SMED30009268
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30009268 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 6
Alignments
SMED30009268 aligns in the following genomic locations:
Homology
BLAST of SMED30009268 vs. TrEMBL
Match: A0A1I8H6V5 (Dynein light chain OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g1 PE=3 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 2.836e-6 Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 3 Query: 111 VTILDGDMEEELYSEVVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIVFTFGK 338 +T++ DM EL ++++V++ L + + + IK DAK W V II G F +SH+PG S +F GK Sbjct: 87 ITVISSDMTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGK 162
BLAST of SMED30009268 vs. TrEMBL
Match: A0A267F2V4 (Dynein light chain (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g2 PE=3 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 3.223e-6 Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 3 Query: 111 VTILDGDMEEELYSEVVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIVFTFGK 338 +T++ DM EL ++++V++ L + + + IK DAK W V II G F +SH+PG S +F GK Sbjct: 91 ITVISSDMTLELQLRIIEIVRDGQRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGK 166
BLAST of SMED30009268 vs. TrEMBL
Match: A0A1I8GCD0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015343g1 PE=4 SV=1) HSP 1 Score: 52.7582 bits (125), Expect = 9.191e-6 Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 3 Query: 111 VTILDGDMEEELYSEVVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIVFTFGKGDTYICVKLEC 371 V + GDM E +VV+V K+ + + ++IK LD +S W V I +G F + H+PG S VF GK +I K C Sbjct: 85 VIYISGDMSLEWQIKVVEVTKQALRDSQKMSDVPKRIKTTLDRMYSQLWHVVIAQGQFWCYYGHEPGYSFVFQIGK-QVFIIFKTPC 170
BLAST of SMED30009268 vs. Planmine SMEST
Match: SMESG000065344.1 (SMESG000065344.1) HSP 1 Score: 192.971 bits (489), Expect = 3.351e-65 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 3 Query: 90 MNEEEFKVTILDGDMEEELYSEVVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIVFTFGKGDTYICVKLEC 371 MNEEEFKVTILDGDMEEELYSEVVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIVFTFGKGDTYICVKLEC Sbjct: 1 MNEEEFKVTILDGDMEEELYSEVVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIVFTFGKGDTYICVKLEC 94
BLAST of SMED30009268 vs. Planmine SMEST
Match: SMESG000006807.1 (SMESG000006807.1) HSP 1 Score: 43.8986 bits (102), Expect = 4.465e-6 Identity = 18/56 (32.14%), Postives = 32/56 (57.14%), Query Frame = 3 Query: 156 VVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIV 323 +++ ++K + E++K ALD + + W I+KG + A +SH+PG SIV Sbjct: 96 TANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIV 151
BLAST of SMED30009268 vs. Planmine SMEST
Match: SMESG000006807.1 (SMESG000006807.1) HSP 1 Score: 43.5134 bits (101), Expect = 5.039e-6 Identity = 18/56 (32.14%), Postives = 32/56 (57.14%), Query Frame = 3 Query: 156 VVKVVKECSDLEKNKGILKEKIKFALDAKFSPSWAVFIIKGNFNARFSHKPGMSIV 323 +++ ++K + E++K ALD + + W I+KG + A +SH+PG SIV Sbjct: 91 TANIIRRTQSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIV 146 The following BLAST results are available for this feature:
BLAST of SMED30009268 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30009268 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30009268 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 3
BLAST of SMED30009268 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30009268 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30009268 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 3
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30009268 ID=SMED30009268|Name=SMED30009268|organism=Schmidtea mediterranea sexual|type=transcript|length=385bpback to top protein sequence of SMED30009268-orf-1 >SMED30009268-orf-1 ID=SMED30009268-orf-1|Name=SMED30009268-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp LVDYQRTQNIEIINDQLILSYLNTILKVNMNEEEFKVTILDGDMEEELYSback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|