Polyamine-modulated factor 1-binding protein 1

Overview
NamePolyamine-modulated factor 1-binding protein 1
Smed IDSMED30009277
Length (bp)6286
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polyamine-modulated factor 1-binding protein 1 (SMED30009277) t-SNE clustered cells

Violin plots show distribution of expression levels for Polyamine-modulated factor 1-binding protein 1 (SMED30009277) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polyamine-modulated factor 1-binding protein 1 (SMED30009277) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polyamine-modulated factor 1-binding protein 1 (SMED30009277) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009277

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30009277SMESG000048873.1 dd_Smed_v4_14986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009277SMESG000048879.1 SMESG000048877.1 Contig6280newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009277SMESG000048879.1 SMESG000048877.1 Contig6280uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009277SMESG000048877.1 Contig37380newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009277SMESG000048877.1 Contig37380uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30009277SMESG000048877.1 dd_Smed_v6_3146_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009277SMESG000048877.1 dd_Smed_v6_3146_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30009277SMESG000048877.1 dd_Smed_v6_3146_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009277SMESG000048877.1 dd_Smed_v6_3146_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30009277SMESG000048877.1 dd_Smed_v4_3146_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Zebrafish
Match: lama5 (laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9823])

HSP 1 Score: 63.1586 bits (152), Expect = 5.182e-9
Identity = 104/537 (19.37%), Postives = 228/537 (42.46%), Query Frame = 1
Query: 2239 LHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEISRIQSDYDEM--EAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQ-IANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQE----KQLVEEKCSKY-----KSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSA-----HYLNDEVKLSLDSLEKEIT--FAKQQIDTKDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIAN 3792
            L++L++    +       NS   K       L+      +  +KDL++K     +KKDA  + +    T  Q  +      +   ++ I ++    ++++      +K+++R  ++ + M  +        +    + EL+Q +  ++ + NEI  +  +  E  +E I  +N++    ++F+E  M L    NE  N   +  E +++N +    LQ   N   E  ++ ++QL++        +  + N   +++   K + E++  +    +Q + EK  KY     K  +V+   +H   L+ +A+  + L        I  S   +++Q+  +A     + +N  ++    +L+   T   A + I  KD   Q        LK +  ++ KS  +  +S +SL    D I     +   K +K  Q +KD+  +L+   V     V+ IS  +S ++Q+    ++   +++ +Q ++ +       +++Q+  S    E++N  L       A L + L  L  + D++ N
Sbjct: 2184 LNRLNASIADIANAITNYNSTLDKSRNRASVLEGELEIIDSDIKDLEKKASVTQKKKDALEDNINSTHTRAQELFGFIKGIMRDVKDIIQQVNRTAQNETQVMD--EKDLARKIAEVESMLRDMRFRGFDYQKNKAKNELDQANNLVDRVINEIANRTWN-NEAVAENI--RNKL----KQFNEQLMDLRDAMNEAVNNTAQTVEANNINQKHLEDLQKKVNSLHEKYKEVVSQLQM-----AEDDVTQVNDLLSMLQDSKEDYEHLAAQLDGARQPLAEKVQKYAPAANKIPLVEAAEKHAEMLEQLANNLSSL--------ISGSNQDNFIQRALNASRAYTNIINSVLEAETTALKANETASMALENIRDKDLPAQAAA-----LKNQSTELLKSAEELNNSSQSLKPRVDTIKMSLLDAEKKKEKMLQDLKDIQNKLN---VSRDDIVNSISAAKSAVEQANNTVANVSGVLAPIQKQLEE-------WQKQYGDSNATSEDINKALNDANTSVAALSDTLPKLIKKLDRLHN 2683          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Xenopus
Match: dcun1d3 (DCN1, defective in cullin neddylation 1, domain containing 3 [Source:Xenbase;Acc:XB-GENE-6258756])

HSP 1 Score: 63.929 bits (154), Expect = 3.804e-9
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 1
Query: 5440 FITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGRTISQ 5733
            F  LKQKY    SE  +++  L+ ++   + L HE+  +V N N W+ EQK A++ LG+KIREQ K I +L  +K+ L++    +I Q+H   R + Q
Sbjct: 1562 FNHLKQKYSAATSELETLRNSLEAARSDCRRLHHESELVVSNVNDWVSEQKQASKTLGEKIREQSKQIGQLATEKDHLQE----VIEQLHRENRQLRQ 1655          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Xenopus
Match: dcun1d3 (DCN1, defective in cullin neddylation 1, domain containing 3 [Source:Xenbase;Acc:XB-GENE-6258756])

HSP 1 Score: 63.929 bits (154), Expect = 3.851e-9
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 1
Query: 5440 FITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGRTISQ 5733
            F  LKQKY    SE  +++  L+ ++   + L HE+  +V N N W+ EQK A++ LG+KIREQ K I +L  +K+ L++    +I Q+H   R + Q
Sbjct: 1688 FNHLKQKYSAATSELETLRNSLEAARSDCRRLHHESELVVSNVNDWVSEQKQASKTLGEKIREQSKQIGQLATEKDHLQE----VIEQLHRENRQLRQ 1781          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Xenopus
Match: dcun1d3 (DCN1, defective in cullin neddylation 1, domain containing 3 [Source:Xenbase;Acc:XB-GENE-6258756])

HSP 1 Score: 63.929 bits (154), Expect = 4.018e-9
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 1
Query: 5440 FITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGRTISQ 5733
            F  LKQKY    SE  +++  L+ ++   + L HE+  +V N N W+ EQK A++ LG+KIREQ K I +L  +K+ L++    +I Q+H   R + Q
Sbjct: 1692 FNHLKQKYSAATSELETLRNSLEAARSDCRRLHHESELVVSNVNDWVSEQKQASKTLGEKIREQSKQIGQLATEKDHLQE----VIEQLHRENRQLRQ 1785          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Xenopus
Match: dcun1d3 (DCN1, defective in cullin neddylation 1, domain containing 3 [Source:Xenbase;Acc:XB-GENE-6258756])

HSP 1 Score: 63.929 bits (154), Expect = 4.040e-9
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 1
Query: 5440 FITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGRTISQ 5733
            F  LKQKY    SE  +++  L+ ++   + L HE+  +V N N W+ EQK A++ LG+KIREQ K I +L  +K+ L++    +I Q+H   R + Q
Sbjct: 1661 FNHLKQKYSAATSELETLRNSLEAARSDCRRLHHESELVVSNVNDWVSEQKQASKTLGEKIREQSKQIGQLATEKDHLQE----VIEQLHRENRQLRQ 1754          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Xenopus
Match: dcun1d3 (DCN1, defective in cullin neddylation 1, domain containing 3 [Source:Xenbase;Acc:XB-GENE-6258756])

HSP 1 Score: 63.929 bits (154), Expect = 4.052e-9
Identity = 37/98 (37.76%), Postives = 58/98 (59.18%), Query Frame = 1
Query: 5440 FITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGRTISQ 5733
            F  LKQKY    SE  +++  L+ ++   + L HE+  +V N N W+ EQK A++ LG+KIREQ K I +L  +K+ L++    +I Q+H   R + Q
Sbjct: 1603 FNHLKQKYSAATSELETLRNSLEAARSDCRRLHHESELVVSNVNDWVSEQKQASKTLGEKIREQSKQIGQLATEKDHLQE----VIEQLHRENRQLRQ 1696          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. TrEMBL
Match: A0A433THS9 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_011129 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 3.485e-46
Identity = 331/1498 (22.10%), Postives = 674/1498 (44.99%), Query Frame = 1
Query: 2008 IEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSE----NFKLNKENE---SLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQS--TKASQAQK-EISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASL--------------RNELDMVNEKLRIKESECQHWMQQ-TQSAHYLNDEVKLSLDSLEKEITFAKQ---QIDTKDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLES-------EIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKL------YARQAEEDISLSHKTIDEIHNEME-LKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKSESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFXXXXXXXXXXXXXXXMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCXXXXXXXXXXXXXXXXXXXXYSEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEFQYQNEQFITLK----------------------------QKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNIL-----------------------EKEKVRIIRQVHENGRTI------SQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERILTLE-------SSQNTEISKHELTEWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQ----------------------DTH--DKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 6111
            +EEL  K  +    N  LE ++ ++ +A+     + ++L++    +ED +  LR +A+       + + K+  RD+ + KL++E  KLK K+QEK  E      ++ K++E    L+    +  + + D++++ +  +  KD AI+ L+    ++Q+Q+  CY  L+K EE    +++L+ + S   KA+QA   E++ +Q    ++E +L   + KHR  Q+E++ RD  I  ++ ++    Q+      E  V +NE+ R   +  ++Q ++    + ++    +++E +    +L    ++A Q+  N   TI Q+K D+   R++ S      Q  +     ++E       + + +  + K  M + K        TVASL               N++   +E+L+ +E+   +  QQ +Q+   L +E +  +  LE+ +   K    Q  T+ G L+   + +  L+++  Q     +D +SS+E L  + D + R Y ++  ++ + E  +  L +EL   Q E+S   S ++ LE         IK++ +E         +L++K+   +++H    ++F   + +V NL   L        E  +++ +     D++++E N+ Q  +D   Q+  +   E+E+  LE+  Q  QLN      +H+ +  +L        RQ ++  +  H +  ++++  E +K  E +I S R     +++  +  +++QLE     ++ E      H     D  + L+ +++ ++ +L E   +  +   E   ++ K++ +E  L  T+ +LS+  ++      +      E+  ++ +  N  + I + K    +   +    K+E     +  L    ++  L+++L+G  E +K+L  Q+E+ E ++ +LQ E+  ER+++    R     K+   + + + E + +  ++L+ ++K  E  +   ++E E    ++R+  E L +R+ +I+L    L  A+ +     + I K E   S   +D +R       LQ    +  + +    +K+H+       L++     +   ++   +     R+ + V +      A +S++ N + EE     + + KL+ EL +   I     DE +++  +R  + Q D ++ + + +    E   + E+ + LK                            Q Y     E ++++  L+ES+     L  E+  +V N N+W+QEQK ANEKLG+KIREQ K I  L  +K +L                       E E++R + Q H   + +      ++ +     + ++ K K   I++L  +++  I  I  L +++ +L+       S    EI+  +  E   +S  +        L  SSY  L+ + +Q                      D H  DK YWI+RVGELS +LQQS EYWS+KV+++S  L
Sbjct:  860 VEELKSKSSQQVEENSRLEDKIRELTVAITTQEAQCDKLRHMVTTKEDMVAQLRSDAESLSRQQKETVSKVLVRDENIQKLNTEIGKLKAKHQEKTKELVACTNEIAKQSELIKKLQGTLGQCHQDLDDVRKRGEADLAHKDEAIKHLQEDLMESQTQHSACYNELVKIEE---ELEILKGEHSHLNKAAQASSMEVASLQDQMHQLELDLTITQEKHRTAQKEVSSRDQVILRLQADLDTATQNYSGSLEELKVNENEMKRMSTRLKQMQQEIRDANDSLDAKNCQIAEGEKKIQQLQHAEEMAVQESRNHLATIEQVKADLKATRASASADLTRVQEDLAGTSQDLE-------VTQAELGEAKRSMAELKV-------TVASLNEDLARYRTLQEESTNDIRRSSEQLKEQEAVLAYTRQQLSQTGGQL-EEAQREIQVLEQAVQSYKHKCGQAATQMGHLE---ETVATLQDKLAQSRGRELDQESSIEQLRSELDGLDRAYSDSKEQVARCEDMVSQLTQELEVGQKELSATHSHVAELEDTGRQLRDRIKEAQLEAKKADEKAQDLENKLMNYQTDHTHSNEEFMGLQDQVTNLQYQL-------EETRSQVESSQRSYDQVSSELNLVQADLDQTRQDKSTAFAEIEK--LEQTVQQLQLNLASAHQRHKSEACRLEEQATSLTRQLDQTQTSLHDSQCQVNDRDEQIKRGEAEIASCR-----EDIRSKVDQIDQLERASHDLKIEINQVIAHNKKLQDNINGLKTDLDTMKKDLTEARTQYKDCAQELAHHEEKLSLMEQSLQTTQDQLSQRVTEVVKHEQTTRKLQAELKSVKERAANYEEEIGEQKTMLDRTRKDLVSSKEECHAAVQEGLAYKQQMHKLELELHGAREQEKMLSDQVEQQEQILGQLQAELRAERERHGETVRQLSSSKKLGLDLQADLEAMQKQVRELQDRVKAREEQMMKLRREAEDFQQRLRENGEALAEREGQIRLLNMNLATANKQAKHHSQEIGKYEDTLSQLHSDQER-------LQEQNRKSSSDLMEADAKVHE-------LKVQLTTVQGNHKEAMDQLTEKSRQLATVKTE----AAKLSQQNNSMKEEIMYYDEKMRKLQQELRKTQEINKATEDE-LQHFEERYTSLQVDLVSSQEKQKHSLQELSAREEEMVVLKVELSSLQEKLKAASDESIKLISELELSRQNYRSANEEIANLRSALEESRANGDRLHQESEMVVHNVNTWVQEQKMANEKLGNKIREQSKAIMALTSEKEMLLEQVTKLQKSYSRTKMDLDKKQTEGEQLRAL-QSHSAHQQVILNQLKNRLEEHEVEQDEDLKTKEATIDDLHIRLKKNIESIHKLNQQLASLQKDNIRLRSELEREIATRQSLEMQLQSKDQLVESLQTQLDSSSYKRLLEKTEQYKDPEKLVRTAVNKLAEESGTTDPHSLDKAYWIQRVGELSIQLQQSSEYWSDKVRDLSTQL 2302          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. TrEMBL
Match: K1RFT6 (Polyamine-modulated factor 1-binding protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10023704 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.132e-38
Identity = 307/1353 (22.69%), Postives = 628/1353 (46.42%), Query Frame = 1
Query: 1888 NEKETSGRLTLENEQLMREVSGLKMKSSEMSEELDDKN-------HSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQS--TKASQA-QKEISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQIDT--KDG-KLQVNTDV-----------ILKLKEERNQIYKSLMDSKSS-------MESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIK----------QSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKI----DSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLY-----ARQAEEDISLSHKTIDEIHNEMELKLKECDIISR--RCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLS--------------KSESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFXXXXXXXXXXXXXXXMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCXXXXXXXXXXXXXXXXXXXXYSEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEFQYQNEQFITLK-------QKY-------EKMCSENSSIQLQLKESKELIKNLKH------ENGG--------IVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDK 5664
            N +E + R   +  Q+ RE+  +KM       ELD K        H++EE  ++     +    LE ++ ++ + L     ++E+L++S + +++ I +L+ + +  Q+   D + K+  RD  + KL++E  KLK K+ EK  E  K  +    L+    +S   +   ++  D  +RK+D +I+QL+    ++Q+QY  CY  LLK E   + IQ L+ D S   +A QA  +EI ++Q    ++E EL   + KHR CQ+E+  RD  I +++ ++   Q+       E  + ++E+ R   K  ++Q ++    +++E    K++E +    +L    +I+ Q+++N  +TI QLK D+ ++RS      NH Q I   Q ++IE + ++ Q  +   S  ++ +++ +S       ++A + +E++ + ++   +++  +  M+Q+++      E K+S   L++++   + Q+DT  +DG +L+ N +            I +L+E    + + L +S++        +ESL  D + + RMY E   +++K E  +  L +EL+  Q E+S   +R+   E  IK            ++ N  R       ++++   K  H+   Q++   E   + ++SL ++  +   EL+ K+  L + +D++ N+  V    +    +S ++E+D   + +++  L      ++     ++ Q +L  L+       AR A  +  LS +      NE E+K    DI ++    E  E N++    EVN L+      +N+               S L+ E E+L+S+L E   +  +   E   ++ K+  +E  L+ T+ +LS              K +++ KTL      Y +E+ E       Q  +I+K +        E++    E    K+            +++L G  E +++L  Q+E+ ++++T+LQ+E+  ER ++    R   + K++ ++  N+ E   +   DL   +KE +  L   + E+E    + R L E L +++ ++++ +  L+ A  +     + I++ E              + +G +Q  +D+ + Q     ++L   +     L++     +   ++   +        S  V+  +  +A   ++T+ + +E +++   +  +  + ++   I  K  D+ ++    +    Q + +  +++ RQ   E   + E+ + LK       +KY       +K+ S++  IQ     S E I++L++       NG         +V+N N+W+QEQK ANEKLG+KIREQ K I  L  +K
Sbjct:  698 NMQEANSRFEEKINQMERELDQMKMHLRTSQSELDTKRGIITNLEHNLEESKKRGAHQLDEINRLEDQVRELNIELTSVQSQVEKLQHSAHTKDELIHNLKKDVEGLQKQQKDTVSKVVVRDDTIQKLNNEIGKLKAKHHEKLGEVQKQGETIRKLQEALTKSHIELDASRKTTDEEVRKRDESIKQLQEDLMESQAQYSACYNELLKAE---DDIQCLKNDNSHMNQAGQASSQEIGQLQDQLHQIELELTISQEKHRTCQKEVANRDQVILKLQTDLDTTQEKYTGCVEELNIREDEVIRLNNKVKQLQQEIRDLNSQIEGDSQKINEDEKTIQKLQHDQEISLQEVKNHLRTIEQLKTDLQISRS------NHEQEIHRLQ-SDIEVLSKDLQTTKADLSDSQNTVMEQRS-------SIACMTDEIERMGKQ---QDNSTREMMRQSET--LAEQENKIS--DLKQQVIILEDQVDTSREDGQQLEANLNTYKQKYSQSMNEIGQLEESVKTLQERLTESRNKELEKEQRIESLKNDYENMDRMYNETKHEVQKCEDVVDQLTQELNASQEELSLSQNRVRECEENIKNLKDRINDLTAESLSNDQR---ARAYENELLTYKGEHSHTDQEYLERE---DKISSLEIEVEEVRNELQGKVRLLGDYQDQV-NDLKVELASVREQKNSAMKEIDRLEQSIQQLQLNLAGSHQRHKSDTSRLQDQLGTLEAGLHQSQARGAALEQELSRREEQVKSNEAEIKACRTDIANKAEEIEKLEANIKDLKLEVNHLQGAKQRADNQL--------------SELQNEAEHLKSDLSEARSQYKDCAQELAHHEEKLMLMEQSLNTTQDQLSQRVTEVVRHEQINRKLQAELKTLRERNTSYEEEIAE-------QKGIIDKLRKDLVGSKEEYHSAVQEGLAYKQR-------AHKTEVELKGAREQEQMLTEQVEQQDNILTQLQQELKAERDRHTDTGRHLQKAKKANHDLHNDIENYHKQVGDLATTIKEKDELLSGMRAELESLQQRQRALKEDLAEKEGQLRVAKMNLQTAQKQSQHHAQEITRYE--------------ETLGQMQNDLDKSQEQFRKTHAELLDNEQRVHDLKVQLTTVQGHHKESMDQLGEK----SRQVAALKTDLAKSQQQTSSLTDEIQAMEDKMRMMGGDCKKLQEI-NKAADDEMRAFEMKFQDMQQELMNTQDKGRQSLQELSAREEEIVVLKIELSNLQEKYKAKLNELDKIKSDHDFIQYNYHCSGEEIQSLRNALEESRSNGDRLHRESELVVQNVNTWVQEQKLANEKLGNKIREQSKAIMTLTSEK 1972          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. TrEMBL
Match: A0A0B7AS07 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF138313 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.491e-34
Identity = 319/1503 (21.22%), Postives = 683/1503 (45.44%), Query Frame = 1
Query: 2008 IEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSE----NFKLNKENE---SLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQS--TKASQAQK-EISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEK---------CSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKL-RIKESECQHWMQQTQ--SAHYLNDEVKLSLDSLEKEITFAKQQIDTKDGKLQVNTDVIL-KLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLE----------SEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEIHN--------EMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEF-QAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKSESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFXXXXXXXXXXXXXXXMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCXXXXXXXXXXXXXXXXXXXXYSEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEFQYQNE-------QFITLKQKYEKMCSENS---------------------SIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNIL-----------------------EKEKVRIIRQVHENGRTI-----SQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERILTLE---------------SSQNTEISKH----------------------ELTEWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 6111
            +EEL ++ ++    N  +E ++ ++ +A+     + E+LK     +ED I+ L  +++       + I K+  RD+ + KL+ E  + K K QEK  E      ++ K++E    L++   ++   + +L+++ +  + +K+  I+ ++    ++Q+Q+  CY  L+K EE  +   +L+ D S  +K +Q    EI+ +     ++E +L   + KHR CQ+E++ RD  I  ++ ++   QQ+      E  + + E+ R   K  ++Q ++    + +++ +++++E +    +L    ++A Q+++N  + I QL++D++  +++++    H Q  + S ++++E  ++E  L E K          ++    + + K+  +   +    +R + D++ E+   + E   Q  + QTQ  +A+   +++ +SL+S  ++      QI    G L+     +  KL E R++     +D ++++     + + + + Y E   ++ K E  I+ L +EL++ + E+S   + I  +E           +++  A+EN  +    +  ++ +   +S H+    +F   E ++    SL  Q A+  A++  K  T+    +++ +E N+ Q ++    ++ ++   E+++  LE++ Q  QLN      +H+ +  +   + A  +  L+  T   +HN        E +++  E +I S R E     +  +  E+ +LE  +  V+ +  QAY  ++ +     S L+ + E LR +L E   +  +   E   ++ K++ +E  L  T+ +LS+  +D   L  +      E+  ++ +  +  + I + KA   K   +    K+E     +  +    +   L+++L+G  E +K+L  Q+E+ E ++ +LQ E+  ER ++    R     K+   + +++ E L +  ++L+ ++   E  +   ++EV+    + R+L E L +R+ +++L    L+ A  +     + I++ E              D +  LQ   ++ + Q     S L +   +  +L++     +   ++   +        S  ++  +   A +S++ N + EE     + + KL+ EL +   I     DE ++   +     Q D ++ + + +Q   E   + E       +F +L+++Y+    E S                      +++ L+ES+     L  E+  +V N N+W+QEQK ANEKLG+KIREQ K I  L  +K +L                       E +K+R ++    + + I     S+ +     + ++ K K   IE+L  +++  I+ I  L +++  L+               + QN E+  H                      E  +   E  R  +   +K+   +         D  + DK YWI+RVGELS +LQQS EYWS+KV+++S  L
Sbjct:  811 VEELKDRNKKQVEDNNRMEDKVRELTIAITTQEAQCEKLKQMVTAKEDLIQKLHEDSESLSRQQKEAINKVLIRDENMQKLNVEIGRFKAKNQEKTKELMDLTIEIAKQSELIKKLQTTLSQNHHDLDELRRRSEQELLRKEETIKHIQEDLLESQTQHSACYNELVKIEEEFD---VLKADHSQLSKVNQVSSMEIASLHDQIHQLELDLTITQEKHRTCQKEVSSRDQVILRLQADLDTAQQNYSGSLEELKISEAELKRLSGKLKQLQQEIRENHDSIDSKDNQITEYEKKIQQLQHDEEMALQEIKNHLRNIEQLRLDLHNNKNSSAVEIAHIQEDLDSTRDDLEVTRRE--LAEYKRANTELNANIAELNDDLTRYKNLQD---ENANDIRRQGDLLKEQEDTLSEIRQQLSITQTQLEAANEDIEKLDMSLNSYRQKCNNLSTQI----GHLESTVATLQNKLAESRSR----ELDKEATIAQQRSELEGLDQAYSERKEEVAKCEDLIQQLTQELTSTKRELSVADNHIKDVEEGNRELGERIQDVQHQALENDEK---ANNFENMLLTYQSEHSHSDTEFAAKEDQI---ASLEYQLAEVLADVSGKKRTI----EQLKSELNLCQSELQQTHEDRNTAFMEIKK--LEQNIQQLQLNLATAHQRHKSETCRYDDQLATLESQLA-DTKARLHNSECESNSKEEQIRRNEAEIASCREE-----IHHKVDEIEKLERSMQGVKTDLKQAYSHNKQLE-GTISELKSDAEILRRDLTEARSQYKDCAQELAHHEEKLSLIEKSLLTTQDQLSQRVTDGVKLEQTIRKLQVELKSVKERAASYEEEIIEQKAMIDKLRKDLMAAKEEYHASVQEGIAYKQQAHKLELELSGTKEQEKMLNDQVEQQEHILGQLQTELRAERDRHGDTVRQLSASKKLGLDLQSDMETLQKQTRELQDRILAREDQIARLRREVDDLQIKNRELNEMLAEREGQLRLANMNLQTAQKQAKHHTQEIARYE--------------DTLAQLQTDQEKLQEQYRKSNSDLMEADVKIHELKVQLATVQGNHKESMEQLTEK----SRQLATTKTETAKLSQQNNSMKEEIIFYDEKLRKLQQELRKSQEINKATEDE-LQQFEEHYTGLQVDLVSSQERQKQGLQELSAKEEEIVLLKVEFTSLQERYKAANEETSKLVNELEMMKQNYRSANEEISGLRVALEESRANGDRLHRESELVVHNVNTWVQEQKMANEKLGNKIREQSKAIMVLTSEKEMLLEQITKLQKSYSKTKIELDEKANESDKLRALQSHSAHQQVILNQLKSRLEEHEVEQDEDMKTKEAAIEDLHLRLKSNIDSIHKLNQQLANLQKENVRLRSELDREVSTRQNFEMQVHGKDQLIENLRSQFESATFKRQFEKADIYKEPDRFAYTALNKAAEDTGV------TDAHSLDKSYWIQRVGELSIQLQQSSEYWSDKVRDLSTQL 2253          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. TrEMBL
Match: A0A0B7ARH7 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF138281 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 9.044e-34
Identity = 319/1503 (21.22%), Postives = 683/1503 (45.44%), Query Frame = 1
Query: 2008 IEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSE----NFKLNKENE---SLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQS--TKASQAQK-EISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEK---------CSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKL-RIKESECQHWMQQTQ--SAHYLNDEVKLSLDSLEKEITFAKQQIDTKDGKLQVNTDVIL-KLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLE----------SEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEIHN--------EMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEF-QAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKSESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFXXXXXXXXXXXXXXXMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCXXXXXXXXXXXXXXXXXXXXYSEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEFQYQNE-------QFITLKQKYEKMCSENS---------------------SIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNIL-----------------------EKEKVRIIRQVHENGRTI-----SQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERILTLE---------------SSQNTEISKH----------------------ELTEWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 6111
            +EEL ++ ++    N  +E ++ ++ +A+     + E+LK     +ED I+ L  +++       + I K+  RD+ + KL+ E  + K K QEK  E      ++ K++E    L++   ++   + +L+++ +  + +K+  I+ ++    ++Q+Q+  CY  L+K EE  +   +L+ D S  +K +Q    EI+ +     ++E +L   + KHR CQ+E++ RD  I  ++ ++   QQ+      E  + + E+ R   K  ++Q ++    + +++ +++++E +    +L    ++A Q+++N  + I QL++D++  +++++    H Q  + S ++++E  ++E  L E K          ++    + + K+  +   +    +R + D++ E+   + E   Q  + QTQ  +A+   +++ +SL+S  ++      QI    G L+     +  KL E R++     +D ++++     + + + + Y E   ++ K E  I+ L +EL++ + E+S   + I  +E           +++  A+EN  +    +  ++ +   +S H+    +F   E ++    SL  Q A+  A++  K  T+    +++ +E N+ Q ++    ++ ++   E+++  LE++ Q  QLN      +H+ +  +   + A  +  L+  T   +HN        E +++  E +I S R E     +  +  E+ +LE  +  V+ +  QAY  ++ +     S L+ + E LR +L E   +  +   E   ++ K++ +E  L  T+ +LS+  +D   L  +      E+  ++ +  +  + I + KA   K   +    K+E     +  +    +   L+++L+G  E +K+L  Q+E+ E ++ +LQ E+  ER ++    R     K+   + +++ E L +  ++L+ ++   E  +   ++EV+    + R+L E L +R+ +++L    L+ A  +     + I++ E              D +  LQ   ++ + Q     S L +   +  +L++     +   ++   +        S  ++  +   A +S++ N + EE     + + KL+ EL +   I     DE ++   +     Q D ++ + + +Q   E   + E       +F +L+++Y+    E S                      +++ L+ES+     L  E+  +V N N+W+QEQK ANEKLG+KIREQ K I  L  +K +L                       E +K+R ++    + + I     S+ +     + ++ K K   IE+L  +++  I+ I  L +++  L+               + QN E+  H                      E  +   E  R  +   +K+   +         D  + DK YWI+RVGELS +LQQS EYWS+KV+++S  L
Sbjct:  832 VEELKDRNKKQVEDNNRMEDKVRELTIAITTQEAQCEKLKQMVTAKEDLIQKLHEDSESLSRQQKEAINKVLIRDENMQKLNVEIGRFKAKNQEKTKELMDLTIEIAKQSELIKKLQTTLSQNHHDLDELRRRSEQELLRKEETIKHIQEDLLESQTQHSACYNELVKIEEEFD---VLKADHSQLSKVNQVSSMEIASLHDQIHQLELDLTITQEKHRTCQKEVSSRDQVILRLQADLDTAQQNYSGSLEELKISEAELKRLSGKLKQLQQEIRENHDSIDSKDNQITEYEKKIQQLQHDEEMALQEIKNHLRNIEQLRLDLHNNKNSSAVEIAHIQEDLDSTRDDLEVTRRE--LAEYKRANTELNANIAELNDDLTRYKNLQD---ENANDIRRQGDLLKEQEDTLSEIRQQLSITQTQLEAANEDIEKLDMSLNSYRQKCNNLSTQI----GHLESTVATLQNKLAESRSR----ELDKEATIAQQRSELEGLDQAYSERKEEVAKCEDLIQQLTQELTSTKRELSVADNHIKDVEEGNRELGERIQDVQHQALENDEK---ANNFENMLLTYQSEHSHSDTEFAAKEDQI---ASLEYQLAEVLADVSGKKRTI----EQLKSELNLCQSELQQTHEDRNTAFMEIKK--LEQNIQQLQLNLATAHQRHKSETCRYDDQLATLESQLA-DTKARLHNSECESNSKEEQIRRNEAEIASCREE-----IHHKVDEIEKLERSMQGVKTDLKQAYSHNKQLE-GTISELKSDAEILRRDLTEARSQYKDCAQELAHHEEKLSLIEKSLLTTQDQLSQRVTDGVKLEQTIRKLQVELKSVKERAASYEEEIIEQKAMIDKLRKDLMAAKEEYHASVQEGIAYKQQAHKLELELSGTKEQEKMLNDQVEQQEHILGQLQTELRAERDRHGDTVRQLSASKKLGLDLQSDMETLQKQTRELQDRILAREDQIARLRREVDDLQIKNRELNEMLAEREGQLRLANMNLQTAQKQAKHHTQEIARYE--------------DTLAQLQTDQEKLQEQYRKSNSDLMEADVKIHELKVQLATVQGNHKESMEQLTEK----SRQLATTKTETAKLSQQNNSMKEEIIFYDEKLRKLQQELRKSQEINKATEDE-LQQFEEHYTGLQVDLVSSQERQKQGLQELSAKEEEIVLLKVEFTSLQERYKAANEETSKLVNELEMMKQNYRSANEEISGLRVALEESRANGDRLHRESELVVHNVNTWVQEQKMANEKLGNKIREQSKAIMVLTSEKEMLLEQITKLQKSYSKTKIELDEKANESDKLRALQSHSAHQQVILNQLKSRLEEHEVEQDEDMKTKEAAIEDLHLRLKSNIDSIHKLNQQLANLQKENVRLRSELDREVSTRQNFEMQVHGKDQLIENLRSQFESATFKRQFEKADIYKEPDRFAYTALNKAAEDTGV------TDAHSLDKSYWIQRVGELSIQLQQSSEYWSDKVRDLSTQL 2274          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. TrEMBL
Match: A0A0B7ASP4 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF138303 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 9.156e-34
Identity = 319/1503 (21.22%), Postives = 683/1503 (45.44%), Query Frame = 1
Query: 2008 IEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSE----NFKLNKENE---SLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQS--TKASQAQK-EISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEK---------CSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKL-RIKESECQHWMQQTQ--SAHYLNDEVKLSLDSLEKEITFAKQQIDTKDGKLQVNTDVIL-KLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLE----------SEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEIHN--------EMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEF-QAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKSESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFXXXXXXXXXXXXXXXMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCXXXXXXXXXXXXXXXXXXXXYSEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEFQYQNE-------QFITLKQKYEKMCSENS---------------------SIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNIL-----------------------EKEKVRIIRQVHENGRTI-----SQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERILTLE---------------SSQNTEISKH----------------------ELTEWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 6111
            +EEL ++ ++    N  +E ++ ++ +A+     + E+LK     +ED I+ L  +++       + I K+  RD+ + KL+ E  + K K QEK  E      ++ K++E    L++   ++   + +L+++ +  + +K+  I+ ++    ++Q+Q+  CY  L+K EE  +   +L+ D S  +K +Q    EI+ +     ++E +L   + KHR CQ+E++ RD  I  ++ ++   QQ+      E  + + E+ R   K  ++Q ++    + +++ +++++E +    +L    ++A Q+++N  + I QL++D++  +++++    H Q  + S ++++E  ++E  L E K          ++    + + K+  +   +    +R + D++ E+   + E   Q  + QTQ  +A+   +++ +SL+S  ++      QI    G L+     +  KL E R++     +D ++++     + + + + Y E   ++ K E  I+ L +EL++ + E+S   + I  +E           +++  A+EN  +    +  ++ +   +S H+    +F   E ++    SL  Q A+  A++  K  T+    +++ +E N+ Q ++    ++ ++   E+++  LE++ Q  QLN      +H+ +  +   + A  +  L+  T   +HN        E +++  E +I S R E     +  +  E+ +LE  +  V+ +  QAY  ++ +     S L+ + E LR +L E   +  +   E   ++ K++ +E  L  T+ +LS+  +D   L  +      E+  ++ +  +  + I + KA   K   +    K+E     +  +    +   L+++L+G  E +K+L  Q+E+ E ++ +LQ E+  ER ++    R     K+   + +++ E L +  ++L+ ++   E  +   ++EV+    + R+L E L +R+ +++L    L+ A  +     + I++ E              D +  LQ   ++ + Q     S L +   +  +L++     +   ++   +        S  ++  +   A +S++ N + EE     + + KL+ EL +   I     DE ++   +     Q D ++ + + +Q   E   + E       +F +L+++Y+    E S                      +++ L+ES+     L  E+  +V N N+W+QEQK ANEKLG+KIREQ K I  L  +K +L                       E +K+R ++    + + I     S+ +     + ++ K K   IE+L  +++  I+ I  L +++  L+               + QN E+  H                      E  +   E  R  +   +K+   +         D  + DK YWI+RVGELS +LQQS EYWS+KV+++S  L
Sbjct:  768 VEELKDRNKKQVEDNNRMEDKVRELTIAITTQEAQCEKLKQMVTAKEDLIQKLHEDSESLSRQQKEAINKVLIRDENMQKLNVEIGRFKAKNQEKTKELMDLTIEIAKQSELIKKLQTTLSQNHHDLDELRRRSEQELLRKEETIKHIQEDLLESQTQHSACYNELVKIEEEFD---VLKADHSQLSKVNQVSSMEIASLHDQIHQLELDLTITQEKHRTCQKEVSSRDQVILRLQADLDTAQQNYSGSLEELKISEAELKRLSGKLKQLQQEIRENHDSIDSKDNQITEYEKKIQQLQHDEEMALQEIKNHLRNIEQLRLDLHNNKNSSAVEIAHIQEDLDSTRDDLEVTRRE--LAEYKRANTELNANIAELNDDLTRYKNLQD---ENANDIRRQGDLLKEQEDTLSEIRQQLSITQTQLEAANEDIEKLDMSLNSYRQKCNNLSTQI----GHLESTVATLQNKLAESRSR----ELDKEATIAQQRSELEGLDQAYSERKEEVAKCEDLIQQLTQELTSTKRELSVADNHIKDVEEGNRELGERIQDVQHQALENDEK---ANNFENMLLTYQSEHSHSDTEFAAKEDQI---ASLEYQLAEVLADVSGKKRTI----EQLKSELNLCQSELQQTHEDRNTAFMEIKK--LEQNIQQLQLNLATAHQRHKSETCRYDDQLATLESQLA-DTKARLHNSECESNSKEEQIRRNEAEIASCREE-----IHHKVDEIEKLERSMQGVKTDLKQAYSHNKQLE-GTISELKSDAEILRRDLTEARSQYKDCAQELAHHEEKLSLIEKSLLTTQDQLSQRVTDGVKLEQTIRKLQVELKSVKERAASYEEEIIEQKAMIDKLRKDLMAAKEEYHASVQEGIAYKQQAHKLELELSGTKEQEKMLNDQVEQQEHILGQLQTELRAERDRHGDTVRQLSASKKLGLDLQSDMETLQKQTRELQDRILAREDQIARLRREVDDLQIKNRELNEMLAEREGQLRLANMNLQTAQKQAKHHTQEIARYE--------------DTLAQLQTDQEKLQEQYRKSNSDLMEADVKIHELKVQLATVQGNHKESMEQLTEK----SRQLATTKTETAKLSQQNNSMKEEIIFYDEKLRKLQQELRKSQEINKATEDE-LQQFEEHYTGLQVDLVSSQERQKQGLQELSAKEEEIVLLKVEFTSLQERYKAANEETSKLVNELEMMKQNYRSANEEISGLRVALEESRANGDRLHRESELVVHNVNTWVQEQKMANEKLGNKIREQSKAIMVLTSEKEMLLEQITKLQKSYSKTKIELDEKANESDKLRALQSHSAHQQVILNQLKSRLEEHEVEQDEDMKTKEAAIEDLHLRLKSNIDSIHKLNQQLANLQKENVRLRSELDREVSTRQNFEMQVHGKDQLIENLRSQFESATFKRQFEKADIYKEPDRFAYTALNKAAEDTGV------TDAHSLDKSYWIQRVGELSIQLQQSSEYWSDKVRDLSTQL 2210          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Planmine SMEST
Match: SMESG000048877.1 (SMESG000048877.1)

HSP 1 Score: 3417.48 bits (8860), Expect = 0.000e+0
Identity = 1823/1842 (98.97%), Postives = 1829/1842 (99.29%), Query Frame = 1
Query:  586 VRQLQQKLVSVEGTAVRSNGECEAIRTELEKTRSQLEEVKQSSDRKNENLSTEVRRREEIIDQLRSELTQTARTVNRSSEVDNAVKEKNIQLEKTVXXXXXXXXXXXXXXXXXEDLIKKMQDETAQRGNAVTTIEDLEQEIDFIKEQLDNANQRNEALTETMLNSKKFYDEFKVNSDNAMKGHISTVDKIKQDYRELELKHKDCLSTMKQQGENTQRLVKEIADLTEKIRINDHNNSEQVKQIQMLKLESAESKSMIENFKLQLVDASMTETNLTKVLTTESQSRQSYIDQLSQETIHLNXXXXXXXXXXXXXXETIGKLNEQLIQIGSEKEINIQTIRNFEEKIYSMNFKEKQLDSDMKEKIHQIEILEIELTTLKDQHKSLLDEYRKINCDKADIERSIKRKDEKHKQELGXXXXXXXXXXXXXXXLTFISSNEKETSGRLTLENEQLMREVSGLKMKSSEMSEELDDKNHSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQIDTKDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEIHNEMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKSESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFXXXXXXXXXXXXXXXMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCXXXXXXXXXXXXXXXXXXXXYSEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEFQYQNEQFITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGRTISQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERILTLESSQNTEISKHELTEWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 6111
            VRQ+QQKL SVEGTAVRSNGECEAIRTELEKTRSQLEEVKQSSD KNENLSTEVRRREEIIDQLRSELTQTARTVNRSSEVDNAVKEKNIQLEKTVKQKEQQLQNLQKHNKELEDLIKKMQDETAQRGNAVTTIEDLEQEIDFIKEQLDNANQRNEALTETMLNSKKFYDEFKVNSDNAMKGHISTVDKIKQDYRELELKHKDCLSTMKQQGENTQRLVKEIADLTEKIRINDHNNSEQ KQIQMLKLESAESKSMIENFKLQLVDASMTETNLTKVLTTESQSRQSYIDQLSQETIHLNRIIDDLKDKIKIRDETIGKLNEQLIQIGSEKEINIQTIRNFEEKIYSMNFKEKQL+SDMKEKIHQIEILEIELTTLKDQHKSLLDEYRKINCDKADIERSIKRKDEKHKQELGEKEDEIISSKSEIEKLTFISSNEKETSGRLTLENEQLMREVSGLKMKSSEMSEELDDKNHSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQID KDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEI NEMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSK+ESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFNLLKDENKKDKK NLMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRK DFIGDLQ TIDE RNQISNLQSKLHQTQSEKSQLRIMCEKKEVEIEKLRREEERLERKY EVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEE+DNILLKNYDETVKNLTQRLLTYQNDEI VENQMRQMKNEFQYQNEQFITLKQKYEKMCSENSSIQLQLKESKELI+NLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKN LEKEKVRIIRQVHENGRTISQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERI+TLESSQNTEISKHEL EWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL
Sbjct:   59 VRQMQQKLASVEGTAVRSNGECEAIRTELEKTRSQLEEVKQSSDSKNENLSTEVRRREEIIDQLRSELTQTARTVNRSSEVDNAVKEKNIQLEKTVKQKEQQLQNLQKHNKELEDLIKKMQDETAQRGNAVTTIEDLEQEIDFIKEQLDNANQRNEALTETMLNSKKFYDEFKVNSDNAMKGHISTVDKIKQDYRELELKHKDCLSTMKQQGENTQRLVKEIADLTEKIRINDHNNSEQAKQIQMLKLESAESKSMIENFKLQLVDASMTETNLTKVLTTESQSRQSYIDQLSQETIHLNRIIDDLKDKIKIRDETIGKLNEQLIQIGSEKEINIQTIRNFEEKIYSMNFKEKQLNSDMKEKIHQIEILEIELTTLKDQHKSLLDEYRKINCDKADIERSIKRKDEKHKQELGEKEDEIISSKSEIEKLTFISSNEKETSGRLTLENEQLMREVSGLKMKSSEMSEELDDKNHSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQIDAKDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEIQNEMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKNESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFNLLKDENKKDKKFNLMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKSDFIGDLQTTIDEFRNQISNLQSKLHQTQSEKSQLRIMCEKKEVEIEKLRREEERLERKYCEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEEKDNILLKNYDETVKNLTQRLLTYQNDEIAVENQMRQMKNEFQYQNEQFITLKQKYEKMCSENSSIQLQLKESKELIENLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNNLEKEKVRIIRQVHENGRTISQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERIMTLESSQNTEISKHELREWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 1900          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Planmine SMEST
Match: SMESG000048877.1 (SMESG000048877.1)

HSP 1 Score: 3378.57 bits (8759), Expect = 0.000e+0
Identity = 1809/1842 (98.21%), Postives = 1815/1842 (98.53%), Query Frame = 1
Query:  586 VRQLQQKLVSVEGTAVRSNGECEAIRTELEKTRSQLEEVKQSSDRKNENLSTEVRRREEIIDQLRSELTQTARTVNRSSEVDNAVKEKNIQLEKTVXXXXXXXXXXXXXXXXXEDLIKKMQDETAQRGNAVTTIEDLEQEIDFIKEQLDNANQRNEALTETMLNSKKFYDEFKVNSDNAMKGHISTVDKIKQDYRELELKHKDCLSTMKQQGENTQRLVKEIADLTEKIRINDHNNSEQVKQIQMLKLESAESKSMIENFKLQLVDASMTETNLTKVLTTESQSRQSYIDQLSQETIHLNXXXXXXXXXXXXXXETIGKLNEQLIQIGSEKEINIQTIRNFEEKIYSMNFKEKQLDSDMKEKIHQIEILEIELTTLKDQHKSLLDEYRKINCDKADIERSIKRKDEKHKQELGXXXXXXXXXXXXXXXLTFISSNEKETSGRLTLENEQLMREVSGLKMKSSEMSEELDDKNHSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQIDTKDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEIHNEMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKSESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFXXXXXXXXXXXXXXXMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCXXXXXXXXXXXXXXXXXXXXYSEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEFQYQNEQFITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGRTISQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERILTLESSQNTEISKHELTEWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 6111
            VRQ+QQKL SVEGTAVRSNGECEAIRTELEKTRSQLEEVKQSSD KNENLSTEVRRREEIIDQLRSELTQTARTVNRSSEVDNAVKEKNIQLEKTVKQKEQQLQNLQKHNKELEDLIKKMQDETAQRGNAVTTIEDLEQEIDFIKEQLDNANQRNEALTETMLNSKKFYDEFKVNSDNAMKGHISTVDKIKQDYRELELKHKDCLSTMKQQGENTQRLVKEIADLTEKIRINDHNNSEQ KQIQMLKLESAESKSMIENFKLQLVDASMTETNLTKVLTTESQSRQSYIDQLSQETIHLNRIIDDLKDKIKIRDETIGKLNEQLIQIGSEKEINIQTIRNFEEKIYSMNFKEKQL+SDMKEKIHQIEILEIELTTLKDQHKSLLDEYRKINCDKADIERSIKRKDEKHKQELGEKEDEIISSKSEIEKLTFISSNEKETSGRLTLENEQLMREVSGLKMKSSEMSEELDDKNHSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQID KDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKE              LNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEI NEMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSK+ESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFNLLKDENKKDKK NLMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRK DFIGDLQ TIDE RNQISNLQSKLHQTQSEKSQLRIMCEKKEVEIEKLRREEERLERKY EVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEE+DNILLKNYDETVKNLTQRLLTYQNDEI VENQMRQMKNEFQYQNEQFITLKQKYEKMCSENSSIQLQLKESKELI+NLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKN LEKEKVRIIRQVHENGRTISQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERI+TLESSQNTEISKHEL EWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL
Sbjct:   59 VRQMQQKLASVEGTAVRSNGECEAIRTELEKTRSQLEEVKQSSDSKNENLSTEVRRREEIIDQLRSELTQTARTVNRSSEVDNAVKEKNIQLEKTVKQKEQQLQNLQKHNKELEDLIKKMQDETAQRGNAVTTIEDLEQEIDFIKEQLDNANQRNEALTETMLNSKKFYDEFKVNSDNAMKGHISTVDKIKQDYRELELKHKDCLSTMKQQGENTQRLVKEIADLTEKIRINDHNNSEQAKQIQMLKLESAESKSMIENFKLQLVDASMTETNLTKVLTTESQSRQSYIDQLSQETIHLNRIIDDLKDKIKIRDETIGKLNEQLIQIGSEKEINIQTIRNFEEKIYSMNFKEKQLNSDMKEKIHQIEILEIELTTLKDQHKSLLDEYRKINCDKADIERSIKRKDEKHKQELGEKEDEIISSKSEIEKLTFISSNEKETSGRLTLENEQLMREVSGLKMKSSEMSEELDDKNHSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQLKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKLKQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAIEQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEISRIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLMELQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDELHGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEIENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLRIKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQIDAKDGKLQVNTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKYEQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQSKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTNERDKIANEYNVSQGKIDSLIQELDSRNKE--------------LNDKQTKYQHELKKLKLYARQAEEDISLSHKTIDEIQNEMELKLKECDIISRRCESAEDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLRSELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKNESDYKTLNSSFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFNLLKDENKKDKKFNLMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKNELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVERCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSPSVTDTDRKSDFIGDLQTTIDEFRNQISNLQSKLHQTQSEKSQLRIMCEKKEVEIEKLRREEERLERKYCEVVSNREESVAVVSRKTNCIIEENESLHQTITKLRLELEEKDNILLKNYDETVKNLTQRLLTYQNDEIAVENQMRQMKNEFQYQNEQFITLKQKYEKMCSENSSIQLQLKESKELIENLKHENGGIVENFNSWIQEQKAANEKLGDKIREQHKTIQELKKDKNNLEKEKVRIIRQVHENGRTISQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERIMTLESSQNTEISKHELREWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKYWIKRVGELSEELQQSKEYWSNKVKEISNNL 1886          
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Planmine SMEST
Match: SMESG000048873.1 (SMESG000048873.1)

HSP 1 Score: 339.347 bits (869), Expect = 7.246e-107
Identity = 187/189 (98.94%), Postives = 188/189 (99.47%), Query Frame = 1
Query:   22 MDNKNALVNDVMSGDDERLXXXXXXXXXXXXXXXXXXXGILNTLLIESETVAKSLTNINSFQNLISEDKKYERKPWQSALSLKSKDNSNLMHNRRPTGTSGYGSGEAGLSFRSNSASLPQYNVQSFNDTSSLLQKLQNELTVRTTELHDKENEYFNLKASYENLRGQFDHVNTDMSTLRMQVLSKDKQV 588
            MDNKNALVNDVMSGDDERLSYRSSKSSDSDSTVISHDDGILNTLLIESETVAKSLTNINSFQNLISEDKKYERKPWQSALSLKSKDNSNLM NRRPTGTSGYGSGEAGLSFRSNSASLPQ+NVQSFNDTSSLLQKLQNELTVRTTELHDKENEYFNLKASYENLRGQFDHVNTDMSTLRMQVLSKDKQV
Sbjct:    1 MDNKNALVNDVMSGDDERLSYRSSKSSDSDSTVISHDDGILNTLLIESETVAKSLTNINSFQNLISEDKKYERKPWQSALSLKSKDNSNLMQNRRPTGTSGYGSGEAGLSFRSNSASLPQHNVQSFNDTSSLLQKLQNELTVRTTELHDKENEYFNLKASYENLRGQFDHVNTDMSTLRMQVLSKDKQV 189          
The following BLAST results are available for this feature:
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lama55.182e-919.37laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcun1d33.804e-937.76DCN1, defective in cullin neddylation 1, domain co... [more]
dcun1d33.851e-937.76DCN1, defective in cullin neddylation 1, domain co... [more]
dcun1d34.018e-937.76DCN1, defective in cullin neddylation 1, domain co... [more]
dcun1d34.040e-937.76DCN1, defective in cullin neddylation 1, domain co... [more]
dcun1d34.052e-937.76DCN1, defective in cullin neddylation 1, domain co... [more]
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433THS93.485e-4622.10Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1RFT61.132e-3822.69Polyamine-modulated factor 1-binding protein 1 OS=... [more]
A0A0B7AS078.491e-3421.22Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0B7ARH79.044e-3421.22Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0B7ASP49.156e-3421.22Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polyamine-modulated factor 1-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000048877.10.000e+098.97SMESG000048877.1[more]
SMESG000048877.10.000e+098.21SMESG000048877.1[more]
SMESG000048873.17.246e-10798.94SMESG000048873.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009277 ID=SMED30009277|Name=Polyamine-modulated factor 1-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=6286bp
CTGATATTTCAAATCAATTAAATGGATAATAAAAATGCTTTAGTAAATGA
TGTTATGAGTGGTGACGATGAGCGTCTTAGTTATAGGTCATCGAAAAGTT
CTGATAGTGACTCGACTGTCATCTCCCACGACGATGGAATTTTAAACACT
TTACTCATCGAAAGTGAAACTGTTGCAAAAAGTTTAACAAACATCAACTC
TTTTCAAAATCTCATTTCCGAAGATAAGAAATATGAAAGAAAACCTTGGC
AAAGTGCTTTATCGCTAAAATCAAAAGATAATTCAAATTTGATGCATAAT
CGTAGACCAACAGGCACATCTGGATATGGCAGTGGGGAGGCTGGGCTATC
ATTTCGCTCAAACAGCGCGAGTCTGCCGCAATATAATGTTCAATCCTTTA
ATGATACCTCCAGTCTTTTACAGAAATTACAAAATGAGTTGACTGTAAGA
ACTACGGAATTACATGACAAGGAAAATGAGTACTTTAATCTGAAAGCAAG
CTATGAAAACCTTAGAGGCCAATTTGACCATGTCAATACGGATATGTCAA
CTTTGCGAATGCAAGTATTATCAAAGGATAAACAAGTGAGGCAACTGCAA
CAAAAATTGGTCAGTGTGGAAGGAACGGCCGTCCGTTCGAATGGTGAATG
CGAGGCAATTCGGACAGAGTTGGAGAAGACTCGTTCTCAGCTAGAGGAGG
TCAAGCAGTCAAGTGACCGTAAAAATGAAAATTTGTCCACTGAAGTCAGG
CGACGAGAAGAAATAATTGACCAGCTCCGTTCTGAGTTGACGCAGACCGC
TCGAACAGTCAATCGGTCATCGGAAGTTGATAATGCAGTTAAAGAAAAAA
ATATTCAGTTGGAGAAAACAGTGAAACAAAAGGAACAACAACTTCAGAAT
TTGCAAAAACATAACAAAGAACTGGAAGACTTAATCAAAAAGATGCAAGA
TGAAACCGCACAGAGAGGAAACGCAGTAACAACAATCGAGGATCTTGAGC
AAGAAATCGACTTCATCAAAGAGCAACTTGACAATGCCAATCAAAGAAAT
GAGGCACTAACCGAAACAATGTTAAATTCCAAAAAGTTCTATGATGAATT
CAAAGTGAACTCAGATAATGCCATGAAGGGCCACATCAGTACTGTTGATA
AGATAAAGCAAGACTACAGGGAGCTAGAGCTGAAACACAAAGATTGTCTC
AGTACAATGAAGCAGCAAGGAGAAAACACTCAACGCCTAGTCAAAGAAAT
TGCAGATCTTACTGAAAAAATTAGAATAAACGACCATAACAATTCTGAAC
AAGTTAAACAAATCCAAATGCTGAAATTGGAAAGTGCAGAATCAAAGAGC
ATGATTGAAAACTTCAAGCTCCAGCTGGTGGATGCGTCCATGACCGAAAC
GAACTTAACCAAAGTCCTAACTACCGAAAGTCAATCTCGACAGAGCTACA
TTGACCAACTGTCACAGGAAACCATCCATTTGAATAGAATTATAGATGAT
CTTAAAGATAAAATCAAAATTCGGGATGAAACAATTGGAAAGCTTAACGA
ACAATTAATTCAAATTGGCAGTGAGAAAGAAATTAATATACAAACAATAC
GAAATTTTGAAGAAAAAATATATTCAATGAATTTCAAAGAAAAGCAATTG
GACAGTGATATGAAGGAAAAAATTCACCAAATAGAAATTCTTGAAATCGA
ACTAACAACTTTGAAAGATCAACATAAAAGTCTTTTGGACGAATATCGTA
AAATCAACTGCGACAAAGCGGACATTGAAAGATCAATAAAAAGAAAAGAC
GAAAAACATAAGCAAGAGCTTGGTGAAAAGGAAGATGAAATTATTTCATC
AAAATCGGAAATTGAGAAACTCACCTTTATCAGTTCAAATGAAAAGGAAA
CGAGCGGGCGATTGACACTAGAAAATGAGCAGTTAATGAGAGAAGTAAGC
GGACTGAAAATGAAATCGAGCGAGATGTCAGAGGAATTAGATGATAAAAA
TCATTCAATTGAAGAACTTACGGAGAAAGAACAAAGATTACAGAATCACA
ACCAATATTTGGAGACTGAACTATCTCAAGTGAAGTTGGCTCTTGATGAT
TCGAGTCAAGAACTGGAGCAATTGAAGTATTCCTGGAATCACCGAGAAGA
TACAATCGAATCTTTGAGACACGAAGCTAAGAAATACCAGGAAAATAATT
TGGATTTGATACAAAAAATTGAGCAGCGCGACCAATTGTTACATAAACTC
TCATCAGAAACGACAAAATTGAAACAGAAATACCAGGAGAAAAACTCGGA
AAATTTCAAGCTCAATAAAGAAAACGAATCACTGAAGTCAAATTTTAGAG
AATCTGAAAAGTCCGTGAAAGATTTACAGCAAAAATTTGATAACATGATT
AGGAAAAAGGATGCGGCGATCGAACAGTTAAAGGTCCAATCAACAGACAC
TCAAAGTCAATATAAACAGTGCTATGAAACGTTGCTGAAGAAGGAAGAAT
ATATTAATCGAATTCAGTTATTAGAGAAAGACCAATCAACCAAAGCCAGT
CAAGCTCAAAAGGAAATTAGTCGAATTCAATCTGACTATGATGAAATGGA
AGCAGAATTAAACGCCATTCGTGCTAAACATCGAGCTTGTCAAGAGGAAT
TAAATCAAAGAGATTTGCAGATCAACGAGATGAGAAATGAAATTCAAGTT
CAACAGCAAGATTTGATGGAGTTGCAGTCCGAAAGGATAGTTTGTCAAAA
TGAAATTGACAGATGGAGGGAGAAATTTTCTGAGATTCAAATGCAGCTCA
ATTCTCAGAAAAACGAAATGGAAAATCTGGAAGATAAAGTCAGTGAAAAG
GATCATTTGAATGATGAACTACACGGCAAGTTGCAGATAGCAAATCAGAA
AATGGAAAATCAAGAACAAACAATCAATCAGCTAAAAGTCGACATAAATC
TTGCCAGATCCACGAACAGCGAACGGAACAATCACTTCCAAACAATTATT
GGATCCCAGAAAAATGAAATAGAAAATATTAAACAAGAAAAACAACTAGT
TGAGGAGAAATGTTCAAAGTATAAATCCCAAATGGTCAAATGTAAATCAG
AACACGAAAGCTCTTTACAAACAGTCGCATCCTTGAGAAATGAGCTAGAT
ATGGTCAATGAGAAATTACGGATTAAAGAATCAGAATGCCAACATTGGAT
GCAACAGACACAAAGTGCTCACTATTTAAATGATGAAGTCAAATTATCAC
TGGACAGCTTGGAGAAAGAGATTACATTCGCAAAGCAGCAAATAGATACA
AAGGATGGCAAGTTGCAGGTGAATACCGATGTCATTTTAAAATTGAAAGA
AGAACGAAACCAAATTTATAAAAGTTTGATGGACAGCAAAAGTTCAATGG
AGTCTCTAAGCAAAGACCGCGACGAAATTGGAAGGATGTATGAAGAAAAT
AATGGAAAAATGAAAAAGTACGAACAGTGTATCAAAGATCTCAACGAAGA
ATTGTCGACAGTTCAAGTAGAGATGTCTGGCTATGTTAGTCGAATATCAA
TGCTAGAATCAGAAATCAAGCAGTCTGCAATGGAAAATAGCCATAGACAG
TCCATCATCAGTGAATTGCAGTCCAAAGTAGCCAAATTAAAGTCTAACCA
CAACATTTACAAACAGCAATTCAAAACCAGCGAAACTGAAGTGGAAAATC
TTAACAGTTTGCTTTTACAGCACGCAAAAAAATGTGCCGAACTTGAAAAC
AAATTATCTACATTGACAAATGAACGCGATAAAATTGCCAATGAATATAA
TGTGAGCCAAGGAAAGATTGATAGCCTAATTCAAGAGCTTGACTCTAGAA
ATAAGGAGGTAGAAAGATTTCATTTGGAAAGAGACTCTCAACTAAAACAA
CTAAATGATAAGCAAACAAAATATCAGCATGAATTGAAAAAGCTGAAATT
ATATGCAAGGCAAGCGGAGGAAGATATTTCTTTATCACACAAAACCATTG
ATGAGATCCATAATGAGATGGAGTTGAAACTAAAGGAATGTGATATCATA
TCAAGGAGGTGCGAATCAGCTGAAGACAATCTTGAAAGACGGAACAGAGA
GGTCAACCAATTGGAAATGAAGCTGTCAAGTGTCGAGAACGAGTTTCAAG
CATATCGAGTTCACAGAGACATCAATTTGGACAAGCATTCAAATCTCGAA
AAAGAGATCGAAAACTTACGGTCAGAATTGAAGGAGAAAAATCAGAAGCT
ATTCGAAATGACAAATGAATGCACGAAGTATCAAACAAAGGTTACCAGTT
TAGAAGATCAGCTTGATAAAACCGAAAAAAAACTTTCCAAAAGTGAATCG
GATTACAAAACATTAAACTCGTCCTTCATGGGATACAACAAAGAGGTAAC
AGAATTACGGAGCCAGCATTTGAACCAGTCTGATGTAATCGAGAAAACGA
AAGCGCAATATGGGAAGTTTTTCTCTGAATTTAATTTATTGAAGGACGAG
AACAAAAAGGACAAGAAATCTAATTTGATGCTGTCGGCGGAAATAGAAAA
TTTAAAGATCCAATTAAATGGACGAATCGAGCATCAGAAACTTCTACAAG
TCCAAATTGAAGAACACGAATCACTAATTACGGAACTCCAAAAAGAAATC
GTAAAAGAGCGAAAGAAGAACGAATTGAATCAACGATTGGAATTTGAAAA
GAAGCGATCAGTTTATAATAAAGAAAACGAAAGTGAAATATTATCTCAGA
TGAAACAAGATTTGGAAATTAAATTGAAAGAAGTCGAAAGAACGCTTTAC
TCTGAAAAGCAAGAAGTGGAGCGTTGTCATGGACAGATACGCAAGCTAAC
GGAGACGTTGATGGACAGAGATAACAAAATAAAATTATTTGAAAAACGAT
TGAAACTTGCTGATAGTGAAATTAATAGCCTAAGAGAAAATATATCAAAA
ATGGAAAGTATCAGTAGTCCAAGCGTGACGGATACAGATAGGAAATTAGA
CTTTATTGGGGACCTGCAAGCAACAATTGACGAATGTCGGAATCAAATCA
GTAATTTACAATCAAAACTCCATCAAACTCAATCAGAAAAAAGTCAACTT
AGAATTATGTGCGAGAAGAAGGAAGTGGAGATAGAAAAATTAAGACGTGA
GGAAGAGAGATTAGAAAGGAAATACTCTGAGGTTGTATCGAATAGAGAAG
AGTCAGTTGCTGTAGTAAGTCGTAAAACAAATTGCATAATAGAGGAAAAT
GAGTCGTTACATCAAACAATAACAAAGTTGAGATTGGAATTAGAAGAAAG
AGATAATATTCTATTGAAAAATTATGACGAAACAGTAAAAAACCTTACTC
AAAGATTATTAACATATCAAAACGATGAAATTACAGTAGAGAATCAAATG
AGACAGATGAAAAACGAGTTTCAATACCAGAATGAACAATTCATCACCTT
GAAGCAAAAGTATGAAAAAATGTGTTCCGAGAATTCCTCAATTCAGTTGC
AGTTGAAAGAATCGAAAGAGTTAATTAAAAACCTGAAGCATGAAAATGGA
GGAATTGTCGAAAATTTTAATTCTTGGATCCAAGAGCAAAAAGCAGCCAA
TGAAAAATTAGGAGATAAAATAAGAGAACAACATAAAACCATTCAAGAGT
TAAAAAAAGATAAAAATATTCTTGAGAAGGAAAAAGTGAGAATAATCCGT
CAAGTCCACGAGAATGGAAGGACGATATCACAGCCTGATTCTGCCAGCTC
ATGGGAGAGTGATGAATTTAAAGAAAAAAATGATGTTATTGAAAATTTGC
AATCAAAAATCAGAGATCAAATTAATGAAATTGTCAGTTTGAAAGAAAGA
ATTTTGACCTTAGAATCAAGCCAGAACACAGAAATTAGTAAGCATGAACT
GACAGAGTGGTCTCCCGAATCATATCGAAAAGGTCATTTGGGATTCTCTA
AATCATTGGCAGGGAGTTCATATTTACACTTAGTAAACGAAATGGACCAG
GATACTCATGATAAAAAGTACTGGATCAAAAGGGTCGGAGAACTATCTGA
AGAACTCCAACAAAGCAAAGAATATTGGTCAAACAAAGTGAAAGAAATTT
CGAACAATTTAGAATCGTCGACCATTACAGACGAAACCATAACCACCCCA
TCCTCCTAATCCCATTAAAATCCCCTTACCTTTGTTGCCTTAAATTATTC
TAGAGTTATTTTAGATGTTTATATACTAATTTTCGCTTTCAATCTATATT
TCTGATCTAATTTCGATGATCTGACTTCGTGTCCAA
back to top

protein sequence of SMED30009277-orf-1

>SMED30009277-orf-1 ID=SMED30009277-orf-1|Name=SMED30009277-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2046bp
MDNKNALVNDVMSGDDERLSYRSSKSSDSDSTVISHDDGILNTLLIESET
VAKSLTNINSFQNLISEDKKYERKPWQSALSLKSKDNSNLMHNRRPTGTS
GYGSGEAGLSFRSNSASLPQYNVQSFNDTSSLLQKLQNELTVRTTELHDK
ENEYFNLKASYENLRGQFDHVNTDMSTLRMQVLSKDKQVRQLQQKLVSVE
GTAVRSNGECEAIRTELEKTRSQLEEVKQSSDRKNENLSTEVRRREEIID
QLRSELTQTARTVNRSSEVDNAVKEKNIQLEKTVKQKEQQLQNLQKHNKE
LEDLIKKMQDETAQRGNAVTTIEDLEQEIDFIKEQLDNANQRNEALTETM
LNSKKFYDEFKVNSDNAMKGHISTVDKIKQDYRELELKHKDCLSTMKQQG
ENTQRLVKEIADLTEKIRINDHNNSEQVKQIQMLKLESAESKSMIENFKL
QLVDASMTETNLTKVLTTESQSRQSYIDQLSQETIHLNRIIDDLKDKIKI
RDETIGKLNEQLIQIGSEKEINIQTIRNFEEKIYSMNFKEKQLDSDMKEK
IHQIEILEIELTTLKDQHKSLLDEYRKINCDKADIERSIKRKDEKHKQEL
GEKEDEIISSKSEIEKLTFISSNEKETSGRLTLENEQLMREVSGLKMKSS
EMSEELDDKNHSIEELTEKEQRLQNHNQYLETELSQVKLALDDSSQELEQ
LKYSWNHREDTIESLRHEAKKYQENNLDLIQKIEQRDQLLHKLSSETTKL
KQKYQEKNSENFKLNKENESLKSNFRESEKSVKDLQQKFDNMIRKKDAAI
EQLKVQSTDTQSQYKQCYETLLKKEEYINRIQLLEKDQSTKASQAQKEIS
RIQSDYDEMEAELNAIRAKHRACQEELNQRDLQINEMRNEIQVQQQDLME
LQSERIVCQNEIDRWREKFSEIQMQLNSQKNEMENLEDKVSEKDHLNDEL
HGKLQIANQKMENQEQTINQLKVDINLARSTNSERNNHFQTIIGSQKNEI
ENIKQEKQLVEEKCSKYKSQMVKCKSEHESSLQTVASLRNELDMVNEKLR
IKESECQHWMQQTQSAHYLNDEVKLSLDSLEKEITFAKQQIDTKDGKLQV
NTDVILKLKEERNQIYKSLMDSKSSMESLSKDRDEIGRMYEENNGKMKKY
EQCIKDLNEELSTVQVEMSGYVSRISMLESEIKQSAMENSHRQSIISELQ
SKVAKLKSNHNIYKQQFKTSETEVENLNSLLLQHAKKCAELENKLSTLTN
ERDKIANEYNVSQGKIDSLIQELDSRNKEVERFHLERDSQLKQLNDKQTK
YQHELKKLKLYARQAEEDISLSHKTIDEIHNEMELKLKECDIISRRCESA
EDNLERRNREVNQLEMKLSSVENEFQAYRVHRDINLDKHSNLEKEIENLR
SELKEKNQKLFEMTNECTKYQTKVTSLEDQLDKTEKKLSKSESDYKTLNS
SFMGYNKEVTELRSQHLNQSDVIEKTKAQYGKFFSEFNLLKDENKKDKKS
NLMLSAEIENLKIQLNGRIEHQKLLQVQIEEHESLITELQKEIVKERKKN
ELNQRLEFEKKRSVYNKENESEILSQMKQDLEIKLKEVERTLYSEKQEVE
RCHGQIRKLTETLMDRDNKIKLFEKRLKLADSEINSLRENISKMESISSP
SVTDTDRKLDFIGDLQATIDECRNQISNLQSKLHQTQSEKSQLRIMCEKK
EVEIEKLRREEERLERKYSEVVSNREESVAVVSRKTNCIIEENESLHQTI
TKLRLELEERDNILLKNYDETVKNLTQRLLTYQNDEITVENQMRQMKNEF
QYQNEQFITLKQKYEKMCSENSSIQLQLKESKELIKNLKHENGGIVENFN
SWIQEQKAANEKLGDKIREQHKTIQELKKDKNILEKEKVRIIRQVHENGR
TISQPDSASSWESDEFKEKNDVIENLQSKIRDQINEIVSLKERILTLESS
QNTEISKHELTEWSPESYRKGHLGFSKSLAGSSYLHLVNEMDQDTHDKKY
WIKRVGELSEELQQSKEYWSNKVKEISNNLESSTITDETITTPSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1070..1097
NoneNo IPR availableCOILSCoilCoilcoord: 1291..1451
NoneNo IPR availableCOILSCoilCoilcoord: 993..1020
NoneNo IPR availableCOILSCoilCoilcoord: 1196..1216
NoneNo IPR availableCOILSCoilCoilcoord: 270..349
NoneNo IPR availableCOILSCoilCoilcoord: 712..732
NoneNo IPR availableCOILSCoilCoilcoord: 740..802
NoneNo IPR availableCOILSCoilCoilcoord: 1821..1841
NoneNo IPR availableCOILSCoilCoilcoord: 1620..1647
NoneNo IPR availableCOILSCoilCoilcoord: 1035..1055
NoneNo IPR availableCOILSCoilCoilcoord: 133..167
NoneNo IPR availableCOILSCoilCoilcoord: 210..255
NoneNo IPR availableCOILSCoilCoilcoord: 540..574
NoneNo IPR availableCOILSCoilCoilcoord: 1765..1799
NoneNo IPR availableCOILSCoilCoilcoord: 1224..1258
NoneNo IPR availableCOILSCoilCoilcoord: 1916..1950
NoneNo IPR availableCOILSCoilCoilcoord: 1571..1598
NoneNo IPR availableCOILSCoilCoilcoord: 1860..1894
NoneNo IPR availableCOILSCoilCoilcoord: 1140..1167
NoneNo IPR availableCOILSCoilCoilcoord: 1522..1549
NoneNo IPR availableCOILSCoilCoilcoord: 477..511
NoneNo IPR availableCOILSCoilCoilcoord: 396..416
NoneNo IPR availableCOILSCoilCoilcoord: 635..683
NoneNo IPR availableCOILSCoilCoilcoord: 1662..1717
NoneNo IPR availableCOILSCoilCoilcoord: 842..981
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 750..779
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..33
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 221..240
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 421..1228
coord: 1226..1555
coord: 1490..1959
coord: 125..451
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1157..1374
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 913..1167
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1326..1552