959e-95
Identity = 258/903 (28.57%), Postives = 449/903 (49.72%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEE-DIEEKIYQFRNQYADLYANLNSALEELNDD---FDHNDFRIDFNQTRLENNYLTYLKQYESFCHLFD-DISKV------DRNNENQRK----FHTIST--LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIE---CATLTNKVEE-IESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKK------KFEKLSPPTLSSGVISNRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLD----------GLNKIYEKFSTTFNEIKDSVDEFKMILESENKY-----QMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFI--EGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNW 2963
            DERD +QK+TF  W+N HL+K  + V D++ DLRDG  L++LLEVLS + L  +    RFH L+N+   LDFLR + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +SDD+S K+ LL WS++ +E Y  +  +NF+TSW+DGK F A+IH+  P L+D+  + + +  QNLE AFN A+KELGV ++++PEDV     DEKS++TYV+SL++  P+E      ++ +   ++ + Y  +   L+ +      F+   F   F +  +        K+ E      D D SK+            Q K    +H I     W +      E+  +L  E ++++R ++I   + +E   C    N +E  ++S IR +S         +  +Y A + ++L   ++ I  +   VQ LK DG    A+Q YR +  ++ ++  ++       K   + PP  SS        +P    EL D+V          W++E    I    + +DL           GL++  E F +     +   DE ++   S++ Y     ++D+ + +  N  K++      N  ++ A       F++ + + + W+  KE++++++ W D  +  ++ K+E +  L+ ELE+RE  +NE  A G  L    H     ++   A L+++W WIL L  C++ HL+    Y QFF +  EAD  + ++ + +  ++           E L ++  D  E + ++K  +  +   ++S+  L  R  +   + +  V+A+C      DF   +    +GE   L NNS    W+V N        P++CFL+  ++ +A ++   LD+    +  LW +  + ++     Q L+  + ++++W
Sbjct:    9 DERDRVQKKTFTKWVNKHLIKAQRHVSDLYEDLRDGHNLISLLEVLSGETLPREKGRMRFHKLQNVQIALDFLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMSAKEKLLLWSQRMVEGYQGMRCDNFTTSWRDGKLFNAVIHRHEPRLVDMSKVYRQTNLQNLEQAFNVAEKELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRETVSGGVRVSELELRWQEYYELVTILLQWIRHHVIIFEERKFPASFEEIEILWRQFLKFKETELPAKEADKDRSKLVYQSFESAVQAGQIKVPPGYHPIDVEKEWGRLHVAILERERLLRTEFERLERLQRIVSKVQMESGVCEEQLNHLETLLQSDIRLLS-------AGKPAQYTAEVGRDLDKADDMIRLLFNDVQILK-DGRHLQAEQMYRRVYRLHERLVNLRSDYNLRMKSAVVVPPLTSSP-------SPRARPEL-DDVTLRYAQDLLAWVEENQRRIETAEWGSDLPTVESQLGSHRGLHQTVEDFKSKIERAR--ADENQLSPMSKSTYREYLARLDLQYAKLLNSSKSRLR----NLDQLHA-------FVNAATKELIWLNDKEEEEVNFDWSD-RNTNMTAKKENYSGLMRELELREKKVNEIQATGDRLIREGHPGKKTVEAFTAGLQTQWSWILQLCCCIEAHLKENTAYYQFFADVKEADEKMKKMQDTMKKKYTCDRSTTSTRLEDLVKDALDEKEQLNEFKTQLAGLNKRARSIIQLKPRNPTNPIKGKQPVQAVC------DFKQMEITVHKGEECALLNNSQPSNWKVLNRSGAEAIVPSVCFLVPPVNKEAVESVSNLDAGLQQMTTLWQRLHIDMKSLLSWQYLMKDIQIIRSW 875          
BLAST of Dystonin vs. Ensembl Cavefish
Match: pleca (plectin a [Source:ZFIN;Acc:ZDB-GENE-030131-8984])

HSP 1 Score: 279.256 bits (713), Expect = 7.349e-74
Identity = 225/886 (25.40%), Postives = 419/886 (47.29%), Query Frame = 3
Query:  456 HLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKI----YQFR-NQYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFC-----------HLFDDISKVDRNNENQ--RKFHT--ISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMN-----EYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVISNR------------QYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFK-SFLEFLHKSNESIA--WIKTKEDQQ----IHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNW 2963
            HL+K  + + D++ DLRDG  L++LLEVLS + L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +SDD++ K+ LL W+++ +E Y  +  +NF+TSW+DGK F  +IHK RP LID+  + + +  +NLE AF  A+++LGV ++++PEDV     DEKS++TYV+SL+++ P+  D+++ +     + R  +Y +L   L   +      F+   F   + +  +E  +  +LK  E+             H++       +  + +    +H   +   W +      E+  +L  E ++++R ++I   + +E      ++ ++ES        +L+T  + +      ++ A I  +L   EN I  +   VQ+LK DG    A+Q YR +  ++ ++  ++ ++       L SGV   +            Q +P       D V    +     W+DE    I    + +DL  +                           E++       HQS  D ++K +    + +++    K ++ E+L K +       + T+ + Q    I +  FD  +    E+ E+     D+L ++E                 H A + ++  +A L+++W W+L L  C++THL+    Y QFF +  EA+  + ++   +  ++     + +   E L ++  D  E + ++K  ++ +   ++++  L  R  +   + ++ V+A+C  K+      R    G+   L NNS    W+V ++       P+ICF++   + +A ++   LDS    L  LW K  + ++     Q L+  +  + +W
Sbjct:    1 HLIKAQRHITDLYEDLRDGHNLISLLEVLSGETLPREKGRMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMTAKEKLLLWAQRMVEGYQGLRCDNFTTSWRDGKLFNGIIHKHRPHLIDMSKVYRQTNLENLEQAFCVAERDLGVTRLLDPEDVDVPHPDEKSIITYVSSLYDVMPRVPDVQDGVQANELELRWQEYYELVTMLLQWIRHHVIVFEEKKFPTSYEE--IEVLWRQFLKFKETELPAKEADKNRSKHIYKAFEGAVQAGQIKVPPGYHPLDVEKEWGRLHVAILERERLLRTEFERLERLQRIVSKVQMESGVCEEQLNQVES--------LLQTDVRALGSGKPVQHAAEIEADLDKAENMIRFLFNDVQQLK-DGRHLQAEQMYRRVYRLHERLVNLRSEYN----LRLKSGVTITQVPVTQISMSQTLQQSPQRVRPELDEVTLRYIQDLLGWVDENQRRIDGATWGSDLPSV---------------------------ESQLGSHRGLHQSIEDFRSKIDRARADENQLTPVSKGAYREYLGKLDLQYGKLLVSTELETQNIIKIMFTGFDARTGTAGEENEQCSGHGDKL-LKE----------------GHPAKSTVEAFMAALQTQWSWMLQLCCCIETHLKENTAYFQFFSDVKEAEERMRKMQESMKKKYVCDRSITVTRLEDLLQDAVDEKEQLTEFKTHLDGLNRRAKTIIQLKPRNPATPVKGKLPVQAVCDFKQMEITVHR----GDECALLNNSQPFKWKVRSTSGSEATVPSICFIVPPTNKEAVESTSGLDSSLQKLMILWQKLHVDMKSLLSWQYLMRDIQFINSW 823          
BLAST of Dystonin vs. Ensembl Sea Lamprey
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 618/2384 (25.92%), Postives = 1188/2384 (49.83%), Query Frame = 3
Query: 12465 SSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAE--QKIETAEKSM------HKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAK--------------LLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSE-YQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAF------ENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSD---QINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHP---EKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVN-----STLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQ---RLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAP-IQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFV-------NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRH 19445
            + + ++   L+ + + ++  +  +    T   +L +++D    ++ D+D+L+ Q+  L +       I++ L NL+ E+    E   K++  E  M       +++ L   + ++ +  D RQ  L        E  ++  DF RKI   N   + A+              L+N   +   +F + +V+PL+  ++E+  +G+    +    +  + +E E++     ++ L + V++    +   L+   KF  +LE+L  ++ +    +  ++ PS EY   K+Q+   +LL   L  R+ S++ + K G  +  +   P K ++  +L  L  ++E L + A+ +  + +  + +++ F +  EP   WL   EK L+N +   T  AI+++++I ++K L+ D ++  + + +L  +   +            + ++ ++  R+ E  +++      L     +      D+V L  + L   +  + D+      P   +   +E L+L +E+ S ++T+    + G++L + ++ ++   I  K++ + + + EI+ S+ + L   E ++ +A +F   + +L+  L    + +   D+    VGE+ +  +++  N++ K V + R  LD +  V +         + E ++ +  E+  R++ V + V +K  ++ +   +++  E+  D  +  ++  E+K+  + D   + +   S+L+  K    ++L      K+SI+  +    +L       +  +++S +  + +  +  ++    +  QL+ A  L+ +F  +Y  L  WLVET E++      +++ + L + ++E++ L  S  + KP +D + K G  L ++ +  +G  +      A++ +  I+E ++ RA  L++ +  ++++ E  D+    LE +   I     P   P   EK+ E+L     I  +L+KLQ   + L+   E        A  + ++  I +KL ++ S  + +QS++ E + +++++L LA  FW DL  +     E   ++ +     ++   +  +++ +   + +ID  ++D+  +   G  LI     P++ P+V+++ +E+  +++ +    + ++  ++       + ++    + +W +     +  L P+ T+   V  Q++  K+LK +   +  ++E ++  G  + K     +K + N       L  + + W  L   +  RQH+++  LL+LG+F  A+DE + W+  TE  L   K    +  ++E+ LA+H ++R D+   Q++V  ++R   +++   +SS G + T    R    R   E L E    +   L D L +A  F G+   + + + ++ ++L   K  GGLP+TAKEQL   M++   +                   ++ QS    ++  ++ L  KW  V N    R+++LE A++T   FH  +  FI WLT  E NLN   P S I+ ++L Q++ H+ L  ++ +HRE+++ LDK  THLKY SQK D+ LI+NL+ S+  RWE ++  + ER R+LD   K AK+F +    L+D +    + L+ +   G  P +I+  + +HK+   +LG     YDST R G  L+++A  + D +++D ++  L+ KW ++C KS+ER+  L +ALL SG + +A+  L+ WL  +EP LS+  +   GD+  V TL++ H + +++L  R   +  +   A  L+  S+ D+S++  Q+AEL + W+ V KL+  K+ RL+ A  QA  F  L  S+ +  +++E  LR     P++  E+ +  +I+ H  F + L     ++      G  IL   +P++  +IK +INII++++ ++++W+ Q    L+  L  L     LL+++L WL  A+  L   +   L   +    +  +EH+ F+ +M  KQ + +++  + K+K      +FDR++     +G  +   P          NP+I  L ++W+QVW + L R+++L D +E L+E++  +NF+F+ WR+RYM WMNH KSRVMDFFRR D D DG++TR+EFIDGI+         S+F T R+EM  VADIFD++  G+IDY +F+AAL P+++ Y  +P  + + I DEV +Q++ C C+  +++ Q G+ KY+      FGD+++LRLVRILRS VMVR+GGGW ALDEFLVK+DPCR                      AKGRTN ELREK   P+G   +M PF+ +                PS R + P  +   H          P  +       PSS  S + ++PR  + +  PG      + T   S     AS  H
Sbjct: 1024 AGITERCSVLDGRLQGVNRFQGHVRELFTSLTDLDDELDTMGPTARDVDTLQCQLEHLGS-------IQEKLQNLRDEIRKAGEGCAKMQENEAGMDLQGVKREVETLKKQSGRLADRTDTRQAEL-------QETLAQVEDFHRKIQALNQQLQAAEATEDEQGPVAAELELINQQMETFQSFQKGEVEPLQVSVQEVNTLGHGLVQSAAKSVATQGLEHELEETNACWNTLNKKVAERAVQLQRALLHCGKFQDALESLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLALLLDDRKHSIEVIRKEGQQIADSADAPDKEKILKQLSSLGRRWEALTSKADARQKQLEGILVVAQQFHETLEPLSEWLSGTEKKLSNLEPIGT-QAIKIQQQISQHKSLEEDVNARSKPLHQLLGLGQALKASSGGGEREAVQVQLEQVQARYLETAERTRRRGELLGQALAHARLFGDDEVELL-NWLAEAQDRLADMSPGDHQPDVLQAQHDEHLSLHEEIVSRKQTVDQAIKNGQNLLKQTTGDEILTIQEKLDGIKSRYAEITGSSTRALKTLEKALHLATKFHGTHRELNEWLGHAESEMATCDTRLA-VGEQ-LAAMQDRVNTLHKDVMERRLTLDTVNEVSSALLELVPWRAREGLDRLVAEDNSRYRVVSDAVARKTDELDAAVQRSQQFEQTADNELAWVAETERKLRALGDVSLEQDTTTSQLQVQKAFTIDIL----RHKDSIDQLVKTGDELKVSCSEEEKAAMESKLASLLEHYDVVSRLNTGRLSQLERAQLLSTQFWETYEELMPWLVETRESLGHLPPPSIEQETLRQQQEELRQLRESIAEHKPYVDKLKKIGPQLEEL-SLSEGPALREKYTGAERLFEAIREDVRLRALGLDEALSQSSQIKEFHDKMDVMLEGLGRIIERLRMPPPIPAEAEKIKEQLAENKNIALELEKLQPMFNLLKESGEELVGLSGGAEKELNAKAIKDKLGQMLSLWEEIQSRSEERENRLLDVLDLAERFWTDLGTMLATLKETREYMQDLEELGVDPSLIKQQEEYMLANKNDIDGFQEDLEILRYLGTNLISACGEPDK-PEVKKSIDEMNSSWDRLNKCWKDRMDKLEEAMKTAMQYQDALQSMFDWVENATTEMENLPPVGTDLETVKRQMEDLKQLKTESYQQQIEMERLSHQGELMLK----RVKEEENRMVIAGPLRDLKEQWETLDTKILNRQHKMEAALLALGQFQHALDELLTWLEHTEGLLEEQKPVANEPKAIEIELAKHHVLRNDVLAHQSTVGTVQRAGQDLV---LSSSGADPTTERIRTSTKRNRKENLTETTIRREPSLTDNL-QAQGFQGEMDGLLQWLSDMENQLSDTKPVGGLPETAKEQLSTHMEMCEEYQV--KHGLYTKVLEQCQRMQNEQSGEPTLKYGIQDLEHKWKIVGNKLNERRAKLETALKTAIEFHNSLQDFIGWLTQMENNLNTLSPASLILDSVLFQIDEHKMLANEVNTHREQIIELDKTGTHLKYFSQKQDVALIKNLLLSVQTRWEHIMQSTLERGRSLDDARKRAKQFHESWTKLMDWLEGAEKGLDHELDCGNDPERIKLMLGRHKDIQKSLGAKQPIYDSTTRTGRTLKERATLVDDDQRLDNMLSELRDKWDTICGKSVERQHKLEEALLFSGQFAEALQVLIDWLYKVEPHLSE-DQPVHGDVALVMTLIDAHKVFQRELGKRASSVNALKRSARDLLDSSKSDASWVRAQMAELSARWDTVCKLSLSKQARLDNALKQAEVFRTLVQSIMDVLAEAEKTLRFHGTLPDD--EDSLRLLIAQHKEFMERLEAQRSEVIRAVSMGEAILAVCHPDSASAIKQWINIIRTRFEEVMTWARQHQTRLEAALSELVSNSQLLEEMLAWLQKAQEMLAQRDQETLPEQIESLHYLISEHQGFMEEMMSKQPEMEQMTKSYKRKPSESHALFDRTRGSTRKRGGPQSTAPASPSQPLETKNPRITLLFNRWRQVWLVALERQRKLQDALERLQELKEFENFDFDVWRKRYMQWMNHKKSRVMDFFRRMDKDQDGKITRQEFIDGILS--------SRFPTNRLEMTAVADIFDRDGDGYIDYYEFIAALHPNKDAY--RPITDADKIEDEVTRQVAACKCTRRFQVEQIGENKYRFYLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCR----------------------AKGRTNLELREKFILPEGASQSMTPFRMR-----------GKRSRPSSRTASPTRAGFAHSHGGHGHAYTPTPNSGGCATPPSSGSSNTPSTPRGSR-LRPPGYLSGKSLHTGDDSLTSDSASETH 3326          

HSP 2 Score: 72.7886 bits (177), Expect = 3.561e-12
Identity = 205/1142 (17.95%), Postives = 479/1142 (41.94%), Query Frame = 3
Query: 14685 KSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKR------YNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEF---WNDLK--LIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDE---WFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFH-------RAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRL-EQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRAL-KRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNL---MSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQS-EEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWN----SLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDL 18017
            +S +  +  Q  +  ++   +QQQL+E+  L + F +  + L  WL+E +  M      ++DP+ L   +Q+++ +   +E ++P  D + ++    +Q +    G+N  AN   A++       + +I   + +R+  ++  +  +    + + + ++++  +  +++     S  PE +  +L    EI  +++   +  D+L+     C        +     EI  +L  +    K L+ +  +   ++   L+ + +F   +++L+  L E +  + T+   ++ I+      +  + +   D    ++ H      +  +G+ L++      E   ++     LK ++E +    +Q      R Q  + K +  +   DE   W ++   +L  +  +  +   V  Q+   K ++ D+E +H  +E +N            + +  V    A +N     L + +  R   L+ +   L EFH       + +D+  +  I + +++ N    +  +  +       K     M      V  M   A  ++ +        +  RL E+ R S++        +   L+  L+    F G  +E+  ++ +L  +L+    +    DT + QL+    I      L  +I K  E  A++ +  +    + ++ ++E L K+   + +  +TR++ L++ +  VE FH  +      L   E   ++Q PV+  +  I +Q+E  ++  K ++   +  +  ++ +   L   + K   V  + L   +   +  W  +  + +ER+  L        +F+D   +LL  +A   E++            ++ QI + K     L     + +  R+ G Q+ D A   D +KI + + +L  +W++L +K+  R+K L   L+++  + + +  L  WL   E KLS+     G     +Q  +++H  LE+ +  R   + ++     AL   S   +   ++ QL ++++ +        E+ RR  E   QA+   RL+      L  + ++++  L    +SP + + +++      H   H+ ++  +  ++   + G  +L     +   +I+  ++ IKS+++++
Sbjct:  461 RSMLKELDDQWAAVHQSASERQQQLEESCGLLETFRTLESQLSQWLMEKQLMMSVLGPLSIDPNMLANQKQQVQFMLKEFEARRPQYDQLNQA----AQGILGKGGENREANERVAEQHAAVNGTWGDITGQLSSRSDRIDKALETSATYADVLRELSDKVSGLGAKLSKQGPLSTQPEVVKRQLEEAGEIAGEIE---LQKDQLEEAEYLCQELSDLVQEPYLQTEIRRRLGSVMVPFKELEDRAGDRMNQLQTALASSQQFQQMFDELRGWLDEQRGEQATMPPISAKID-----QLQAQLQQQSDFLKSLNQHAGTYHVVVAEGEALLQATQPGAEKTALQTQLASLKEHWEDL---MKQAGDRHHRLQDALKKAQHYKQLADELRPWVEDSEGKLTAIDKVSIDQTEVDRQLAGGKAMRQDVERRHGMLEALNTAADNFIDSCQVD-EEMVRDEKAELNQRMDNLTENVLLRVEGLEEMAQRLKEFHDSQKDIQKKLDDACQ-QIRSHDAMGNQAFNNKQLEKM-------KAYHEGMEALAPQVDYMHNFALGLVADASEGSDTSSVVRLTEETRSSFDSALAGITERCSVLDGRLQGVNRFQGHVRELFTSLTDLDDELDTMGPTARDVDTLQCQLEHLGSIQEKLQNLRDEIRKAGEGCAKMQENEAGMDLQGVKREVETLKKQSGRLADRTDTRQAELQETLAQVEDFHRKIQALNQQLQAAEATEDEQGPVAAELELINQQMETFQSFQKGEVEPLQVSVQEVNTLGHGLVQSAAKS--VATQGLEHELEETNACWNTLNKKVAERAVQLQRALLHCGKFQDALESLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLALLLDDRKHSIEVIRKEGQQIADSADAPDKEKILKQLSSLGRRWEALTSKADARQKQLEGILVVAQQFHETLEPLSEWLSGTEKKLSNLEP-IGTQAIKIQQQISQHKSLEEDVNARSKPLHQLLGLGQALKASSGGGEREAVQVQLEQVQARYLET----AERTRRRGELLGQALAHARLFGDDEVELLNWLAEAQDRL--ADMSPGDHQPDVLQAQHDEHLSLHEEIVSRKQTVDQAIKNGQNLLKQTTGDEILTIQEKLDGIKSRYAEI 1569          
BLAST of Dystonin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002838.1 (pep scaffold:Pmarinus_7.0:GL477168:22072:87306:1 gene:ENSPMAG00000002584.1 transcript:ENSPMAT00000002838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.062 bits (645), Expect = 4.874e-70
Identity = 119/236 (50.42%), Postives = 174/236 (73.73%), Query Frame = 3
Query:  390 VLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDI 1097
            +L +ADERD +QK+TF  W+N HLMK+ K V D++ DLRDG  L++LLEVLS +KL  +    RFH L N+   LDFLR + IKLVNI ++D+ DGNPKLTLGL+W IIL FQ  DI  S +S+D++ K  LL WS++ +E YP I  +NF+TSW+DG+ F A+IH+ RP+LID+K ++  + ++NLE AF  A++++GV ++++PEDV     DEKS++TYV+SL+++ P+  ++
Sbjct:    1 LLLIADERDRVQKKTFTKWVNKHLMKVRKHVNDMYEDLRDGHNLISLLEVLSGEKLPREKGRMRFHRLHNVQIALDFLRLRQIKLVNIRSDDIADGNPKLTLGLIWTIILHFQIADIQVSGQSEDMTAKDRLLLWSQRMVEGYPGIRCDNFTTSWRDGRLFNAIIHRHRPELIDMKRVAVRANRENLEQAFTVAERDMGVTRLLDPEDVDVPSPDEKSIITYVSSLYDVIPRMPEV 236          
BLAST of Dystonin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006515.1 (pep scaffold:Pmarinus_7.0:GL476558:286719:335794:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.588 bits (623), Expect = 3.921e-68
Identity = 175/670 (26.12%), Postives = 321/670 (47.91%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFEL--NPK------EEDIEEKIYQFRNQYADLYANLNSALEELNDDFDHNDFRIDFNQ-------------TRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIE---CATLTNKV-EEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVISNRQYTPIHSM-ELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLDGLNKIYEK---FSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDAD-FKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQ 2318
            DERD +QK+TF  WIN HL ++   + D++ DLRDG  L++LLE LS   +  +    R H ++NI  VL++L+ Q +KLVNI  ED+VDGNPKLTLGL+W IIL +Q   +           ++ LL W+R   +D P ++  NFS+SW+DG+   A++H  RP L+DL+ + +  A+QNLE A + A+ ELGVP++++PEDV     DEKS++TYV++L     N K      +  I   +  + ++Y  L A+L   +EE         F    ++             +         L+  E +  + + +               + T+W       + + +IL +  KK++  ++++  ++++   CA   NKV E +++ +  I+       +  + ++   IS+ L + E  + ++   V+ L   G   P     R +  +  ++  ++ +  K++          +R    + +     D    + L +   W+    A + +  +  DLD    + E+      T    + S+ E +  ++S ++     D+ +S + L+ ++++L +N S+      ++   FL +    + W+  +E++++ + W D     L  K+E +  L+ ELE RE +  E +  G  L    H     IQ
Sbjct:    1 DERDRVQKKTFTKWINSHLQQVRMNIGDLYEDLRDGQALISLLESLSGDCIIREKGRLRVHHVQNIQIVLNYLQHQQVKLVNIRKEDIVDGNPKLTLGLIWTIILHYQ---VSAGQVGGGTPGRERLLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVSALHNALHNHKVVSSIPDGVIRTALRHWLSEYWQLAASLRVWIEERTITLKSRTFPYSIDKLMVMQKEHALMKNSEFPKKKAELLQLEEVYKSMEEAVQACLIKTVPPPPPPPVRTVWGGLHVQVRYREVILRSNFKKLEMLQRLAQKMEVDTNTCAEGLNKVYEALQADVALIN-------SGRVPQHGEEISRCLSEIEVFVQSLYPDVRTLTDGGCSQPELLQSR-LRRLEEQVASLRAEHAKITAHAGEGARSRSRDEAQLQAASSQQDQTAAAYLQELLTWVQSNQATVDKSGYGKDLDETTALLEEQKALHQTIENFRSSLGEAQETMQSVSQGSR-YDYSKSLDKLEQQYSKL-LNGSRARLGLLENQQGFLRRCQREMLWLTQREEREVAYDWSDLNP-DLEPKKEAYALLVRELEQREPAFREVVQAGEDLVGEGHPGNPTIQ 656          
BLAST of Dystonin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.713 bits (574), Expect = 1.572e-58
Identity = 207/797 (25.97%), Postives = 376/797 (47.18%), Query Frame = 3
Query:  399 VADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKL-FTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDD----LSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIE---EKIYQF------RNQYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFCH-------------------LFDDISKVDRNNEN------QRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRK----ISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVISNRQYTPIHSME--LGDNVLYSSLNKWKNWIDE-KCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQS-----KNDLKTKFNELWINCSKIDADFKSFLE-------FLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDE--GEILNREIRDMLETIEDYKETVNRIIAISQSV 2609
            +ADER+A+QK+TF  W+N HL +++ R+ D++ DLRDG +L+ LLEVLS +KL        R HCLEN++  L FL+ Q + L N+ + D+VDGN +L LGL+W IIL FQ +DI  S +++D     S K  LL W +     Y ++NI NF+TSW+DG AF A++HK RPDLI+   + K++A  NL+ AFN A+++LG+ K+++PED+     DEKS++TYV + +    K + +    ++I +        +Q  D Y  L S L E  +        I  N  +  N+     +Q ++F                     LF   SK+  NN+        +  + I+  W + E    E+ L L NE  + ++ E+++   D + A     + E +  + +    +  P ++  TK+      +I  ++   E ++  ++   +EL+ + Y        +  +  + D V + +E L        +++ R+    H +E  L    ++  +    +W+DE K  ++S+ ++   L G+  + +K +    +I    D  K +  +  ++  + D ++       ++  T   E +     + A+ +S LE       F  +  E   W++ KE   +       +   +     + + + DEL  R   + +T+  G  +    H  A+ I+  +A +   W  + +L    K  L+      QF     +AD   +E+  +   R      +G DE   + LN++ +D+ E I  Y+  ++ +   +Q +
Sbjct:   51 LADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDI--SVETEDNKERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPEDISVDQPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLESAIETDQMIDKYETLASELLEWIE-----QTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHE----AIEADIAAYEERVQAVVDVARELEAEDYHE------VRRVCSRRDNVLRLWEYLQE------LLAARR----HRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQ-DYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAYKPCDSHVVSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEP-LLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQF-----QADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGL 813          
BLAST of Dystonin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006506.1 (pep scaffold:Pmarinus_7.0:GL476558:286440:335800:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 214.157 bits (544), Expect = 3.976e-57
Identity = 108/256 (42.19%), Postives = 164/256 (64.06%), Query Frame = 3
Query:  399 VADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQ-SSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKIYQFRNQYADLYANLNSAL 1163
            +ADERD +QK+TF  WIN HL ++   + D++ DLRDG  L++LLE LS   +  +    R H ++NI  VL++L+ Q +KLVNI  ED+VDGNPKLTLGL+W IIL +Q             +  ++ LL W+R   +D P ++  NFS+SW+DG+   A++H  RP L+DL+ + +  A+QNLE A + A+ ELGVP++++PEDV     DEKS++TYV++L     K +D + ++    N+ AD +  L ++L
Sbjct:    1 LADERDRVQKKTFTKWINSHLQQVRMNIGDLYEDLRDGQALISLLESLSGDCIIREKGRLRVHHVQNIQIVLNYLQHQQVKLVNIRKEDIVDGNPKLTLGLIWTIILHYQNASFAHIEGNHSSMQSRERLLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVSALHNALHK-QDGQSRVALDANEDADEFWRLAASL 255          

HSP 2 Score: 53.5286 bits (127), Expect = 1.689e-6
Identity = 40/187 (21.39%), Postives = 82/187 (43.85%), Query Frame = 3
Query: 1791 DNVLYSSLNKWKNWIDEKCAIISEINFTNDLD----------GLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADF-KSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQ 2318
            D    + L +   W+    A + +  +  DLD           L++  E F ++  E +++     M +   ++Y    D+ +S + L+ ++++L +N S+      ++   FL +    + W+  +E++++ + W D     L  K+E +  L+ ELE RE +  E +  G  L    H     IQ
Sbjct:  573 DQTAAAYLQELLTWVQSNQATVDKSGYGKDLDETTALLEEQKALHQTIENFRSSLGEAQET-----MSVSQGSRY----DYSKSLDKLEQQYSKL-LNGSRARLGLLENQQGFLRRCQREMLWLTQREEREVAYDWSDLNP-DLEPKKEAYALLVRELEQREPAFREVVQAGEDLVGEGHPGNPTIQ 748          
BLAST of Dystonin vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 80.1073 bits (196), Expect = 6.962e-15
Identity = 70/242 (28.93%), Postives = 123/242 (50.83%), Query Frame = 3
Query:  408 ERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLS---------DQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIII---LFFQFKDIVQSSKSDDLSIKQILLQWSR-KALEDYPDINIENFS-TSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQ----NLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELN 1079
            ER+A   R F  W+N   + ++  V  +F+DL+DG++LL   E +          +++  +   ISRF  LEN N  +D  R++   LV I   D+VDGN  LTLGLVW ++   +    K +  SS   D+S  QI L+W++ +  +   +  I +F   +  +    L +++   P  +D   ++  + ++    N  +A + A+K LG    + PED+    +  + ++T++ASL  LN
Sbjct:  411 EREA---RVFTLWLNS--LDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTL--SSSGRDMSDSQI-LKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARK-LGALIWLVPEDINE--VRARLIITFIASLMTLN 641          

HSP 2 Score: 60.077 bits (144), Expect = 1.079e-8
Identity = 50/192 (26.04%), Postives = 88/192 (45.83%), Query Frame = 3
Query:  573 ISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIII---------------LFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYP-DINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIE 1100
            ++ F   EN N V++  ++    +VN+H+ED+++G   L LGL+W II               L+   +D     +   L  +QILL+W    L+    +  + NFS    DG+ +  L+++  P L     +      +  E     A+K L   K + P  +++G  + K  + +VA LF  +P  E I+
Sbjct:  208 LNNFQASENANIVINSAKAIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYHLKQANWNRRVTNFSKDVSDGENYTILLNQLDPALCSKAPLQTTDLMERAEQVLQNAEK-LDCRKYLTPSSLVAG--NPKLNLAFVAHLFNTHPGLEPIQ 396          
BLAST of Dystonin vs. Ensembl Nematostella
Match: EDO37706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF35])

HSP 1 Score: 504.597 bits (1298), Expect = 3.091e-147
Identity = 371/1352 (27.44%), Postives = 661/1352 (48.89%), Query Frame = 3
Query: 15570 EDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTN--IKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKE-DVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSE-EDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNE---------RKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQG--ISKIQEPLFV-----NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYK---------FGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTK----KPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQS--LASPRTPKVV---ASPGLQRKSRIPT---RQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 19502
            ++LR E+D H   +  + +    L+E  + P +   V+     +   +E +    +++   +   +    +  ++ + +  W  E+  +L  + P+ TE   V  Q++  K    ++ P   +I  INQLG  + +       + V++ L  +N  W  L +    RQ +L+  LL LG+F  A  E + W+  T+++L     K   GD+  +E+ LA+HK+++ D+   + SV  + R A+ +++  +  S   E   ++++L+ +W+ +   +  +  ELE ALK++  F    +E+   ++E    L+  +  GG P+ A +QL +  D             + +E    +   +  +   +++  ++ L   W+ V + A     +LE+A+    +          WLT  +  ++     S I+  +  Q E ++ LK DI +HR+    +  +A  +  +  K D V I  +MS +  RW+++++ SS R R+LD  Y+ + +F      L+  + +  E L+ +  IG  P+ +R Q+ KHKEF   LG +    D+T ++G QL D++  +D+  I+  + +L+ +W ++C  S+ER++ L +ALL +G ++DA+ +LL WL A+EP LS  +    GD  TVQ L++ H   +++L  R+   + +     A++ +++ E+ + +E++LA+L+  W+ V  ++N K+ RLE A   A EF+    +      + E  LR+  + P  E  E I   +  H +FH  L   E+ +    + G  IL   +P A   I+ ++  +K +W ++  WS QR + L++ L +L E         R I   +  L     E   +  +  E  + L E      EH+ F  +M  KQ  +D +  ++K++T          K   + +G  +S+I           NP ++ L  +W+ +W + + R +RL + +E +        FNF +W+ R+  W++ SKSRV D FRR D D DG++TR++FI G+++        + F T R EME+VA  F  E++G IDY++F+ AL+ D+ + + KP  + + IH+E+ +Q+  C C+  +   + G+ KY+         FGD++KLRL+RILRS VMVR+GGGW  L EFL K+DPCR                      A+GRTN +LR +L    G   +MA FK K  +L         KPT     +    +P S  R            P TS      +PS R  +S  L SPR P +    +   L+ +++ PT   R+T   G+    +  SR  S  ++ ST  +  E
Sbjct:  215 DELRKELDGHTPRVTSLCEASPALVENCS-PGDRAHVQSELNAVTEQWEGIEKGWQKRRGELVEVKVTSEQYHKLFVVILVWLDELELKLSEVPPVGTELATVQEQLKLHKAFHAELTPHQSEITQINQLGSTVGERCRHEDSDLVHAQLEEVNHRWDELCNHSTGRQQKLEEALLQLGQFQLAFQELLVWLRQTDSTLDEQLAKKVQGDVKYIEIELAKHKILQNDILSHEPSVDSLSRAASALLESGETDSTALEG--KVQELKTTWDAVLAKSAQRQAELEKALKDSHSFMSQIKELRGWLNEASEFLKSRRAIGGRPENATKQLNKHKDFMVVIETRQKIYVQIVEVVENLIDTADPTTAASLQRQLDELKTSWEQVTSRAAEESEKLEQALTNATSLEAQTSDMDQWLTRVDGVVSVYERPSTILVVLETQREEYKELKEDIDAHRDPYKGMRLLAHKISDVCIKEDGVYIEGIMSGLEERWKELLTTSSARKRSLDENYRMSSKFFGGVEDLMKMLDAAEEALKNEEPIGVDPAHLRTQLKKHKEFQTMLGANQAGLDATVKMGKQLMDRSLDEDAITIEGKIADLKARWDAVCGLSVERQQKLEEALLFTGMFQDALQSLLDWLFAVEPSLSTETA-VMGDPETVQILIDNHKTFQRELGRREANYQSVMKAGRAMINENKVEEPAALEEKLADLRMRWDAVYAMSNTKQDRLENALVLAKEFDSSVKTELHILKQFEENLRE--LGPIAEDLEEIKEQMEKHRVFHDELKQEEVNVQSAVKKGQVILRFCHPSAIQIIQQWLARLKKRWDEVWKWSSQRLMRLEEELRKLAEEDELMGELLRWIQTKEEALAEKEKEP--IPDDDYEEVHRLLE------EHKVFQEEMAKKQPSYDRLTKSAKRRTNGSTTRTPEVKATPSRRGGAVSRIPRSSPAGRSAHNPAVSHLSKRWQHLWLLSMERLRRLQEKLERIAIKRASAKFNFPEWKSRFNKWLHDSKSRVQDIFRRMDHDRDGKLTREQFITGVLN--------TSFPTERWEMEIVASKF--ERNGLIDYKEFMNALK-DKPSPE-KPKTDAQKIHNEIDRQVEHCCCAKQFSYFKVGENKYRVSHAKKERYFGDSQKLRLLRILRSTVMVRVGGGWETLQEFLEKNDPCR----------------------AEGRTNLDLRAQLVGDAGFAESMATFKSKRPSLSREGSDIGGKPTRESSGTSLRGKPPSGAR------------PKTSTSSGLTVPSVRREKSGELLSPRAPSIAKARSGSNLRAQAKSPTPGMRKTGSYGALKDAKVVSRSDSQSSIGSTGSREGE 1506          

HSP 2 Score: 119.398 bits (298), Expect = 3.976e-26
Identity = 189/923 (20.48%), Postives = 400/923 (43.34%), Query Frame = 3
Query: 15345 EILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTN----STIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTK-ELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMER---KAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLE---MFKFSGGLPDTAKEQLKRFM---DIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFE----DMNR--TLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQS-EEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKE-------ELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWS 18029
            E+  KLAKI +    ++++    +EK+   +    EF   L    +K  ++   L +    S + D+    V  +K  +E+ R +    E    K+S  G  ++E +    E  D++   +++++ +++V    +++   +DR  +       + ++L    K+V +R+  L  LP+     L + Q    EL+ +++     +  + +    L +   P  +  V S L  + + W  +  G  +R+ +L  + ++  ++H+     + W+   E  L+ +     ++ +++  L  HK   A++   Q+ ++++ +      E  + + S L H    +LE++   W+EL  H+  +  +LE+AL +   F    QE+   + +  S L+     K  G +     E  K  +   DI    P ++      +  +A    +S ++   A+E  ++ L   WD V   +  R++ LEKA++   +F   + +   WL    + L  +R +        +Q+  H+     I + ++  + + ++  +L   +       ++  +  +   WE+V SR++E S  L+     A   E    DM++  T +D + S   + ER ++I       RE+   +KE   ++  H   Y   R L +++ D    +D   I+ I+  L+ +W+ L   S  R+++L++   +S  +   + +L+  L A E  L +     G D   ++T L +H   +  L      ++        LM +S +ED+  IE ++A+LK+ W+ V  L+ E++++LEEA      F+    SL ++          F + P    E       E +  +I NH  F + L   E       + G  ++     E   +++  +  ++ +W  + + S
Sbjct:   30 EVNTKLAKIKTPLDAIEAKVNNRQEKLQLAVLQTQEFQTTLDDFTEKLAKIEDDLEHVGPVSAVYDV----VKRQKHKVEEARDDCKQLEPVFEKVSSCGNDVLESLEAGEEKDDLKGKLDDMEQRWKSVVELYDERQKALDRSLNAAEVFWPVLLELKAALKDVQDRME-LEDLPSADLEALAEQQADHDELRKELDGHTPRVTSLCEASPALVENCSPGDRAHVQSELNAVTEQWEGIEKGWQKRRGELVEVKVTSEQYHKLFVVILVWLDELELKLSEVPPVGTELATVQEQLKLHKAFHAELTPHQSEITQINQLGSTVGERCRHEDSDLVH---AQLEEVNHRWDELCNHSTGRQQKLEEALLQLGQFQLAFQELLVWLRQTDSTLDEQLAKKVQGDVKYIEIELAKHKILQNDILSHEPSVD-----SLSRAASALLESGETDSTALEGKVQELKTTWDAVLAKSAQRQAELEKALKDSHSFMSQIKELRGWLNEASEFLKSRRAIGGRPENATKQLNKHKDFMVVIETRQKIYVQIVEVVENLIDTADPTTAASLQRQLDELKTSWEQVTSRAAEESEKLEQALTNATSLEAQTSDMDQWLTRVDGVVS---VYERPSTILVVLETQREE---YKELKEDIDAHRDPYKGMRLLAHKISDVCIKEDGVYIEGIMSGLEERWKELLTTSSARKRSLDENYRMSSKFFGGVEDLMKMLDAAEEALKNEEP-IGVDPAHLRTQLKKHKEFQTMLGANQAGLDATVKMGKQLMDRSLDEDAITIEGKIADLKARWDAVCGLSVERQQKLEEALLFTGMFQDALQSLLDWL---------FAVEPSLSTETAVMGDPETVQILIDNHKTFQRELGRREANYQSVMKAGRAMINENKVEEPAALEEKLADLRMRWDAVYAMS 923          

HSP 3 Score: 52.7582 bits (125), Expect = 5.962e-6
Identity = 195/1126 (17.32%), Postives = 465/1126 (41.30%), Query Frame = 3
Query: 13044 FKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPK-KSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLAN---FDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVN-LFEDTLYGFESAMKDLKLNIVDPYQTR-DIWEESLNLVK----EVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVL-NEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQIN-----------------NDYSELEECKIDFTNLLSAWNEQKESINSTIND-SKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWL--VETEENMYQNKINNLDPDQLHKAE-QEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDK---DDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIED---LRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLD---EWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWI---IATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKA 16289
            +  +  ++  +K   D +   V++ +  + + +++ Q+F T+L++  E +  I  DL+     S  Y   K Q +      D  K+ +   ++++  G+D+L + +  + K  L+ +LD++  ++++++ L + +    DR++  ++ F     P L+ L  A K++ +    +  P+ D   + ++  ++  L+ +   +D    ++  +  +      EN S   +  +    +  +E  +   +  +        ++   +Q + LF   L   +    +LKL+ V P  T     +E L L K    E+  H+  +  ++Q+G  + +     DS  ++ ++  +++ +DE+   +  +    E +       LL   +  L    L   +R+ DS    + E+  + ++ +   +E  + + +   + + S +   +SL +     +E+ +     L  +V +  T   +   K+  ++  L++ ++   +F  +I E+   +N                 N   +L + K DF  ++    E ++ I   I +  + LI  A  +   SL+  +D +K   E  T     + ++L++A+  A    +  + +  WL  V+   ++Y+     L   +  + E +E+K   ++  D    + ++    H +S +  +  G  I   +   ++R+  +      R   L++   ++++    V+     L+   + + +     V P  L  +L    E        Q  +   Q G++      K   D+   +D++ I  K+A + +    +   ++E ++K+   L     F + L+ + D    +   L+  T    +  +V   + LI++    + E+   E +   + + G+ +I + N   E   +E+   +L+  ++AV +      T  DR ++ +   +E    +       K+    L  LGP+  +   +  Q++K +   ++++ +  +++   + G  + +  HP+    +   LAR+   W  +     QR  +L+  L  L E    + E + WI              I   D   +   L +HK+ + +M   Q S  ++ + A
Sbjct:   28 YSEVNTKLAKIKTPLDAIEAKVNNRQEKLQLAVLQTQEFQTTLDDFTEKLAKIEDDLEHVGPVSAVYDVVKRQKHKVEEARDDCKQLEPVFEKVSSCGNDVLESLEAGEEKDDLKGKLDDMEQRWKSVVELYDERQKALDRSLNAAEVFW----PVLLELKAALKDVQDRMELEDLPSADLEALAEQQADHDELRKE---LDGHTPRVTSLC-EASPALVENCSPGDRAHVQSELNAVTEQWEGIEKGWQKRRGELVEVKVTSEQYHKLFVVILVWLDEL--ELKLSEVPPVGTELATVQEQLKLHKAFHAELTPHQSEITQINQLGSTVGERCRHEDSDLVHAQLEEVNHRWDELCNHSTGRQQKLEEA-------LLQLGQFQLAFQELLVWLRQTDST---LDEQLAKKVQGDVKYIEIELAKHKILQNDILSHEPSVDSLSRAASALLESGETDSTALEGKVQELKTTWDAVLAKSAQRQAELEKALKDSHSFMSQIKELRGWLNEASEFLKSRRAIGGRPENATKQLNKHK-DFMVVI----ETRQKIYVQIVEVVENLIDTADPTTAASLQRQLDELKTSWEQVTSRAAEESEKLEQALTNATSLEAQTSDMDQWLTRVDGVVSVYERPSTILVVLETQREEYKELKEDIDAHRDPYKGMRLL---AHKISDVCIKEDGVYIEGIMSGLEERWKELLTTSSARKRSLDENYRMSSKFFGGVEDLMKMLDAAEEALKNEEPIGVDPAHLRTQLKKHKE-------FQTMLGANQAGLDATVKMGKQLMDRSLDEDAITIEGKIADLKARWDAVCGLSVERQQKLEEALLFTGMFQDALQSLLDWLFAVEPSLSTETAVMGDPETV---QILIDNHKTFQRELGRREANYQSVMKAGRAMINE-NKVEEPAALEEKLADLRMRWDAVYAMSN---TKQDRLENALVLAKEFDSSVKTELHILKQFEENLRELGPIAEDLEEIKEQMEKHRVFHDELKQEEVNVQSAVKKGQVILRFCHPSAIQIIQQWLARLKKRWDEVWKWSSQRLMRLEEELRKLAEEDELMGELLRWIQTKEEALAEKEKEPIPDDDYEEVHRLLEEHKVFQEEMAKKQPSYDRLTKSA 1111          
BLAST of Dystonin vs. Ensembl Nematostella
Match: EDO37708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF38])

HSP 1 Score: 237.269 bits (604), Expect = 1.359e-61
Identity = 129/268 (48.13%), Postives = 184/268 (68.66%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDI---VQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPED-VMSGIIDEKSMMTYVASLFELNPKEEDIEEKIYQFRNQYA-DLYANLNSALEELNDDFDHN 1193
            D RDA+QK+TF  W+N  L+K+  R+ D++ +LRDG  LL LLEVL + KL  +  + RFH L+N+ T L+FL S+ IKLVNI ++D+VDGNPKLTLGL+W IIL+FQ  D+   +   K  DLS K  LL WS+K  + YP ++++NFS+SW+DG AF A+IH+ RPDL+D   +SK S + N+E AF+ A+KEL VP++++ ED V+S   DEKS+MTYVASL+E+ P+   ++E ++    Q   + Y N    L +L +D   N
Sbjct:   33 DHRDAVQKKTFTKWVNNRLLKVGVRILDLYEELRDGEDLLLLLEVLCNVKLPRERGLLRFHMLQNVQTALEFLESKKIKLVNIRSDDIVDGNPKLTLGLIWTIILYFQINDLDVEIAGEKVQDLSAKDALLHWSKKVTQGYPKVDVKNFSSSWRDGFAFNAIIHRYRPDLVDFSKLSKTSPEANIEYAFHVAEKELNVPRLLDVEDVVVSENPDEKSIMTYVASLYEVFPRTPTVQESLHDNEKQLKYEEYCNYAKNLVDLVNDVISN 300          

HSP 2 Score: 63.929 bits (154), Expect = 2.861e-9
Identity = 33/136 (24.26%), Postives = 69/136 (50.74%), Query Frame = 3
Query: 2076 FKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRF 2483
             KS +EF+ ++ + + W+  +E+ ++   W   + + L++     + L+ E++  E      +A G  +  + H A   I+  L+ + S+W WI  LT     HL+   I++QF  +A  A+  ++   +QLN+ +
Sbjct:  722 LKSLVEFMSEATKELIWMNQREEPEVSRDWARAD-LDLADLATYGQELLLEIKDHEPHYQGIVAKGNGMVQSGHPAPGPIEAYLSAMSSQWWWINQLTLAFDEHLKNAQIHQQFQGDAQAAEQKMVHFIDQLNTVY 856          

HSP 3 Score: 57.7658 bits (138), Expect = 2.361e-7
Identity = 37/148 (25.00%), Postives = 75/148 (50.68%), Query Frame = 3
Query: 2538 RDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLREQV----LLSTMDLVKNWTP 2969
            ++M + + DYK+ ++ +  +S+ V+ +  R + +   ++ +VKA+CS K   +       +GE   L +N+ H  W+V +S  E    P++CF+I     +A   A  L+  +  L  LW  R   L++ +    + + + +VK+  P
Sbjct: 1010 QEMKQELIDYKDIISSLQLLSKQVTPMKQRKSKL--RQKTSVKAVCSYKNMQNTVE----QGEEYTLFDNTEHHAWKVASSPGEQSEVPSVCFVIPAPDLEAIDFATRLEIQYKHLLTLWRTRHSNLKQALAKEQVFTNIKVVKSTIP 1151          
BLAST of Dystonin vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 216.853 bits (551), Expect = 1.681e-55
Identity = 191/701 (27.25%), Postives = 325/701 (46.36%), Query Frame = 3
Query:  399 VADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKL-FTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDI-VQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDI-----------------EEKIYQFRNQYADLYANLNSALEELNDDFDHNDF------RIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNEN------QRKFHTISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDGYPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVISNRQYTPIHSMELGDNVLYSSLNKWKNWIDE-KCAIISEINFTNDLDGLNKIYEKFSTTFNEIKDSVDEFKM----------ILESENKYQMDMDFHQSKN---DLKTKFNELWINCSKIDADFKSFLE---FLHKSNESIAWIKTKE---DQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEW 2348
            +ADER+ +QK+TF  WIN HL ++  RV ++++DL+DG  L+ LLEVLS +KL        R H LEN+   L FL+ Q + L N+ A D+VDGN K+TLGL+W IIL FQ +DI ++   ++  S K  LL W +     Y  + I NF+TSW+DG AF A+IH+ RPDLI+ + ++K  A+QNLE AF  A+ +LG+  +++ EDV     DEKS++TYVA+ +    K + +                 EE I  +    +DL   +   + +L +    N         ++FNQ R +     ++++      LF   SK+  N++        R    I+  W + E +  E+ L L  E  + +R E ++   D + A     + E +  +   ++       +   +   +I  ++   E ++N ++   +EL R+ Y   +  ++     G+I         +    L   +I  R+      M+L    ++  +    +W+DE K  ++SE ++   L G+  + +K S    +I    D  K           + + E K Q   D  Q ++   +L+  +NEL    +   A  +  L+   F   ++E   W+  K+       +    +T  I L+    K + +  E+  R          G  L      A + IQ  L T++S+W
Sbjct:   18 LADERERVQKKTFTKWINSHLQRVGARVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQV---CKGRI---------IQLWELLLVLIKQRRVRLEKCMQL--QRVFQEMINIIDWMDEIKIGLLSE-DYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLT----KHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKW 699          

HSP 2 Score: 56.6102 bits (135), Expect = 4.608e-7
Identity = 52/212 (24.53%), Postives = 100/212 (47.17%), Query Frame = 3
Query: 17430 MTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALM--------IQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEA-KNQAI----EFERLWNSLKEFFSKSE---HELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDL 18017
            M N++ W+  I  K+   S+  G  +  V+ LL +HS++E  +  +   ++ +N  A A +         Q + D + I D  AEL+  +N + +LA  ++ RLEE+ K Q+     + E +W + K++F +S    H+L    I            +++ H    + +     +     + G E+L  A P A  +I++ ++ I+S+W  L
Sbjct:  506 MINIIDWMDEI--KIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMI------------LLTKHEAVEREMTARNAQTKAVARNGEELL-EAVPYATDTIQNRLDTIRSKWDKL 702          
BLAST of Dystonin vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 190.274 bits (482), Expect = 2.329e-52
Identity = 125/338 (36.98%), Postives = 194/338 (57.40%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVY--DIFNDLRDGIXXXXXXEVLSDQKL-FTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLS-----IKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK---EE--------------DIEEKIYQFRNQYADLYANLNSALEELNDDFDHNDFRID-----FNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKF 1328
            +ER   QK+TF  W+N  L K+   ++  D+F DL DG +L++LLE++S +K+ F      R H ++N+N  L+FL+ +++KL +I AED+VDGN +L LGL+W+IIL FQ  DI   S  DD+S      K+ LL W ++    YPD++I+NFSTSW++G AF AL+HK RPDLID  ++  +  + NL  AF  A+++LG+ ++++ EDV     D++S+MTYVA+ ++   K   EE              +IE+    + +  +DL   ++S + EL   F+ N F +      F   R       Y ++     HLF+  +K  R   NQR F
Sbjct:   19 NERIFSQKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFLQ-KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADI---SYQDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELARPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTK--RKANNQRPF 350          
BLAST of Dystonin vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 195.667 bits (496), Expect = 1.177e-50
Identity = 135/379 (35.62%), Postives = 207/379 (54.62%), Query Frame = 3
Query:  405 DERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKL-FTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLS-----IKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK---EE--------------DIEEKIYQFRNQYADLYANLNSALEELNDDFDHNDFRID-----FNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQRKFHT--------ISTLWSKFETNSKEKSLILTNESKKVQRSEKIS 1433
            +ER   QK+TF  W+N  L K    V D+F DL DG +L++LLE++S +K+ F      R H ++N+N  L+FL+ +++KL +I AED+VDGN +L LGL+W+IIL FQ  DI   S  DD+S      K+ LL W ++    YP ++I+NFSTSW++G AF AL+HK RPDLID  ++  +  + NL  AF  A ++LG+ ++++ EDV     D++S+MTYVA+ ++   K   EE              +IE+    + +  +DL   ++S + EL   F+ N F +      F   R       Y ++     HLF+  +K  R   NQR F          I+  W   E+   E++  L NE  + Q  EK++
Sbjct:   19 NERIFSQKKTFTKWVNSFLDKSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFLQ-KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADI---SYQDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELARPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTK--RKANNQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMA 391          
BLAST of Dystonin vs. Ensembl Medaka
Match: ENSORLT00000046669.1 (pep primary_assembly:ASM223467v1:15:24337939:24343724:-1 gene:ENSORLG00000026707.1 transcript:ENSORLT00000046669.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 381.719 bits (979), Expect = 7.954e-115
Identity = 233/616 (37.82%), Postives = 361/616 (58.60%), Query Frame = 3
Query: 16896 DITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDS-KKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKT---PPL---IPIFDRSK---RMETNQGI--SKIQEPLFV-NPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKE 18704
            ++ SHRE ++ LDK  THLKY SQK D+VLI+NL+ S+  RWEK+V +S ER R LD   K  K+F +    L++ +  +   L+ +  I   P KI+ Q+ +HKEF   LG  +  YD+T R G  L+DK  ++D  +K+D+++  L+ KW ++C KS+ER+  L +ALL SG + DA+  L+ WL  +EP+L++      GD++ V  L++ H + +K+L  R   ++ +   A  L+  + +DSS+++ Q+ EL + W  V  L+  K+ RLE+A  QA EF    + L E+ +++E  LR     P+EE  E +   I  H  F K L    + +N     G  I+   +P++  +IKH+  IIK+++ ++ +W+ Q    L   L  L   + LL+ LL WL  AE  +   +   L   + E K    EH+ F+ +MT KQ D D+I    K+K    PP+   IP+ ++ +   +    Q +  S  Q P+   NP++N L SKW+ VW + L+RR++L D ++ L+E++   NF+F+ WR+RYM WMNH KSRVMDFFRR D D DG+VTR+EFI+GI+         SKF T+R+EM  VADIFD++
Sbjct:    5 EVNSHREHIIELDKAGTHLKYFSQKKDVVLIKNLLLSVQGRWEKLVQKSVERGRLLDDARKRTKQFHETFNKLMEWLDESERTLDSEVEIANDPDKIKTQLAQHKEFQKALGSKHSVYDTTARTGRALKDKTSLRDDHQKLDDMLCELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAEDQP-VHGDIDLVLHLIDNHKVFQKELGKRTVGVQALKRSARELIENTHDDSSWVKVQMQELSTRWETVCNLSVSKQGRLEQALCQAEEFHSTVHILLEWLAEAEQSLRFHGSLPDEE--ETLLGQIEQHKEFMKKLEEKRVSVNKATSMGEAIISICHPDSITTIKHWNTIIKARFEEVQAWARQHQQRLNLALKELLATQELLETLLNWLQWAEANISNKDMEILPQEIEEIKTLIAEHQVFMEEMTRKQPDVDKITKTHKRKAAAEPPIQSQIPVLNKGRTGRKRSPTQAMYASTTQTPIETKNPRVNLLVSKWQHVWLLALDRRRKLNDALDRLEELKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQDGKVTRQEFIEGILS--------SKFPTSRLEMSAVADIFDRD 609          

HSP 2 Score: 69.707 bits (169), Expect = 8.281e-11
Identity = 83/354 (23.45%), Postives = 152/354 (42.94%), Query Frame = 3
Query: 15801 KLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLT-KGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAI----EIDMEILVKKWDT--------VKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLN 16823
            KL EW  E    L     +  +   + TQ+ + KE +  +  KH   +   + G  L  K S  +   +++  L  + D W  +     +RQ++L+  LL  G+F  A+   I+W+   E  L   +  HGDI+ +   +  HK+ + ++      V  ++R A E+I E+          ++++L   WE +   + +K   LE AL +A  F+     +   ++ L    +  +F G LPD  +E L   ++ ++ F K          E   +S   + S+G+AI      D    +K W+T        V+  A   + RL  A++ +      +   +NWL   E N++
Sbjct:   76 KLMEWLDESERTLDSEVEIANDPDKIKTQLAQHKEFQKALGSKHSVYDTTARTGRALKDKTSLRDDHQKLDDMLCELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAEDQPVHGDIDLVLHLIDNHKVFQKELGKRTVGVQALKRSARELI-ENTHDDSSWVKVQMQELSTRWETVCNLSVSKQGRLEQALCQAEEFHST---VHILLEWLAEAEQSLRFHGSLPD-EEETLLGQIEQHKEFMK--------KLEEKRVSVNKATSMGEAIISICHPDSITTIKHWNTIIKARFEEVQAWARQHQQRLNLALKELLATQELLETLLNWLQWAEANIS 416          

HSP 3 Score: 65.855 bits (159), Expect = 1.494e-9
Identity = 111/513 (21.64%), Postives = 223/513 (43.47%), Query Frame = 3
Query: 16005 VNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSL-TNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLE----QLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQ--------LKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSI---GKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIA-SNLEILERDTSI-GQTPSKIREQITKHKEFHCNLG-----VHNLTYDSTRRL---------------GYQLRDKAPIQDS---------KKIDEIVHNLQMKWQSLCNKSIEREKALNDAL 17402
            + + L  +   W +L+    +R   L        +FH   ++ +EW+  +E +L + ++I + D + ++  LAQHK  +  +  S+ SV     +    +K D +SL  +  Q+L+    +LR  W+ +      K  E ++ L+EAL+F G   +  + + +   K+E        P  A++Q        +   +D ++ F K   K    ++     +++  ++       +++ M+ L  +W+TV NL+ +++ RLE+A+   E FH  +   + WL   E++L     +     T+L Q+E H+   + +   R  +     M   +  I     I  I++  + I  R+E+V + + +  + L+   KE    +++  TLL+ +  +   I  +D  I  Q   +I+  I +H+ F   +      V  +T    R+                G   R ++P Q           +  +  V+ L  KWQ +   +++R + LNDAL
Sbjct:   35 IKNLLLSVQGRWEKLVQKSVERGRLLDDARKRTKQFHETFNKLMEWLDESERTLDSEVEIAN-DPDKIKTQLAQHKEFQKALG-SKHSVYDTTARTGRALK-DKTSL-RDDHQKLDDMLCELRDKWDTVC----GKSVERQNKLEEALLFSGQFTDALQALIDWLYKVE--------PQLAEDQPVHGDIDLVLHLIDNHKVFQKELGKRTVGVQALKRSARELIENTHDDSSWVKVQMQELSTRWETVCNLSVSKQGRLEQALCQAEEFHSTVHILLEWLAEAEQSLRFHGSLPDEEETLLGQIEQHKEFMKKLEEKRVSVNKATSMGEAIISICHPDSITTIKHWNTIIKARFEEVQAWARQHQQRLNLALKELLATQELLETLLNWLQWAEANISNKDMEILPQEIEEIKTLIAEHQVFMEEMTRKQPDVDKITKTHKRKAAAEPPIQSQIPVLNKGRTGRKRSPTQAMYASTTQTPIETKNPRVNLLVSKWQHVWLLALDRRRKLNDAL 531          

HSP 4 Score: 61.6178 bits (148), Expect = 3.025e-8
Identity = 71/314 (22.61%), Postives = 133/314 (42.36%), Query Frame = 3
Query: 16680 LVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKH-DIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKA--------LNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKR-CGGDMNTVQTLLNEHSILEKQLRDRDHMIEKIN 17591
            L  KWDTV   +  R+++LE+A+     F   +   I+WL   E  L + +PV   +  +L  ++ H+  ++++      +  L + A  L  I   H D   ++  M  +  RWE V + S  +   L+    +A+ F      LL+ +A   + L    S+      +  QI +HKEF   L    ++ +    +G  +     I     I  I H     W ++     E  +A        LN AL      ++ +  LL+WL+  E  +S+        ++  ++TL+ EH +  +++  +   ++KI 
Sbjct:  152 LRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQALIDWLYKVEPQLAEDQPVHGDIDLVLHLIDNHKVFQKELGKRTVGVQALKRSAREL--IENTHDDSSWVKVQMQELSTRWETVCNLSVSKQGRLEQALCQAEEFHSTVHILLEWLAEAEQSLRFHGSLPDEEETLLGQIEQHKEFMKKLEEKRVSVNKATSMGEAI---ISICHPDSITTIKH-----WNTIIKARFEEVQAWARQHQQRLNLALKELLATQELLETLLNWLQWAEANISNKDMEILPQEIEEIKTLIAEHQVFMEEMTRKQPDVDKIT 455          
BLAST of Dystonin vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 364.385 bits (934), Expect = 1.701e-99
Identity = 262/940 (27.87%), Postives = 477/940 (50.74%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQ------------KLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKIY--QFRNQYADLYANLNSALEELNDD---FDHNDFRIDFNQTRLENNYLTYLKQYESFC-----------HLFDDISKVDRNNENQ--RKFHT--ISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIE---CATLTNKVEE-IESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVISNR-QYTPIHSMEL-----------GDNVLYSSLNKWKNWIDEKCAIISEINFTNDLD----------GLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLE---FLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNWTPEDFCNL 2987
            LDP +R V+R+ADERD +QK+TF  W+N HL+K+ + + D++ DLRDG  L++LLEVLS +            +L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +SDD++ K+ LL WS++ +E Y  +  +NF+TSW+DG+ F A+IHK RP LID+  + + + Q+NLE AF+ A++ELGV ++++PEDV     DEKS++TYV+SL++  P+  DI++ +   +   ++ + Y  +   L+ +      F+   F   + +  +E  +  +LK  E+             H+F       +  + +    +H   +   W +      E+  +L  E ++++R ++I   +  E   C    N+VE  +++ +R++S    K P     ++ A +  +L   E  I  +   VQ LK DG    A+Q YR +  ++ ++  ++ ++       L SGV +++   T +H++++            D V     +    W+++    + E  + +DL           GL++  E+F +     K   DE ++   S+  Y+  +        L+ ++ +L +  SK  A  +  +E   F+  + + + W+  KE++++++ W +  +  +S K+E +  L+ ELE+RE  +N   A G  L  + H A   I+   A L+++W WIL L  C++THL+    Y QFF +  EA+  + ++ + +  ++     V +   E L ++  D  E + ++K  +  +   + ++  L  R  +   + ++ ++A+C  K+      R    G+   L NN+    WRV N++    + P+ICFL+   +  A  +   LD +   L  +W    + L+     Q L+  + ++  W    F  L
Sbjct:   59 LDPAERAVIRIADERDRVQKKTFTKWVNKHLIKVQRHITDLYEDLRDGHNLISLLEVLSGETLQRERDVVRNVRLPREKGRMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMTAKERLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFSAIIHKHRPALIDMNQVYRQTNQENLEQAFSVAERELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRVPDIQDGVRANELELRWQEYYEVVTMLLQWIRHHILVFEEKKFPTSYEE--IEVLWRQFLKFKETELPAKEADKNRSKHIFKSFEGAVKAGQVKVPPGYHPLDVEKEWGRLHAAILERERLLRTEFERMERLQRIVGKVQTESGVCEEQLNQVETLLQADVRRMSSG--KAP-----QHTAEVEADLEKAEGMIRFLFNDVQLLK-DGRHLQAEQMYRRVYRLHERLVNLRSEYN----LRLKSGVAASQIPMTQLHTVQVLQQSSKSTRPELDEVTLRYAHDLLGWVEDNQRRVDEGEWGSDLANVESQLGSHRGLHQSVEEFRSKIERAK--ADESQISPVSKPAYREYL------GKLELQYGKL-LTASK--ARLRYLVELHTFVSAATKELMWLNEKEEEEVNYDWSERNTNMVS-KKENYSGLMRELELREKKVNGVQATGDKLLRDGHPARKTIEAFTAALQTQWSWILQLCCCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYTCDRSVTVTRLEDLLQDAADEKEQLAEFKTHLEGLKRKANTIVQLKPRNPTTPIKGKLPIQAVCDFKQMEITVHR----GDECALLNNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLKSLLSWQYLMRDIHIINTWNVSMFKTL 968          
BLAST of Dystonin vs. Ensembl Medaka
Match: plecb (plectin b [Source:ZFIN;Acc:ZDB-GENE-100917-2])

HSP 1 Score: 362.073 bits (928), Expect = 7.153e-99
Identity = 269/990 (27.17%), Postives = 482/990 (48.69%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPK---EEDIEEKIYQFR-NQYADLYANLNSALEELNDDFDHNDFRIDFNQTRLENNYLTYLKQYESFCHLFDDISKVDRNNENQ-----------------RKFHTIST--LWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIECATLTNKVEEIESKIRKISYPMLKTPTKEMN-----EYLASISKELCDCENQINNMIISVQELKRDGYP-ADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVIS-NRQYTPIHSMELGDNVLYSSLNKWKNWIDEKCAIISEINFTNDLD----------GLNKIYEKFSTTFNEIKDSVDEFKMILESENKY-----QMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLEFLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEK----------RVNVKAICSSKENPDFYTRQFI--EGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNWTPEDFCNLEP-VHRQ--KIVEILNQDANRLILDLKCANIDENEINKFHFALNQCNARFAELAHS 3146
            LDP +R V+R+ADERD +QK+TF  W+N HL+K  + V D++ DLRDG  L++LLEVLS   L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +S+D+S K+ LL WS++  E YP I  +NF+TSW+DGK F A+IHK  P LID+  + + S  +NLE AFN A+K+LGV ++++PEDV     DEKS++TYV+SL+++ P+   ++       + R  +Y +L   L   + +    F+   F   + +  L        +Q+  F      + + D++   Q                   +H I     W +      E+  +L  E ++++R +++   + +E     +++  +ES        +L++  + +N     ++ A + +EL   EN I  +   VQ LK   +P A+Q YR +  ++ ++  ++  +      TL++  +    Q T +      D+V    +     W++E    I    + +DL           GL++  E F +     K   DE ++   S+  Y     ++D+ + +  N  K++   L            S   F+  + + + W+  KE++++++ W D  +  ++ K++ +  L+ ELE++E  +N+  A+G  L  + H     ++   A L+++W WIL L  C++ HL+    Y QFF +  E    + ++   +  ++         +G      + D+L+   + +E +N    +   ++AL+ R+ SI+  K          ++ ++A+C      DF  ++    +G+   L NNS    W+V N        P++CF++  ++ +A  +  +LD+    +  +W    + +R     Q L      +++W       ++P  +RQ  K +E+  QD  R   D +    D+    +     N+C   F EL HS
Sbjct:   52 LDPAERAVIRIADERDRVQKKTFTKWVNKHLIKAQRHVTDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSEDMSAKEKLLFWSQRMTEGYPGIRCDNFTTSWRDGKLFNAVIHKHYPRLIDMGKVYQQSNLENLEHAFNVAEKDLGVTRLLDPEDVDVPHPDEKSIITYVSSLYDVMPRVDVQDGARANELELRWQEYYELVTILLQWIRQHAMIFEERKFPASYEEIEL------LWRQFLRFKETELPVKEGDKSRSKQIYQSFESAVHAGQVKVPPGYHPIDVEKEWGRLHAAILERERLLRIEFERLERLQRVFGKVQMESGVCDDQLSRLES--------LLQSDIRLLNAGKPAQHTAEVERELDKAENMIRLLFNDVQFLKDGRHPQAEQMYRRVYRLHERLVNLRSDYNLRLKSTLTAAQVPLTSQQTSMKVRPEIDDVTLRYVQDLLAWVEENQRRIDSAEWGSDLPSLESQLGSHRGLHQTVEDFKSKIERAKS--DEGQLSPVSKGTYREYLGKLDLQYGKLLNSSKSRLRNL-----------DSLHAFISAATKELMWLNDKEEEEVNFDWSD-RNTNMTAKKDNYSGLMRELELQEKKVNDIQALGDKLVKDGHPGKKTVETFTAALQTQWSWILQLCCCIEGHLKENTAYYQFFGDVKEVQEKMNKMQENMKKKYS-------CDGSTTATRLEDLLQDAAEEREQLNEFKTL---ITALNKRSRSIIQLKPRNPTTSIKGKMPIQAVC------DFKQQEITVHKGDECALLNNSQPFKWKVLNRSGHEALVPSVCFIVPPVNKEALDSVSSLDAGHQQMLSMWQMLHVNMRSLLSWQYLTKDFTQIRSWNITMLKTMKPEEYRQVMKNLELHYQDFMRDSQDSQQFGPDDR--MQVEGEYNRCIKHFDELIHS 995          
BLAST of Dystonin vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 354.369 bits (908), Expect = 1.470e-96
Identity = 262/953 (27.49%), Postives = 477/953 (50.05%), Query Frame = 3
Query:  369 LDPVDRIVLRVADERDAMQKRTFENWINCHLMK-------------INKRVYDIFNDLRDGIXXXXXXEVLSDQ------------KLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKIY--QFRNQYADLYANLNSALEELNDD---FDHNDFRIDFNQTRLENNYLTYLKQYESFC-----------HLFDDISKVDRNNENQ--RKFHT--ISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIE---CATLTNKVEE-IESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVISNR-QYTPIHSMEL-----------GDNVLYSSLNKWKNWIDEKCAIISEINFTNDL----------DGLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLE---FLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNWTPEDFCNL 2987
            LDP +R V+R+ADERD +QK+TF  W+N HL+K             + + + D++ DLRDG  L++LLEVLS +            +L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +SDD++ K+ LL WS++ +E Y  +  +NF+TSW+DG+ F A+IHK RP LID+  + + + Q+NLE AF+ A++ELGV ++++PEDV     DEKS++TYV+SL++  P+  DI++ +   +   ++ + Y  +   L+ +      F+   F   + +  +E  +  +LK  E+             H+F       +  + +    +H   +   W +      E+  +L  E ++++R ++I   +  E   C    N+VE  +++ +R++S    K P     ++ A +  +L   E  I  +   VQ LK DG    A+Q YR +  ++ ++  ++ ++       L SGV +++   T +H++++            D V     +    W+++    + E  + +DL           GL++  E+F +     K   DE ++   S+  Y+  +        L+ ++ +L +  SK  A  +  +E   F+  + + + W+  KE++++++ W +  +  +S K+E +  L+ ELE+RE  +N   A G  L  + H A   I+   A L+++W WIL L  C++THL+    Y QFF +  EA+  + ++ + +  ++     V +   E L ++  D  E + ++K  +  +   + ++  L  R  +   + ++ ++A+C  K+      R    G+   L NN+    WRV N++    + P+ICFL+   +  A  +   LD +   L  +W    + L+     Q L+  + ++  W    F  L
Sbjct:   59 LDPAERAVIRIADERDRVQKKTFTKWVNKHLIKCFISLGVLRKQEEVQRHITDLYEDLRDGHNLISLLEVLSGETLQRERDVVRNVRLPREKGRMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMTAKERLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFSAIIHKHRPALIDMNQVYRQTNQENLEQAFSVAERELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRVPDIQDGVRANELELRWQEYYEVVTMLLQWIRHHILVFEEKKFPTSYEE--IEVLWRQFLKFKETELPAKEADKNRSKHIFKSFEGAVKAGQVKVPPGYHPLDVEKEWGRLHAAILERERLLRTEFERMERLQRIVGKVQTESGVCEEQLNQVETLLQADVRRMSSG--KAP-----QHTAEVEADLEKAEGMIRFLFNDVQLLK-DGRHLQAEQMYRRVYRLHERLVNLRSEYN----LRLKSGVAASQIPMTQLHTVQVLQQSSKSTRPELDEVTLRYAHDLLGWVEDNQRRVDEGEWGSDLANVESQLGSHRGLHQSVEEFRSKIERAK--ADESQISPVSKPAYREYL------GKLELQYGKL-LTASK--ARLRYLVELHTFVSAATKELMWLNEKEEEEVNYDWSERNTNMVS-KKENYSGLMRELELREKKVNGVQATGDKLLRDGHPARKTIEAFTAALQTQWSWILQLCCCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYTCDRSVTVTRLEDLLQDAADEKEQLAEFKTHLEGLKRKANTIVQLKPRNPTTPIKGKLPIQAVCDFKQMEITVHR----GDECALLNNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLKSLLSWQYLMRDIHIINTWNVSMFKTL 981          
BLAST of Dystonin vs. Ensembl Medaka
Match: pleca (plectin [Source:NCBI gene;Acc:101160251])

HSP 1 Score: 353.984 bits (907), Expect = 2.377e-96
Identity = 254/910 (27.91%), Postives = 464/910 (50.99%), Query Frame = 3
Query:  399 VADERDAMQKRTFENWINCHLMKINKRVYDIFNDLRDGIXXXXXXEVLSDQKLFTQNAISRFHCLENINTVLDFLRSQNIKLVNIHAEDLVDGNPKLTLGLVWIIILFFQFKDIVQSSKSDDLSIKQILLQWSRKALEDYPDINIENFSTSWKDGKAFLALIHKKRPDLIDLKSISKNSAQQNLEMAFNTAQKELGVPKIIEPEDVMSGIIDEKSMMTYVASLFELNPKEEDIEEKIY--QFRNQYADLYANLNSALEELNDD---FDHNDFRIDFNQTRLENNYLTYLKQYESFC-----------HLFDDISKVDRNNENQ--RKFHT--ISTLWSKFETNSKEKSLILTNESKKVQRSEKISVSLDIE---CATLTNKVEE-IESKIRKISYPMLKTPTKEMNEYLASISKELCDCENQINNMIISVQELKRDG--YPADQHYRIIININGKIDKVKKKFEKLSPPTLSSGVISNR-QYTPIHSMEL-----------GDNVLYSSLNKWKNWIDEKCAIISEINFTNDLD----------GLNKIYEKFSTTFNEIKDSVDEFKMILESENKYQMDMDFHQSKNDLKTKFNELWINCSKIDADFKSFLE---FLHKSNESIAWIKTKEDQQIHWQWFDTESIKLSEKQEKFKNLIDELEMRETSINETIAVGTTLTINNHSAANYIQKSLATLKSEWQWILNLTHCLKTHLECLAIYEQFFYEANEADNAILELTNQLNSRFFRPLGVGLDEGEILNREIRDMLETIEDYKETVNRIIAISQSVSALSLRTTSILPEKRVNVKAICSSKENPDFYTRQFIEGELLQLTNNSGHDMWRVCNSRNESFNAPAICFLITDISPQASQTAITLDSHFTFLKDLWTKRELQLRE----QVLLSTMDLVKNW 2963
            V DERD +QK+TF  W+N HL+K+ + + D++ DLRDG  L++LLEVLS + L  +    RFH L+N+   LDFL+ + +KLVNI  +D+ DGNPKLTLGL+W IIL FQ  DI  + +SDD++ K+ LL WS++ +E Y  +  +NF+TSW+DG+ F A+IHK RP LID+  + + + Q+NLE AF+ A++ELGV ++++PEDV     DEKS++TYV+SL++  P+  DI++ +   +   ++ + Y  +   L+ +      F+   F   + +  +E  +  +LK  E+             H+F       +  + +    +H   +   W +      E+  +L  E ++++R ++I   +  E   C    N+VE  +++ +R++S    K P     ++ A +  +L   E  I  +   VQ LK DG    A+Q YR    ++ ++  ++ ++       L SGV +++   T +H++++            D V     +    W+++    + E  + +DL           GL++  E+F +     K   DE ++   S+  Y+  +        L+ ++ +L +  SK  A  +  +E   F+  + + + W+  KE++++++ W +  +  +S K+E +  L+ ELE+RE  +N   A G  L  + H A   I+   A L+++W WIL L  C++THL+    Y QFF +  EA+  + ++ + +  ++     V +   E L ++  D  E + ++K  +  +   + ++  L  R  +   + ++ ++A+C  K+      R    G+   L NN+    WRV N++    + P+ICFL+   +  A  +   LD +   L  +W    + L+     Q L+  + ++  W
Sbjct:   12 VPDERDRVQKKTFTKWVNKHLIKVQRHITDLYEDLRDGHNLISLLEVLSGETLPREKGRMRFHKLQNVQIALDFLKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMTAKERLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFSAIIHKHRPALIDMNQVYRQTNQENLEQAFSVAERELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDAMPRVPDIQDGVRANELELRWQEYYEVVTMLLQWIRHHILVFEEKKFPTSYEE--IEVLWRQFLKFKETELPAKEADKNRSKHIFKSFEGAVKAGQVKVPPGYHPLDVEKEWGRLHAAILERERLLRTEFERMERLQRIVGKVQTESGVCEEQLNQVETLLQADVRRMSSG--KAP-----QHTAEVEADLEKAEGMIRFLFNDVQLLK-DGRHLQAEQMYRRFYRLHERLVNLRSEYN----LRLKSGVAASQIPMTQLHTVQVLQQSSKSTRPELDEVTLRYAHDLLGWVEDNQRRVDEGEWGSDLANVESQLGSHRGLHQSVEEFRSKIERAK--ADESQISPVSKPAYREYL------GKLELQYGKL-LTASK--ARLRYLVELHTFVSAATKELMWLNEKEEEEVNYDWSERNTNMVS-KKENYSGLMRELELREKKVNGVQATGDKLLRDGHPARKTIEAFTAALQTQWSWILQLCCCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYTCDRSVTVTRLEDLLQDAADEKEQLAEFKTHLEGLKRKANTIVQLKPRNPTTPIKGKLPIQAVCDFKQMEITVHR----GDECALLNNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLKSLLSWQYLMRDIHIINTW 891          
BLAST of Dystonin vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 7302.21 bits (18945), Expect = 0.000e+0
Identity = 3951/4911 (80.45%), Postives = 4183/4911 (85.18%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI---AINIDQ---TECNLFENRKL--YQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN-----EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKTRQYMPLSCPFTNVH---IRTIEEEMNFSI-----PQSLP-ENVLRVFSQKPNDNKNVEGLIITST---SVNLDHEIQIKTDNN------KNQVDINQADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 19502
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K    +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+     NI     +E    +  KL   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E    G  ++  L  +   I+    + L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +      + +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++  + ++   + + T+    TL +A++ GL+ T+  T +  P+S    ++     R I +  N +I      QS+    +L+ FS  P+  K  +  I  +    S NL+    IK++ +      +   +I +ADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID        SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCR        CV   S  +  +  +KGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE
Sbjct: 3224 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERID---KEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIKKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD-PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKIDDNNFHFSNNLNTFTHIKSNLHHLSHFEEESPNIIEADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID--------SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCREA------CVPEPSNDTESIKNSKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 8032          

HSP 2 Score: 109.768 bits (273), Expect = 9.780e-23
Identity = 244/1140 (21.40%), Postives = 459/1140 (40.26%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEG-----ILSKPISI------LQIVLEKDEFPFLVD---------INNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITL-NDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG----LLHTIMKTR-------QYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            ++ +EA+     D E+  I+D  +   + L    + G     +L+K IS+        + L++     LVD         I+ ++ S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K    +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      ++D + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++            N   ++T   + ++++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N ++   NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + ++++S +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL   +E G V     TL                    ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G     L T  K R       +   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:  545 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGK 1618          

HSP 3 Score: 103.219 bits (256), Expect = 8.644e-21
Identity = 246/1158 (21.24%), Postives = 473/1158 (40.85%), Query Frame = 3
Query: 5055 DPITNTELKYTDAIRYQYINDDISEILFVDPSEN-------------SFHLTTKEAVKNKFFDPESGNI-FDHNRDS-YIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG----LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISG----PNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI---AINIDQ---TECNLFENRKL--YQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG----LLHTIMKTR-------QYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            DPI+ TE+   +AI    I+ + S I   +  ++             S  LT+++   +K    E   I  +++ D+ ++ L  A ++G++      ++  +   E            S+ EA+ RGIID  +         Q +SL E +++G    ++  N K  +DK K +    +S   + +  ++ L+E++  G        I  P    +++L  AI  GIID +N    +    +  SL E              E + + K    +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+     NI     +E    +  KL   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   +            +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++        T+++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T ++A+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E         N  +Y+     KG  V+    ++ML   +   I+ L+   K       +  LE  S+  +  T  +     E + K   +   +++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G     L T  K R       +   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct: 1970 DPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEI-----------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTI------------RDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTELEKISMEY-STDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAE---------NSAIYD---AEKGQSVS---LSEMLKSGK--NISALLTSEKERMDKEKLTELEKISMEYS--TDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGK 3064          

HSP 4 Score: 102.064 bits (253), Expect = 2.097e-20
Identity = 227/1087 (20.88%), Postives = 435/1087 (40.02%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAY------------ENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEG----DSERLE--------EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + I K    +L       + +   LT+  A+ + L+D   G I D  +   IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I  E     D+E+ +        E+I +          +           ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  887 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTKLEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSCLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1893          

HSP 5 Score: 100.908 bits (250), Expect = 4.798e-20
Identity = 243/1108 (21.93%), Postives = 443/1108 (39.98%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISG---PNQEIIHPNLTQK-LTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TENQ--YNRIVFLTCPLIKFSISIDE----------IAINIDQTECNLFE--NRKLYQTI-TTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDV--------KSLNNELKIIGF---------------------------KDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIV--TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTG--KSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G     +  I   ++ K ++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  EN   Y+     +C        ID+          +  + D     L E   + L  T+  T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I       KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +  +        K    EL+ I                             +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  T+  +E+S  L EAI    ID + S +   + G+ + L E +++     +   ++ N    I        +       TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E         N  +Y+     KG  V+    ++ML   +   + Q  +  +    K T L       S  A  +TL       E + K   +    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1481 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGTEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSCLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEIS--LQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISV---LQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII----DAE---------NSAIYD---AEKGQSVS---LSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLD------EAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2508          

HSP 6 Score: 99.7525 bits (247), Expect = 1.027e-19
Identity = 231/1112 (20.77%), Postives = 435/1112 (39.12%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKG-----LVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL E +  G++      I D  K             + L+E L SG N   +  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +                D   G  +S  + ++ G     L+ +K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++ NS +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL + +E G V     TL                    ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:  149 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISALLTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENS------------AIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVD----TLRG------------------TIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 1161          

HSP 7 Score: 99.3673 bits (246), Expect = 1.353e-19
Identity = 243/1158 (20.98%), Postives = 462/1158 (39.90%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIV----LEKDEFPFLVDINNEKSS------ISEALVRGIIDGNSEFSIKPNFSQK-ISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQL------------------------------FIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEG---DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT-NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L       ++K++   L  I+ E S+      + EA+ +G++D     +I+   S K ISL EA+  G++      I D  K             + L+E L SG N  ++  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L                               I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E    D E+L E  +++  + Y+    H        LT ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2274 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVD-TLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISVLQTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE--LEKISMEYSTDAHH--------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3353          

HSP 8 Score: 98.5969 bits (244), Expect = 2.143e-19
Identity = 230/1110 (20.72%), Postives = 439/1110 (39.55%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D     I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2729 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3749          

HSP 9 Score: 96.2857 bits (238), Expect = 1.241e-18
Identity = 216/1007 (21.45%), Postives = 390/1007 (38.73%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGIL------------------------SKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLI 7625
            E + ++ S ++ HLT  EA++    D   G I D      I L  A   GI+                         K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +  N G  K   +L++   + +     T+              LTL  A++ G++DT      + I+ ++ SL+E                                 AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I
Sbjct:  689 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE---------------------------------AIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII 1631          

HSP 10 Score: 94.3597 bits (233), Expect = 4.649e-18
Identity = 222/1070 (20.75%), Postives = 415/1070 (38.79%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL-----------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINE----GYYDKIITENQYNRI---VFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            E + ++ S ++ HLT  EA++    D   G I D      I L  A   GI+    S +           Q  LEK    +  D ++   ++ +A+ +G++D        P    +ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + +     T+              LTL  A++ G++DT      +TI+ ++ SL+EA                                 I   +ID +   I+D    Q +S++E    G    ++  N+  RI          I    S D   + +D+  E  L +  +      T+ D      ISL EA  R  I+ +    Y  +     S ++ + +   I       KER+ + K  + EKI     +   +      ++  +A+E G++D L G                                            +D ISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++   +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L++A+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1863 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHH--LTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEA---------------------------------IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT------------------------------------------IRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2805          

HSP 11 Score: 93.9745 bits (232), Expect = 4.929e-18
Identity = 256/1232 (20.78%), Postives = 491/1232 (39.85%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINE----GYYDKIITENQYNRI---VFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYY-----------HEKDRI---------YYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINE---------AILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLT--------------------EKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG----LLHTIMKTR-------QYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQKPNDNKNVEGLIITSTSVNLDHEIQIKTDNNKNQVDINQADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDE 8468
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P    +ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + +     T+              LTL  A++ G++DT      +TI+ ++ SL+EA                                 I   +ID +   I+D    Q +S++E    G     +  ++  R+          I    S D   + +D+  E  L +  +      T+ D+   + ISL EA  R  I+ +    Y           +EK+RI           S   + DA+ +  +    K  V  ++              + +PI+ + +S ++A+  GIID        I D      + ++E         A+L+   E +D++ ++   EL+ I  +       ++  +A+EKGLVD       +  S + +++ EA   G +                      EK+ ++        T++D + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N ++   NE++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E         N  +Y+     KG  V+    ++ML   +   I+ L+   K       +  LE  S+  +  T  +     E + K   +    ++ D    + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G    +L T  K R       +   +S  + T+ H  T++E M   +      + LR   + P   K +      +  + +D E     D  K Q  ++ ++     KN   ++ SE E++   +Q  L+++++  +   + + LDE
Sbjct: 1422 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTNEKERIDKEKQTKLEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEA---------------------------------IARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSCLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT------------IRDPISGKEISLQEAIARGIID---AENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQT---ELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII----DAE---------NSAIYD---AEKGQSVS---LSEMLKSGK--NISALLTSEKERMDKEKLTELEKISMEYS--TDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLV-----DTLRGTIRDPISGKEISLQEAIARGI-IDAENSAIYDAEKGQ-SVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDE 2548          

HSP 12 Score: 88.1965 bits (217), Expect = 2.727e-16
Identity = 246/1211 (20.31%), Postives = 457/1211 (37.74%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS---------------LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKD-------------------------LTVYCGITNG-------------NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINE----GYYDKIITENQYNRI---VFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITL-NDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKS--------------PKLSTNESLTSNITSLTGSNTEN--NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY-------------FENLNKRH--DNYQII---------------SVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG----LLHTIMKTR-------QYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +               L+  DA  KG       L+      I  P    +++L  AI  GIID +N    +    +  SL E  +  K IS  L  +                         LT+   +  G             + +++++ +AI   +ID +   I+D    Q +S++E    G    ++  N+  RI          I    S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I +     KER+ + K  + EKI     +   +      ++  +A+E G++D L G                                            +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++            N   ++T   + ++++   E         TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S  L++               K+S   S  ++  +L  +  +   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y              E ++  +  D + +                ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G     L T  K R       +   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:  986 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKG-------LVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT------------------------------------------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSC-LQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGK 2074          

HSP 13 Score: 87.0409 bits (214), Expect = 7.691e-16
Identity = 132/601 (21.96%), Postives = 263/601 (43.76%), Query Frame = 3
Query: 6501 FKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT----------------NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
             +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++        T+++ + +GLVD   G +  P     ++L E I    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT                ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  140 IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 719          

HSP 14 Score: 79.7221 bits (195), Expect = 1.068e-13
Identity = 134/636 (21.07%), Postives = 257/636 (40.41%), Query Frame = 3
Query: 6540 DAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEI------KLPTINDLITQG------------------LVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLHTIMKTRQYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            +A+EKGLVD       +T S + +++ EA   G +  E   I      +  ++++++  G                  L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++E +A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G   + + T++   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:   27 EAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKK---ISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGK 628          

HSP 15 Score: 75.0998 bits (183), Expect = 3.077e-12
Identity = 131/616 (21.27%), Postives = 262/616 (42.53%), Query Frame = 3
Query: 6501 FKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQS---------------------NVTVYMT-----DVQNSVQNKTLEIPNEEKFVDT-----------KTTKTLESIKRNYFGDDQDSKLIQTVKDASIRQELPLS--VATDERITA--------VNRKPSNSMEN-AHSLGLKSPKLSTNESLTSNIT-SLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
             +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S                     N++  +T     +      + TL+   E+  VDT           K     E+I R    D ++S     + DA   Q + LS  + + + I+A        ++++    +E  +      +  L+ +E++   +  +L G+          I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  338 IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII-DAENS----AIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT----------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 917          

HSP 16 Score: 68.5514 bits (166), Expect = 2.339e-10
Identity = 111/501 (22.16%), Postives = 217/501 (43.31%), Query Frame = 3
Query: 6675 TINDLITQGLVDFDSGIV--TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITL-NDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLS---VATDERITAVNRKPSNS----MENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            T+++ + +GLVD   G +  T+  +E+S  L EAI    ID + S +   + G+ + L E +++            N   ++T   + ++++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S   ++  E I        NS     E   S+ L S  L + +++++ +T+      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:   24 TLDEAMEKGLVDTLRGTIRDTISGKEIS--LQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----------KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 482          

HSP 17 Score: 56.9954 bits (136), Expect = 7.979e-7
Identity = 90/435 (20.69%), Postives = 178/435 (40.92%), Query Frame = 3
Query: 6963 TDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN------------------------------QMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E +  G+I    D+E       ++   V     +  G  ++A LTN                              + + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:   18 TDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 436          
BLAST of Dystonin vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 7300.29 bits (18940), Expect = 0.000e+0
Identity = 3958/4960 (79.80%), Postives = 4197/4960 (84.62%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIV----LEKDEFPFLVDINNEKSS------ISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGY-YDKIIT------ENQYNRIVFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNS------------------IDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAIN-------------------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKTRQYMPLSCPFTNVH---IRTIEEEMNFSI-----PQSLP-ENVLRVFSQKPNDNKNVEGLIITST---SVNLDHEIQIKTDNN------KNQVDINQADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 19502
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L       ++K++   L  I+ E S+      + EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + +    LT+              LTL  A++ G++DT      + I+ ++ SL+EA                                 I   +ID +   I+D    Q +S++E    DK I+      + + ++        I    S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I       KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI                                      E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++  + ++   + + T+    TL +A++ GL+ T+  T +  P+S    ++     R I +  N +I      QS+    +L+ FS  P+  K  +  I  +    S NL+    IK++ +      +   +I +ADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID        SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCR        CV   S  +  +  +KGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE
Sbjct: 3160 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEA---------------------------------IARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSCLLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD-PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKIDDNNFHFSNNLNTFTHIKSNLHHLSHFEEESPNIIEADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID--------SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCREA------CVPEPSNDTESIKNSKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 8032          

HSP 2 Score: 108.612 bits (270), Expect = 1.925e-22
Identity = 238/1104 (21.56%), Postives = 452/1104 (40.94%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TEN------QYNRIVFLTCPLIKFSISIDEIAIN----IDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNY--------FGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----------------------------------NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG---LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E  +  K IS  L K +++    T+ ++  LT+ +A+ + L+D   G I D  + + IS+ E     II  EN      +  + V L+  ++K   +I  +  N    ID+      E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  +   + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y          D  +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E                                   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G    ++   + ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  406 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYS-TDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLS-EMLKSGKNISALLTNEKERIDK------EKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKE-------RMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1412          

HSP 3 Score: 107.842 bits (268), Expect = 3.486e-22
Identity = 226/1079 (20.95%), Postives = 435/1079 (40.32%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAY------------ENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEG----DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + I K    +L       + +   LT+  A+ + L+D   G I D  +   IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I  E     D+E+ +++I +          +           ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  887 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTKLEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1885          

HSP 4 Score: 103.605 bits (257), Expect = 7.191e-21
Identity = 232/1093 (21.23%), Postives = 437/1093 (39.98%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL--------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEA-------YEN----------KFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLP------TINDLITQGLVDFDSGIV--TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            E + ++ S ++ HLT  EA++    D   G I D      I L  A   GI+    S +              Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + +     T+              LTL  A++ G++DT      + I+ ++ SL+EA        EN          K I K    +L       + +   LT+  A+ + L+D   G I D  +   IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   +            +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++        T+++ + +GLVD   G +  T+  +E+S  L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N ++   NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL + +E G V     TL                    ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1679 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTI------------RDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEIS--LQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVD----TLRG------------------TIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2701          

HSP 5 Score: 100.138 bits (248), Expect = 7.728e-20
Identity = 231/1112 (20.77%), Postives = 435/1112 (39.12%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKG-----LVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL E +  G++      I D  K             + L+E L SG N   +  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +                D   G  +S  + ++ G     L+ +K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++ NS +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL + +E G V     TL                    ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:  149 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISALLTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENS------------AIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVD----TLRG------------------TIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 1161          

HSP 6 Score: 99.7525 bits (247), Expect = 1.010e-19
Identity = 243/1158 (20.98%), Postives = 462/1158 (39.90%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIV----LEKDEFPFLVDINNEKSS------ISEALVRGIIDGNSEFSIKPNFSQK-ISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQL------------------------------FIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEG---DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT-NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L       ++K++   L  I+ E S+      + EA+ +G++D     +I+   S K ISL EA+  G++      I D  K             + L+E L SG N  ++  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L                               I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E    D E+L E  +++  + Y+    H        LT ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2269 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVD-TLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISVLQTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE--LEKISMEYSTDAHH--------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3348          

HSP 7 Score: 98.9821 bits (245), Expect = 1.640e-19
Identity = 230/1110 (20.72%), Postives = 439/1110 (39.55%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D     I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2724 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3744          

HSP 8 Score: 97.4413 bits (241), Expect = 4.703e-19
Identity = 255/1217 (20.95%), Postives = 459/1217 (37.72%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGIL------------------------SKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN-------QMLTE-----------------------NQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY-FENLNKRHDNYQII--------------------------------SVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            E + ++ S ++ HLT  EA++    D   G I D      I L  A   GI+                         K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +  N G  K   +L++   + +     T+              LTL  A++ G++DT      + I+ ++ SL+E                                 AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT+       + LTE                         +D +   I+D  +GK  +L   +  G     II   N ++Y  E   KR D  +                                  ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:  689 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE---------------------------------AIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARG-----IIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 1832          

HSP 9 Score: 96.2857 bits (238), Expect = 1.160e-18
Identity = 227/1075 (21.12%), Postives = 427/1075 (39.72%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLV---------TENGKIIVDKNKPS---------------LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TENQ--YNRIVFLTCPLIKFSISIDEIAI-NIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++          E G+  +DK K +               L+  DA  KG       L+      I  P    +++L  AI  GIID +N    +    +  SL E              E + + K    +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  EN   Y+     +  L +   S   I++   ++ E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            D ISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++   +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L++A+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1796 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKG-------LVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2800          

HSP 10 Score: 90.1225 bits (222), Expect = 9.275e-17
Identity = 244/1214 (20.10%), Postives = 456/1214 (37.56%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS---------------LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKD-------------------------LTVYCGITNG-------------NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINE----GYYDKIITENQYNRI---VFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERIT---------------AVNRKPSNSMEN-AHSLGLKSPKLSTNESLTSNIT-SLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY-FENLNKRHDNYQII--------------------------------SVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG----LLHTIMKTR-------QYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +               L+  DA  KG       L+      I  P    +++L  AI  GIID +N    +    +  SL E  +  K IS  L  +                         LT+   +  G             + +++++ +AI   +ID +   I+D    Q +S++E    G    ++  N+  RI          I    S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I +     KER+ + K  + EKI     +   +      ++  +A+E G++D L G                                            +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I                 ++++    +E  +      +  L+ +E++   +  +L G+          I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y  E   KR D  +                                  ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G     L T  K R       +   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:  986 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKG-------LVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT------------------------------------------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT----------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGK 2069          

HSP 11 Score: 87.0409 bits (214), Expect = 6.507e-16
Identity = 132/601 (21.96%), Postives = 263/601 (43.76%), Query Frame = 3
Query: 6501 FKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT----------------NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
             +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++        T+++ + +GLVD   G +  P     ++L E I    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT                ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  140 IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 719          

HSP 12 Score: 80.1073 bits (196), Expect = 8.956e-14
Identity = 134/636 (21.07%), Postives = 257/636 (40.41%), Query Frame = 3
Query: 6540 DAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEI------KLPTINDLITQG------------------LVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLHTIMKTRQYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            +A+EKGLVD       +T S + +++ EA   G +  E   I      +  ++++++  G                  L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++E +A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G   + + T++   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:   27 EAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKK---ISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGK 628          

HSP 13 Score: 68.9366 bits (167), Expect = 1.946e-10
Identity = 109/500 (21.80%), Postives = 217/500 (43.40%), Query Frame = 3
Query: 6675 TINDLITQGLVDFDSGIV--TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLS---VATDERITAVNRKPSNS----MENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            T+++ + +GLVD   G +  T+  +E+S  L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S   ++  E I        NS     E   S+ L S  L + +++++ +T+      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:   24 TLDEAMEKGLVDTLRGTIRDTISGKEIS--LQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 482          

HSP 14 Score: 57.3806 bits (137), Expect = 6.922e-7
Identity = 90/435 (20.69%), Postives = 178/435 (40.92%), Query Frame = 3
Query: 6963 TDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN------------------------------QMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E +  G+I    D+E       ++   V     +  G  ++A LTN                              + + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:   18 TDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 436          
BLAST of Dystonin vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 7300.29 bits (18940), Expect = 0.000e+0
Identity = 3958/4960 (79.80%), Postives = 4197/4960 (84.62%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIV----LEKDEFPFLVDINNEKSS------ISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGY-YDKIIT------ENQYNRIVFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNS------------------IDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAIN-------------------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKTRQYMPLSCPFTNVH---IRTIEEEMNFSI-----PQSLP-ENVLRVFSQKPNDNKNVEGLIITST---SVNLDHEIQIKTDNN------KNQVDINQADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 19502
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L       ++K++   L  I+ E S+      + EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + +    LT+              LTL  A++ G++DT      + I+ ++ SL+EA                                 I   +ID +   I+D    Q +S++E    DK I+      + + ++        I    S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I       KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI                                      E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++  + ++   + + T+    TL +A++ GL+ T+  T +  P+S    ++     R I +  N +I      QS+    +L+ FS  P+  K  +  I  +    S NL+    IK++ +      +   +I +ADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID        SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCR        CV   S  +  +  +KGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE
Sbjct: 3157 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEA---------------------------------IARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSCLLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD-PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKNFSDVPSLFKAYDFKIDDNNFHFSNNLNTFTHIKSNLHHLSHFEEESPNIIEADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID--------SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCREA------CVPEPSNDTESIKNSKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 8029          

HSP 2 Score: 108.612 bits (270), Expect = 1.958e-22
Identity = 238/1104 (21.56%), Postives = 452/1104 (40.94%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TEN------QYNRIVFLTCPLIKFSISIDEIAIN----IDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNY--------FGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----------------------------------NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG---LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E  +  K IS  L K +++    T+ ++  LT+ +A+ + L+D   G I D  + + IS+ E     II  EN      +  + V L+  ++K   +I  +  N    ID+      E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  +   + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y          D  +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E                                   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G    ++   + ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  406 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYS-TDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLS-EMLKSGKNISALLTNEKERIDK------EKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKE-------RMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1412          

HSP 3 Score: 108.227 bits (269), Expect = 3.024e-22
Identity = 229/1079 (21.22%), Postives = 436/1079 (40.41%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAY------------ENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEG----DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + I K    +L       + +   LT+  A+ + L+D   G I D  +   IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I  E     D+E+ + K  Q      +  Y      +T    ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  887 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTKLEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLT---LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1882          

HSP 4 Score: 100.138 bits (248), Expect = 8.263e-20
Identity = 231/1112 (20.77%), Postives = 435/1112 (39.12%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKG-----LVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL E +  G++      I D  K             + L+E L SG N   +  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +                D   G  +S  + ++ G     L+ +K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++ NS +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL + +E G V     TL                    ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:  149 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISALLTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENS------------AIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVD----TLRG------------------TIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 1161          

HSP 5 Score: 99.7525 bits (247), Expect = 1.089e-19
Identity = 243/1158 (20.98%), Postives = 462/1158 (39.90%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIV----LEKDEFPFLVDINNEKSS------ISEALVRGIIDGNSEFSIKPNFSQK-ISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQL------------------------------FIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEG---DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT-NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L       ++K++   L  I+ E S+      + EA+ +G++D     +I+   S K ISL EA+  G++      I D  K             + L+E L SG N  ++  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L                               I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E    D E+L E  +++  + Y+    H        LT ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2266 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVD-TLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISVLQTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE--LEKISMEYSTDAHH--------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3345          

HSP 6 Score: 98.9821 bits (245), Expect = 1.668e-19
Identity = 230/1110 (20.72%), Postives = 439/1110 (39.55%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D     I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2721 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3741          

HSP 7 Score: 98.5969 bits (244), Expect = 2.512e-19
Identity = 257/1213 (21.19%), Postives = 471/1213 (38.83%), Query Frame = 3
Query: 5055 DPITNTELKYTDAIRYQYINDDISEILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQK-ISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEK-----------------LTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNN------EKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEI------KLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLG----LKSPK----LSTNES-----------------LTSNITSLTGSNTEN----NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            DPI+ TE                              ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D     +I+   S K ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + +    LT+              LTL  A++ G++DT      +TI+ ++ SL+EA     I     ++  +Y      N EK                 LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N      EK ++R+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I      K  ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+     LKS K    L TNE                   +++   LT          ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++    ++   + + T+    TL DA++ GL+ T+  T
Sbjct: 1514 DPISGTE------------------------------ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVD-TLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDA---ENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGT 2652          

HSP 8 Score: 98.2117 bits (243), Expect = 3.338e-19
Identity = 249/1190 (20.92%), Postives = 459/1190 (38.57%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGIL------------------------SKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN-------QMLTE-----------------------NQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY----FENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLL 8072
            E + ++ S ++ HLT  EA++    D   G I D      I L  A   GI+                         K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +  N G  K   +L++   + +     T+              LTL  A++ G++DT      + I+ ++ SL+E                                 AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT+       + LTE                         +D +   I+D  +GK  +L   +  G     II   N ++Y     +N  K+ +  +I   Y    + L T  EA+++ +++ +  T  +  + +  +L +A+  G++
Sbjct:  689 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE---------------------------------AIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARG-----IIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHL-TLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII 1804          

HSP 9 Score: 96.2857 bits (238), Expect = 1.200e-18
Identity = 227/1075 (21.12%), Postives = 427/1075 (39.72%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLV---------TENGKIIVDKNKPS---------------LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TENQ--YNRIVFLTCPLIKFSISIDEIAI-NIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++          E G+  +DK K +               L+  DA  KG       L+      I  P    +++L  AI  GIID +N    +    +  SL E              E + + K    +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  EN   Y+     +  L +   S   I++   ++ E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            D ISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++   +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L++A+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1793 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKG-------LVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2797          

HSP 10 Score: 92.0485 bits (227), Expect = 2.147e-17
Identity = 246/1211 (20.31%), Postives = 458/1211 (37.82%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS---------------LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKD-------------------------LTVYCGITNG-------------NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINE----GYYDKIITENQYNRI---VFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERI-----TAV-------NRKPSNSMEN-AHSLGLKSPKLSTNESLTSNIT-SLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY-FENLNKRHDNYQII--------------------------------SVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG----LLHTIMKTR-------QYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +               L+  DA  KG       L+      I  P    +++L  AI  GIID +N    +    +  SL E  +  K IS  L  +                         LT+   +  G             + +++++ +AI   +ID +   I+D    Q +S++E    G    ++  N+  RI          I    S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I +     KER+ + K  + EKI     +   +      ++  +A+E G++D L G                                            +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I     +A+       N++    +E  +      +  L+ +E++   +  +L G+          I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y  E   KR D  +                                  ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G     L T  K R       +   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:  986 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKG-------LVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT------------------------------------------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT----------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGK 2066          

HSP 11 Score: 87.0409 bits (214), Expect = 6.617e-16
Identity = 132/601 (21.96%), Postives = 263/601 (43.76%), Query Frame = 3
Query: 6501 FKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT----------------NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
             +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++        T+++ + +GLVD   G +  P     ++L E I    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT                ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  140 IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 719          

HSP 12 Score: 80.1073 bits (196), Expect = 9.107e-14
Identity = 134/636 (21.07%), Postives = 257/636 (40.41%), Query Frame = 3
Query: 6540 DAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEI------KLPTINDLITQG------------------LVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLHTIMKTRQYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            +A+EKGLVD       +T S + +++ EA   G +  E   I      +  ++++++  G                  L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++E +A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G   + + T++   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:   27 EAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKK---ISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGK 628          

HSP 13 Score: 68.9366 bits (167), Expect = 1.979e-10
Identity = 109/500 (21.80%), Postives = 217/500 (43.40%), Query Frame = 3
Query: 6675 TINDLITQGLVDFDSGIV--TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLS---VATDERITAVNRKPSNS----MENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            T+++ + +GLVD   G +  T+  +E+S  L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S   ++  E I        NS     E   S+ L S  L + +++++ +T+      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:   24 TLDEAMEKGLVDTLRGTIRDTISGKEIS--LQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 482          

HSP 14 Score: 56.9954 bits (136), Expect = 7.098e-7
Identity = 90/435 (20.69%), Postives = 178/435 (40.92%), Query Frame = 3
Query: 6963 TDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN------------------------------QMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E +  G+I    D+E       ++   V     +  G  ++A LTN                              + + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:   18 TDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 436          
BLAST of Dystonin vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 7234.42 bits (18769), Expect = 0.000e+0
Identity = 3705/3726 (99.44%), Postives = 3709/3726 (99.54%), Query Frame = 3
Query: 8325 QADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 19502
            +ADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCR        CV   S  +  +  +KGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE
Sbjct: 4583 KADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCREA------CVPEPSNDTESIKNSKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 8302          

HSP 2 Score: 107.842 bits (268), Expect = 3.522e-22
Identity = 238/1104 (21.56%), Postives = 452/1104 (40.94%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TEN------QYNRIVFLTCPLIKFSISIDEIAIN----IDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNY--------FGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----------------------------------NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG---LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E  +  K IS  L K +++    T+ ++  LT+ +A+ + L+D   G I D  + + IS+ E     II  EN      +  + V L+  ++K   +I  +  N    ID+      E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  +   + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y          D  +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E                                   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G    ++   + ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  406 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYS-TDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLS-EMLKSGKNISALLTNEKERIDK------EKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKE-------RMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1412          

HSP 3 Score: 107.071 bits (266), Expect = 5.965e-22
Identity = 229/1079 (21.22%), Postives = 436/1079 (40.41%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAY------------ENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEG----DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + I K    +L       + +   LT+  A+ + L+D   G I D  +   IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I  E     D+E+ + K  Q      +  Y      +T    ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  887 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTKLEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLT---LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1882          

HSP 4 Score: 98.9821 bits (245), Expect = 1.524e-19
Identity = 231/1112 (20.77%), Postives = 435/1112 (39.12%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKG-----LVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL E +  G++      I D  K             + L+E L SG N   +  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +                D   G  +S  + ++ G     L+ +K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++ NS +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL + +E G V     TL                    ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:  149 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISALLTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENS------------AIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVD----TLRG------------------TIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 1161          

HSP 5 Score: 98.9821 bits (245), Expect = 1.699e-19
Identity = 213/1021 (20.86%), Postives = 403/1021 (39.47%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQN-----GLVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEI-KLP----------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY 7883
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++      L+T   K  +DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E    G  + ++ E+ K+           T+++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y
Sbjct: 3315 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSE-KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIKKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY 4252          

HSP 6 Score: 98.5969 bits (244), Expect = 2.112e-19
Identity = 243/1158 (20.98%), Postives = 462/1158 (39.90%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIV----LEKDEFPFLVDINNEKSS------ISEALVRGIIDGNSEFSIKPNFSQK-ISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQL------------------------------FIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEG---DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT-NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L       ++K++   L  I+ E S+      + EA+ +G++D     +I+   S K ISL EA+  G++      I D  K             + L+E L SG N  ++  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L                               I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E    D E+L E  +++  + Y+    H        LT ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2266 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVD-TLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISVLQTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE--LEKISMEYSTDAHH--------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3345          

HSP 7 Score: 98.2117 bits (243), Expect = 3.076e-19
Identity = 248/1195 (20.75%), Postives = 466/1195 (39.00%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----------------------------------NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYY----------YVHKGVGVTAKLT------------NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNK--------RHDNYQII---------------SVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLHTIMKTRQYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D     I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E                                   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y            + KG+  T + T             + +    ID  N  I D + G+S +L   L++G   + ++T     +  E L +          D + +                ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G    I K  +   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct: 2721 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNIKKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGK 3835          

HSP 8 Score: 97.4413 bits (241), Expect = 5.342e-19
Identity = 257/1213 (21.19%), Postives = 471/1213 (38.83%), Query Frame = 3
Query: 5055 DPITNTELKYTDAIRYQYINDDISEILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQK-ISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEK-----------------LTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNN------EKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEI------KLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLG----LKSPK----LSTNES-----------------LTSNITSLTGSNTEN----NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            DPI+ TE                              ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D     +I+   S K ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + +    LT+              LTL  A++ G++DT      +TI+ ++ SL+EA     I     ++  +Y      N EK                 LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N      EK ++R+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I      K  ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+     LKS K    L TNE                   +++   LT          ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++    ++   + + T+    TL DA++ GL+ T+  T
Sbjct: 1514 DPISGTE------------------------------ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVD-TLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDA---ENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGT 2652          

HSP 9 Score: 97.0561 bits (240), Expect = 7.098e-19
Identity = 249/1190 (20.92%), Postives = 459/1190 (38.57%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGIL------------------------SKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN-------QMLTE-----------------------NQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY----FENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLL 8072
            E + ++ S ++ HLT  EA++    D   G I D      I L  A   GI+                         K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +  N G  K   +L++   + +     T+              LTL  A++ G++DT      + I+ ++ SL+E                                 AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT+       + LTE                         +D +   I+D  +GK  +L   +  G     II   N ++Y     +N  K+ +  +I   Y    + L T  EA+++ +++ +  T  +  + +  +L +A+  G++
Sbjct:  689 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE---------------------------------AIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARG-----IIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHL-TLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII 1804          

HSP 10 Score: 95.5153 bits (236), Expect = 2.087e-18
Identity = 227/1075 (21.12%), Postives = 427/1075 (39.72%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLV---------TENGKIIVDKNKPS---------------LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TENQ--YNRIVFLTCPLIKFSISIDEIAI-NIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++          E G+  +DK K +               L+  DA  KG       L+      I  P    +++L  AI  GIID +N    +    +  SL E              E + + K    +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  EN   Y+     +  L +   S   I++   ++ E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            D ISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++   +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L++A+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1793 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKG-------LVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2797          

HSP 11 Score: 91.2781 bits (225), Expect = 4.164e-17
Identity = 233/1150 (20.26%), Postives = 436/1150 (37.91%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS---------------LSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKD-------------------------LTVYCGITNG-------------NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINE----GYYDKIITENQYNRI---VFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERI-----TAV-------NRKPSNSMEN-AHSLGLKSPKLSTNESLTSNIT-SLTGSNTENNSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY-FENLNKRHDNYQII--------------------------------SVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +               L+  DA  KG       L+      I  P    +++L  AI  GIID +N    +    +  SL E  +  K IS  L  +                         LT+   +  G             + +++++ +AI   +ID +   I+D    Q +S++E    G    ++  N+  RI          I    S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I +     KER+ + K  + EKI     +   +      ++  +A+E G++D L G                                            +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I     +A+       N++    +E  +      +  L+ +E++   +  +L G+          I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y  E   KR D  +                                  ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:  986 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKG-------LVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT------------------------------------------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT----------IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIYDAEKGQKRIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2005          

HSP 12 Score: 89.7373 bits (221), Expect = 1.010e-16
Identity = 240/1112 (21.58%), Postives = 445/1112 (40.02%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFIS----INEGYYD---KIITENQYNRIVFLTCPLIKFSISIDEIAINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIIT-LNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNVTVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----------------------------------NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEG---DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT-NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D   G I D  + + IS    I  G  D     I + +  + V L+  ++K   +I   A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++            N   ++T   + I+++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D    N  +Y  +   SV     E+    K +  +T   LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E                                   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ NE    D E+L E  +++  + Y+    H        LT ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 3117 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLS-EMLKSDKNIS--ALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG----------KNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIID--AENSAIYDAEKGQSVS--LSEMLKSGKNIKKQT--ELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTE--LEKISMEYSTDAHH--------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 4124          

HSP 13 Score: 87.0409 bits (214), Expect = 7.834e-16
Identity = 132/601 (21.96%), Postives = 263/601 (43.76%), Query Frame = 3
Query: 6501 FKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT----------------NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
             +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++        T+++ + +GLVD   G +  P     ++L E I    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  +  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT                ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E ID++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  140 IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 719          

HSP 14 Score: 82.8037 bits (203), Expect = 1.289e-14
Identity = 162/750 (21.60%), Postives = 302/750 (40.27%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISK--SLLKD------LTVYCGITNGNNEK------------------LTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI---AINIDQ---TECNLFENRKL--YQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNVTVYMTDVQNSV 7148
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +    G  K   +L++   + I    LT+              LTL  A++ G++DT      + I+ ++ SL+EA     I    S + D      +++   + +G N K                  LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+     NI     +E    +  KL   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  +   + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D    N  +Y  +   SV
Sbjct: 3553 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIKKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIID--AENSAIYDAEKGQSV 4260          

HSP 15 Score: 79.7221 bits (195), Expect = 1.222e-13
Identity = 134/636 (21.07%), Postives = 257/636 (40.41%), Query Frame = 3
Query: 6540 DAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEI------KLPTINDLITQG------------------LVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLHTIMKTRQYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            +A+EKGLVD       +T S + +++ EA   G +  E   I      +  ++++++  G                  L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++E +A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G   + + T++   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct:   27 EAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKK---ISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGK 628          

HSP 16 Score: 68.5514 bits (166), Expect = 2.401e-10
Identity = 109/500 (21.80%), Postives = 217/500 (43.40%), Query Frame = 3
Query: 6675 TINDLITQGLVDFDSGIV--TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLS---VATDERITAVNRKPSNS----MENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            T+++ + +GLVD   G +  T+  +E+S  L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S   ++  E I        NS     E   S+ L S  L + +++++ +T+      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q +     ++        TL   +E G V     TL                    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:   24 TLDEAMEKGLVDTLRGTIRDTISGKEIS--LQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEEIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD----TLRG------------------TIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 482          

HSP 17 Score: 57.3806 bits (137), Expect = 6.928e-7
Identity = 90/435 (20.69%), Postives = 178/435 (40.92%), Query Frame = 3
Query: 6963 TDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN------------------------------QMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            TD + +T +EA+E+G +D    T RD  +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E +  G+I    D+E       ++   V     +  G  ++A LTN                              + + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:   18 TDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 436          
BLAST of Dystonin vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 7204.37 bits (18691), Expect = 0.000e+0
Identity = 3695/3726 (99.17%), Postives = 3696/3726 (99.19%), Query Frame = 3
Query: 8325 QADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQXXXXXXXXXXXXXXADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKXXXXXXXXXXXXXXXXXXXXXXPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRXXXXXXXXXXXXXXRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPXXXXXXXXXXXXXXXXXXXXESXXXXXXXXXXXXXXXXXXXQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYXXXXXXXXXXXXXXXXXDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNXXXXXXXXXXXXXXXXXXQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVXXXXXXXXNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKIXXXXXXXXXXXXEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIIDSKVCRHIFSKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCRVLHCGDCECVCHFSMSSLELLEAKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 19502
            +ADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID        SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCR                      AKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE
Sbjct: 4580 KADAPNFAKNYIEMVKSEMEKLSVIEQKLLKEVNVFLNEKENQMLLDEFQDVNNEFVSQQTLVLTLIHEIEKFLMKKYDTIPLEIEKDLEETTNLLKTHTNQTHKELNNRSRLLIAIIDEFDQFINRLNDCTSAHDKLKLSIDKISNVKSVEDLQKSLTDLKLLDNEFASYNNDIRVLIGSKIKFIDKINKLEEQRKKFSDLVKVPLVSNQDSKTDQEITELLNEVTDGQKDLQDLYKTKLSQIKDVLENLENLAEKQKKIDKICENSREELQKILSNKEELSIHSLLPHTDNLHRLNGEMVSTSKIIKEIEDSLQNSIKSLEAIGNTRENIDLFRKPIDGSLNEFYGINKRLHEILQQINEQEISNDDTVYSINNLDLWLKEIDQRIKNIGSLSLDPKYINEQERLIQTILAEISSRQPFLENVLMNNASRNEPKLKELDDKIKQKLLVASNIEAKVNDTRKLLGSFEVAVKSCGDWIALTTELLSDRMFVRLDNEKFKEKLDEIKEGYEMKQRDMEQARKICKELVSQSNCKDQNSIEICMENLEKVWSSLNELINTRSKELSDRKNYSEKYAQLKAKIIENLNNWEQTLSMNSPLAIDLLALENQHEDIEYFINEWNSSKPVINEFYKIGSEYDSIMQGFPLGGDQQAKLTSPQRKPSKIKAELYTQPLSPTSITKQPTTANRQSGHYSGSESSGVSSADYVNLNQEFSETILEINDIKSRYSEIGDQLVNRKSDIAALLNKCLSFDQEYKEFSDKLDSELNELLSVEVKNLILNDEIIEIERIDEDIRNLRPTLTNILTMGQDLLRNRELVPGGVELKSKLDRLEKKFISLKDSAKKHLNLRRNTDSQMKKFGEMKKSIENNIVRKERMLNVLGPVGTSVSYGNAQLQQVNALIDEVEGLENDVKELRNIGQEIIRSMSPTSSEVDEIEETLDRLSKKVDNLNKLLKDRELNIHSIMGPSKDFYKLINDVSDRLAVLQEKIDKNDTNVLTSFDWEEIQTELDSIKSILKESENLSKTLLESISDENTHYEIKNKVSNLSRNCREIQWKIDHSVDMIGKRSHHEDVLLTKLEDTEQWLQRKQEQLNLLSLEVGEIPTTLSDNIRQIQILQGDIKHKKSQVEDIYTELNRMNEEKSPTHKSKQIFDKLAVLTNVIENIDTDINNLSIVYQQASTDLNKINNETNKIEAWIDIEKHKMNKHYPVGLESIDSEIKLLECTGKSIENKHQQINDLKNLISPLDVLDSKTLLSKKLSSVFKVESDLKDLKLEADEKLEFLKKLQEQISTTTENMNYLKSALLKLETKAEEYLKFAESADKQPIDVSKLESEIKTTQSDMHLIKPDMENTKLLIASIAQISPVNATLLEPEMEKIVNRYQVLSSSLAQKLIYLNSKHKAMDECKSRIEIFATRQKNLREKIDNFPQSSLDLDSLEDQIHDLANLRRESNEIEKSLSNLKSEVENLAEQKIETAEKSMHKIDNLAAINEKIIESIDDRQNSLILQHKIVTEFESKKNDFIRKIDEANNDPELAKLLNNTSKNIGAFSEQKVDPLKKQLEELIDIGNKACSTVISGLGFKHMEQEMDSVKHSFDRLMQIVSDIENHVDIKLMKEQKFDTSLENLKEFVENISRDLDAEEEPSIEYHKSKSQLNSHRLLLDRLKKRQSSLDELNKAGSDLLINTKEPKKSQLQNELDELNAKYENLLNLAEGKNCRYDRAVKLSKSFKDFYEPSLIWLDTAEKNLANFDTSPTVDAIEMEKRIQEYKHLQNDDSSIDESIKKLKIIINKVDGVFSENVSIDTKNKINKLFDRFSEYQKSHYEKLELLLKFGNLLRNYLDQVNLFEDTLYGFESAMKDLKLNIVDPYQTRDIWEESLNLVKEVKSHEETLKNLDQVGEDLKQISSENDSAAINCKINILHNYFDEISVSALKKLSLFENSIPIAERFLLANNKLDLVLPSLTALVRENDSLTGQVGERNMEILENETNSVEKLVCQARNDLDKLKSVDAFENSLEKVEDIFVENEKRFKEVLNEVTKKATKIGSNRTKAKIQEENLDQCMEVLSNFEQKINEMSDQINNDYSELEECKIDFTNLLSAWNEQKESINSTINDSKKLIRQAPGSDLKSLKSAVDRVKKQSESTTKALESQQQQLDEAIPLAKEFISSYNTLKDWLVETEENMYQNKINNLDPDQLHKAEQEIKALANSWEDQKPLLDIIIKSGHPLSQIVNRVQGKNILANIEDAKKRYNNIKEFIKTRATDLEDLILINTELNEKVDQCANQLENIRDRITDSYQPSVHPEKLDEELGVFDEILYDLDKLQIFVDKLQIGIENCSPSRKNANDKDDSVEILEKLAKISSSNKGLQSQTMEYKEKIMNLLSLANEFWNDLKLIEDKFHEMTIHLTNSTIEDLNTRSVNDKKKLIEDLRGEIDVHEKDIGKISQKGKQLIEKVNNPNETPDVEQAEEELKRNFEAVRSSCEQQITNIDRQQSLITKLEEMRMKLDEWFKEVNNRLFILGPLPTETRPVLTQIQKTKELKNDIEPKHRDIELINQLGYQLTKGSHPNIKNQVNSTLARINDSWARLLDGLGQRQHQLQCILLSLGEFHRAVDEFIEWIIATENSLTNIKIEHGDINSLEMGLAQHKMIRADMNISQASVSKMERKAAEIIKEDVSSLGHEATQRLEQLRKSWEELKEHARAKHFELEDALKEALIFYGDQQEISKNIDELGSKLEMFKFSGGLPDTAKEQLKRFMDIYRTFPKLNIKIEKFIEESAEISKKSSQSIGKAIEIDMEILVKKWDTVKNLAETRKSRLEKAIETVETFHLDMGKFINWLTLTEKNLNQQRPVSRIVSTILEQVEAHRALKRDITSHREEMLNLDKMATHLKYISQKHDIVLIRNLMSSIHHRWEKVVSRSSERSRNLDYGYKEAKRFEDMNRTLLDDIASNLEILERDTSIGQTPSKIREQITKHKEFHCNLGVHNLTYDSTRRLGYQLRDKAPIQDSKKIDEIVHNLQMKWQSLCNKSIEREKALNDALLLSGNYKDAMTNLLSWLRAIEPKLSDSSKRCGGDMNTVQTLLNEHSILEKQLRDRDHMIEKINTDAMALMIQSEEDSSFIEDQLAELKSTWNNVNKLANEKKRRLEEAKNQAIEFERLWNSLKEFFSKSEHELRQFTISPEEEKEELISNMISNHGIFHKNLLMNEMKINDFQQFGHEILVSAYPEAEGSIKHYINIIKSQWSDLLSWSEQRGLNLKDHLDRLNERKILLDDLLLWLAAAEGTLLASESRELSYALAEAKFQYNEHERFITDMTLKQKDHDEIITNSKKKTPPLIPIFDRSKRMETNQGISKIQEPLFVNPKINQLHSKWKQVWFMILNRRKRLLDHIEYLKEVENMKNFNFEDWRRRYMSWMNHSKSRVMDFFRRQDTDHDGRVTRKEFIDGIID--------SKFQTTRVEMEVVADIFDKEKSGFIDYRQFLAALRPDRETYQVKPANENEIIHDEVKKQISKCTCSNPYKITQCGDGKYKFGDTEKLRLVRILRSNVMVRIGGGWCALDEFLVKHDPCR----------------------AKGRTNYELREKLSNPKGTINTMAPFKFKPATLPIPTKKPTTAKIPSPRVSQPLSSPRIHQPVSSPRIPQPVTSPRISQNIPSSRVSQSLASPRTPKVVASPGLQRKSRIPTRQTSQQGSQASTRHQSRDISPETVTSTNKQMNE 8275          

HSP 2 Score: 108.227 bits (269), Expect = 3.185e-22
Identity = 238/1104 (21.56%), Postives = 452/1104 (40.94%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG-----LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYE-NKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII-TEN------QYNRIVFLTCPLIKFSISIDEIAIN----IDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNY--------FGDDQDSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----------------------------------NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG---LIVNEGDSERLE-EKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G     L+T N K  +DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E  +  K IS  L K +++    T+ ++  LT+ +A+ + L+D   G I D  + + IS+ E     II  EN      +  + V L+  ++K   +I  +  N    ID+      E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  +   + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y          D  +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E                                   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G    ++   + ER++ EK  +   +   Y      + +     ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  406 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLT-NEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYS-TDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLS-EMLKSGKNISALLTNEKERIDK------EKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKE-------RMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTL-----DEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1412          

HSP 3 Score: 107.457 bits (267), Expect = 5.394e-22
Identity = 229/1079 (21.22%), Postives = 436/1079 (40.41%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAY------------ENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEG----DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + I K    +L       + +   LT+  A+ + L+D   G I D  +   IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I  E     D+E+ + K  Q      +  Y      +T    ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++    ++   + + T+    TL +A++ GL+ T+  T
Sbjct:  887 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTKLEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLT---LDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 1882          

HSP 4 Score: 103.605 bits (257), Expect = 6.738e-21
Identity = 240/1102 (21.78%), Postives = 439/1102 (39.84%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISG---PNQEIIHPNLTQK-LTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKII---------TENQYNRIVFLTCPLIKFSISIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANF-IQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDV--------KSLNNELKIIGF---------------------------KDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLPT------INDLITQGLVDFDSGIV--TLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTG--KSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G     +  I   ++ K ++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II          E   N+        I    S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +   I       KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +  +        K    EL+ I                             +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++  T      +++ + +GLVD   G +  T+  +E+S  L EAI    ID + S +   + G+ + L E +++     +   ++ N    I        +       TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E         N  +Y+     KG  V+    ++ML   +   + Q  +  +    K T L       S  A  +TL       E + K   +    ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1481 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGTEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEIS--LQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISV---LQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII----DAE---------NSAIYD---AEKGQSVS---LSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLD------EAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2497          

HSP 5 Score: 102.834 bits (255), Expect = 1.283e-20
Identity = 233/1097 (21.24%), Postives = 451/1097 (41.11%), Query Frame = 3
Query: 5055 DPITNTELKYTDAIRYQYINDDISEILFVDPSEN-------------SFHLTTKEAVKNKFFDPESGNI-FDHNRDS-YIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG----LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISG----PNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI---AINIDQ---TECNLFENRKL--YQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLT--------------EKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            DPI+ TE+   +AI    I+ + S I   +  ++             S  LT+++   +K    E   I  +++ D+ ++ L  A ++G++      ++  +   E            S+ EA+ RGIID  +         Q +SL E +++G    ++  N K  +DK K +    +S   + +  ++ L+E++  G        I  P    +++L  AI  GIID +N    +    +  SL E              E + + K    +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+     NI     +E    +  KL   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    SV     KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   +            +DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT              EK+ ++        T+++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++     I   + +    I        E +  E+  TD + +T ++A+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E         N  +Y+     KG  V+    ++ML   +   I+ L+   K       +  LE  S+  +  T  +     E + K   +   +++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct: 1959 DPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEI-----------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTI------------RDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNISALLTNEKERIDKEKQTELEKISMEY-STDAHHLTLDDAMEKGLVDTLRGTIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAE---------NSAIYD---AEKGQSVS---LSEMLKSGK--NISALLTSEKERMDKEKLTELEKISMEYS--TDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 2992          

HSP 6 Score: 99.3673 bits (246), Expect = 1.278e-19
Identity = 231/1112 (20.77%), Postives = 435/1112 (39.12%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKG-----LVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQMLTENQIDPINQL------IKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHG 8066
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL E +  G++      I D  K             + L+E L SG N   +  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++  +A+E G++D L G    I D     +I + EAI  G I+A +                D   G  +S  + ++ G     L+ +K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++ NS +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LTN+   + +ID   Q       ++        TL + +E G V     TL                    ++ DP     I+ QEAI R +I+  +S   + +  +  +LS+ L+ G
Sbjct:  149 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEEIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISALLTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDEAMEKGLVDTLRGT---IRDPISGKEISLQEAIARGIIDAENS------------AIYDAEKGQSVSLSEMLKSGKNISALLTKKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHHLTLDDAMEKGLVD----TLRG------------------TIRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG 1161          

HSP 7 Score: 98.9821 bits (245), Expect = 1.563e-19
Identity = 213/1021 (20.86%), Postives = 403/1021 (39.47%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQN-----GLVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNEAEDLGFVLTEKLEI-KLP----------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDNCGHIITLNDAINEDLFPEF------VPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTNQ---MLTENQ---------------------------IDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY 7883
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++      L+T   K  +DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D   G I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E    G  + ++ E+ K+           T+++ + +GLVD   G +  P     ++L EAI    ID + S +   + G+ + L E +++          ++    + +  + ++++   E         TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT++   M  E Q                           +D +   I+DP +GK  +L   +  G     II   N ++Y
Sbjct: 3312 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSE-KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNIKKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---------KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQSELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY 4249          

HSP 8 Score: 98.9821 bits (245), Expect = 1.847e-19
Identity = 243/1158 (20.98%), Postives = 462/1158 (39.90%), Query Frame = 3
Query: 5166 LTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIV----LEKDEFPFLVDINNEKSS------ISEALVRGIIDGNSEFSIKPNFSQK-ISLFEAVQNGLVTENGKIIVDKNKPSLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNE------QFSLKEAYENKFISKSLLKDLTVYCGITNG-NNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQD------------SKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTSNITSLTGSNTENNSTQL------------------------------FIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEG---DSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLT-NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNKRHDNYQIISVYD-----PRINQLITYQ-EAIDRQVINIIDSTYINHKTNEIS-TLSDALQHGLLHTIMKT 8090
            ++ +EA+     D E+  I+D  +   + L    + G   K IS L       ++K++   L  I+ E S+      + EA+ +G++D     +I+   S K ISL EA+  G++      I D  K             + L+E L SG N  ++  N  ++           ID + +  +  I+ E        +L EA E   +        T+   I +  + +++++ +AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D                 L  T++D    +E+ L  A    I           E   S+ L S  L + +++++ +TS      +   T+L                               I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E    D E+L E  +++  + Y+    H        LT ++ + +  +D +   I+DP +GK  +L   +  G     II   N ++Y        +  Q +S+ +       I+ L+T + E +D++ +  ++   + + T+    TL +A++ GL+ T+  T
Sbjct: 2263 ISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG---KNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVD-TLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQ----------SVSLSEMLKSGKNISVLQTNEKER-----------IDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVD-------TLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSL-SEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE--LEKISMEYSTDAHH--------LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARG-----IIDAENSAIY------DAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGT 3342          

HSP 9 Score: 98.2117 bits (243), Expect = 2.691e-19
Identity = 248/1195 (20.75%), Postives = 466/1195 (39.00%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGILSKPISILQIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNG------LVTENGKIIVDKNKPS----LSFLDAFNKGYIKLNESLISGP----NQEIIHPNLTQKLTLLGAIQLGIIDTKNEKFINTITNEQFSLKE------------AYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLTCPLIKFSISIDEI--------AINIDQTECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDANFIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDRKFENFWNTKSNQILTMNE----AEDLGFVLTEKLEIKLPTINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSNSIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRD-NCGHIITLNDAIN------------------------EDLFPEFVPTDKNKITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----------------------------------NSTQLFIINPNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMG-----LIVNEGDSERLE-EKIIQRNCVVYNYY----------YVHKGVGVTAKLT------------NQMLTENQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLYFENLNK--------RHDNYQII---------------SVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLLHTIMKTRQYMPLSCPF-TNVHIRTIEEEMNFSIPQSLPENVLRVFSQK 8213
            E + ++ S ++ HLT  EA++    D   G I D                    PIS  +I                  S+ EA+ RGIID  +         Q +SL E +++G      L +E  ++  DK K +    +S   + +  ++ L+E++  G        I  P   ++++L  AI  GIID +N    +    +  SL E              E + + K  L +L       + +   LT+ +A+ + L+D     I D  + + IS+ E     II  +  N  ++        S+S+ E+        A+   + E    E +   + I+  Y S    +++LDEA ++  ++   G           S  +AI    I   N    +         SE +KS    S      KE +   +  E   ++ +S  Y           + ++EA+  G ++ +   ++            DPISG  IS  +AI +G++D +    ++ +  Q ++++E     +++  +LT + E        +  + L + +   +        +TL+EA+    +D  R  ++ P +G+ I L+EAI   + D     I D   G  ++L++ +                         E +  E+  TD + +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + +E++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E                                   ++ +  I +P +G++++L+EAI   I D   + I       S S  E +K G     L+ +E   ER++ EK  +   +   Y            + KG+  T + T             + +    ID  N  I D + G+S +L   L++G   + ++T     +  E L +          D + +                ++ DP   + I+ QEAI R +I+  +S   + +  +  +LS+ L+ G    I K  +   +S  + T+ H  T++E M   +  +L   +    S K
Sbjct: 2718 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRD--------------------PISGKEI------------------SLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERM--DKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRVTIRDPISGKEISLQEAIARGII--DAENSAIYDAEK--GQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTE---LEKISMEYSTDAHH-----LTLDEAMEKGLVDTLRGTIR------------DPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKE-------RMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEY-STDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSDKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSE--KERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSG--KNIKKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGK 3832          

HSP 10 Score: 97.0561 bits (240), Expect = 6.054e-19
Identity = 249/1190 (20.92%), Postives = 459/1190 (38.57%), Query Frame = 3
Query: 5127 EILFVDPSENSFHLTTKEAVKNKFFDPESGNIFDHNRDSYIPLHYARQEGIL------------------------SKPISIL------------QIVLEKDEFPFLVDINNEKSSISEALVRGIIDGNSEFSIKPNFSQKISLFEAVQNGLVTENGKIIVDKNKP-SLSFLDAFNKGYIKLNESLISGPNQEIIHPNLTQ-------------KLTLLGAIQLGIIDTKNEKFINTITNEQFSLKEAYENKFISKSLLKDLTVYCGITNGNNEKLTILQAINENLIDIKTGQIFDRSNNQFISINEGYYDKIITENQYNRIVFLT-----------CPLIKFSI--SIDEIAINIDQT-ECNLFENRKLYQTITTVYDSKQNEYISLDEARKRDFINDDMGMYYHEKDRIYYSFTDAIDAN----FIQTNNEKSKERVXXXXXXXXXXXXXXXXXXVFNPITKEWVSARQAVEDGIIDHLSGNYKIINDFGFVIDIPINEAILSGYIEAIDEDVKSLNNELKIIGFKDPISGGIISPIDAIEKGLVDR-------KFENFWNTKSNQILTMNEAEDLGFVLTEKLEIKLP------TINDLITQGLVDFDSGIVTLPNREVSMTLNEAINSN------------------SIDIDRSMLKHPDNGRHICLREAIENDLFDPIRCEIRDN-CGHIITLNDAINEDL------------------FPEFVPTDKN--------------------------------KITFEEALEQGYIDLKTNTFRDPRNDNVYGVEEALAKNILDHPQSNV-------TVYMTDVQNSVQNKTLEIPNEEKFVDTKTTKTLESIKRNYFGDDQ--------DSKLIQTVKDASIRQELPLSVATDERITAVNRKPSNSMENAHSLGLKSPKLSTNESLTS--NITSLTGSNTEN----NSTQLFIIN---PNTGRKLNLEEAIKENIYDPVENMIRSVTNNNSYSWEESVKMGLIVNEGDSERLEEKIIQRNCVVYNYYYVHKGVGVTAKLTN-------QMLTE-----------------------NQIDPINQLIKDPKTGKSTTLINGLENGSVFATIITLTNRSLY----FENLNKRHDNYQIISVYDPRINQLITYQEAIDRQVINIIDSTYINHKTNEISTLSDALQHGLL 8072
            E + ++ S ++ HLT  EA++    D   G I D      I L  A   GI+                         K IS L            Q  LEK    +  D ++   ++ EA+ +G++D        P   ++ISL EA+  G++      I D  K  S+S  +  N G  K   +L++   + +     T+              LTL  A++ G++DT      + I+ ++ SL+E                                 AI   +ID +   I+D    Q +S++E      + ++  N    LT             L K S+  S D   + +D+  E  L +  +      T+ D    + ISL EA  R  I+ +    Y  +     S ++ + +      + TN    KER+ + K  + EKI     +   +      ++   A+E G++D L G    I D     +I + EAI  G I+A +  +        +   +   SG  IS +   EK  +D+       K    ++T ++  LT++EA + G V T +  I+ P      ++ + I +G++D ++  +    +  S++L+E + S                     ++++  +++  +  H+ L EA+E  L D +R  IRD   G  I+L +AI   +                    E + + KN                                 +T +EA+E+G +D    T RDP +     ++EA+A+ I+D   S +       +V ++++  S +N +  + NE++ +D +    LE I   Y  D          +  L+ T++  +IR   P+S        A+ R   ++  +A     K   +S +E L S  NI++L  S  E       T+L  I+         L L+EA+++ + D +   IR   +    S +E++  G+I    D+E       ++   V     +  G  ++A LT+       + LTE                         +D +   I+D  +GK  +L   +  G     II   N ++Y     +N  K+ +  +I   Y    + L T  EA+++ +++ +  T  +  + +  +L +A+  G++
Sbjct:  689 EKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH--LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLNSG--KNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQE---------------------------------AIARGIIDAENSAIYDAEKGQSVSLSE------MLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLR-----GTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNE---KERIDKEKQTELEKISMEYSTDAHH------LTLDDAMEKGLVDTLRGT---IRDPISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHH-LTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISVLQTNEKERIDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISSLLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTNEKERIDKEKQTKLEKISMEYSTDAHHLTLDEAMEKGLVDTLR-GTIRD--PISGTEISLQEAIARGIIDAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKQTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARGII----DAENSAIYDAEKGQSVSLSEMLKSGKNISALLTSEKERMDKEKLTELEKISMEYSTDAHHLTLDEAMEKGLVDTLRGTIRDTISGKEISLQEAIARG-----IIDAENSAIYDAEKGQNKEKQTELEKISMEYSTDAHHL-TLDEAMEKGLVDTLRGTIRDPISGKEISLQEAIARGII 1804          

HSP 11 Score: 93.9745 bits (232), Expect = 6.034e-18
Identity = 2