slc25a-6

Overview
Nameslc25a-6 (AKN21574.1)
Smed IDSMED30009256
Length (bp)1038
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-6 (SMED30009256) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-6 (SMED30009256) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-6 (SMED30009256) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-6 (SMED30009256) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009256

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009256h1SMcG0014394 SmedASXL_010147SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-6 vs. Ensembl Human
Match: SLC25A26 (solute carrier family 25 member 26 [Source:HGNC Symbol;Acc:HGNC:20661])

HSP 1 Score: 188.348 bits (477), Expect = 2.639e-57
Identity = 101/208 (48.56%), Postives = 144/208 (69.23%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            + ++ +G VAG+  D IL+P+DTIKTR+QS +   K+  +  +++G+P+    S PNAA FF++YE++K  L+  S+    P+   LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + E GI +GLYRGY + V REIPFS++QFP+WE LK     RQ++  + SWQSA+CG FAGG AA +TTPLDVAKTRI +A+ 
Sbjct:    7 VAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGSFPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHV-VDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLAKA 212          
BLAST of slc25a-6 vs. Ensembl Human
Match: SLC25A26 (solute carrier family 25 member 26 [Source:HGNC Symbol;Acc:HGNC:20661])

HSP 1 Score: 188.348 bits (477), Expect = 2.639e-57
Identity = 101/208 (48.56%), Postives = 144/208 (69.23%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            + ++ +G VAG+  D IL+P+DTIKTR+QS +   K+  +  +++G+P+    S PNAA FF++YE++K  L+  S+    P+   LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + E GI +GLYRGY + V REIPFS++QFP+WE LK     RQ++  + SWQSA+CG FAGG AA +TTPLDVAKTRI +A+ 
Sbjct:    7 VAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGSFPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHV-VDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLAKA 212          
BLAST of slc25a-6 vs. Ensembl Human
Match: SLC25A26 (solute carrier family 25 member 26 [Source:HGNC Symbol;Acc:HGNC:20661])

HSP 1 Score: 126.331 bits (316), Expect = 2.148e-34
Identity = 69/121 (57.02%), Postives = 89/121 (73.55%), Query Frame = 3
Query:  327 LAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + E GI +GLYRGY + V REIPFS++QFP+WE LK     RQ++  + SWQSA+CG FAGG AA +TTPLDVAKTRI +A+
Sbjct:    5 LAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDH-VVDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLAK 123          
BLAST of slc25a-6 vs. Ensembl Human
Match: SLC25A26 (solute carrier family 25 member 26 [Source:HGNC Symbol;Acc:HGNC:20661])

HSP 1 Score: 126.331 bits (316), Expect = 2.148e-34
Identity = 69/121 (57.02%), Postives = 89/121 (73.55%), Query Frame = 3
Query:  327 LAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + E GI +GLYRGY + V REIPFS++QFP+WE LK     RQ++  + SWQSA+CG FAGG AA +TTPLDVAKTRI +A+
Sbjct:    5 LAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDH-VVDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLAK 123          
BLAST of slc25a-6 vs. Ensembl Human
Match: SLC25A26 (solute carrier family 25 member 26 [Source:HGNC Symbol;Acc:HGNC:20661])

HSP 1 Score: 124.79 bits (312), Expect = 1.511e-33
Identity = 69/121 (57.02%), Postives = 89/121 (73.55%), Query Frame = 3
Query:  327 LAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + E GI +GLYRGY + V REIPFS++QFP+WE LK     RQ++  + SWQSA+CG FAGG AA +TTPLDVAKTRI +A+
Sbjct:    5 LAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHV-VDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLAK 123          
BLAST of slc25a-6 vs. Ensembl Celegans
Match: slc-25A26 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q18934])

HSP 1 Score: 171.014 bits (432), Expect = 5.520e-51
Identity = 88/201 (43.78%), Postives = 126/201 (62.69%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQ---STCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            +  GA AGL  D  LYP+DTIK+R+QS +  + +  +K+++ G+ +V+  SAP AA+FFL+Y++I     Q       ++ +++A+  EI+AC +R P E+ KQR Q     +L  +    +   GI RG YRGY + V REIPFSIIQFPIWE LK+ +  ++ +      + A CG  AG  AA LTTPLDVAKTRIM+
Sbjct:   12 LVCGATAGLAVDIGLYPLDTIKSRMQSKQGFIAAGGFKDIYRGMISVLVGSAPGAAIFFLTYKYINGQMKQVIEERNALVDAVSASLAEIAACAVRVPTELCKQRGQVNKNERLTLICKEIMETKGI-RGFYRGYGSTVAREIPFSIIQFPIWEALKRAVANKKESGRCSPLEGAACGSVAGFIAAGLTTPLDVAKTRIML 211          
BLAST of slc25a-6 vs. Ensembl Celegans
Match: slc-25A18.2 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q20847])

HSP 1 Score: 85.1149 bits (209), Expect = 1.335e-18
Identity = 60/223 (26.91%), Postives = 108/223 (48.43%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKS-------------------NLYKNLFSGIPTVIAASAPNAAVFFLSYEF-----IKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQR-SQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKS--WQSAICGFFAGGTAAVLTTPLDVAKTRI 677
            + +G ++G+V  S ++P+D +KTR+Q+ +   K                    N  K ++ G    I    P  A+  ++ +F     +K  + + + P      A+ G     +I  P E++K R  Q   K+K  ++  N ++++G  R LY+G    + R++ FS + FP++ +L   L  R+ ++   +  W S + G  AG TA++  TPLDV KTRI
Sbjct:   24 VLNGGISGIVGVSCVFPMDLVKTRLQNQKGTSKYTGIADCFKKSWQAGAPGRLNQIKGMYQGASVNIFLITPEKAIKLVANDFFRHALMKDHDERLSTPRGMIAGASAG-FCQVVITTPMELLKIRMQQSSDKVKATKLIWNLLTKDGGVRALYKGLGPTMARDVSFSAMYFPLFAYLD-GLGPRKKDDSGDAVFWASFVSGLTAGATASLSVTPLDVVKTRI 244          
BLAST of slc25a-6 vs. Ensembl Celegans
Match: K02F3.2 (Probable calcium-binding mitochondrial carrier K02F3.2 [Source:UniProtKB/Swiss-Prot;Acc:Q21153])

HSP 1 Score: 82.4185 bits (202), Expect = 4.764e-17
Identity = 67/220 (30.45%), Postives = 101/220 (45.91%), Query Frame = 3
Query:   99 GAVAGLVTDSILYPIDTIKTRIQSTRT---ILKSNLYKNLFSGIPTV----------------IAASAPNAAVFFLSYEFIK-KLNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY--QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLK-KNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            G+VAG    + +YPID +KTR+Q+ RT    +   +YKN       V                I   AP  A+     ++++ K       P+   + A G G +   +   P E++K R Q   +++    ++ + T+ +   F GLY+G      R+IPFS I FP + H K  +  E   N P   + SA   F AG  AA L TP DV KTR+ +A
Sbjct:  377 GSVAGACGATAVYPIDLVKTRMQNQRTSGSFVGEVMYKNSLDCFKKVVKFEGLLGLYRGLLPQIVGVAPEKAIKLTMNDYMRDKFTKDGKIPLYGEIIAGGTGGMCQVVFTNPLEIVKIRLQTAGEVQQAGKKIGVFTVLKELGFLGLYKGSRACFLRDIPFSAIYFPAYAHAKLASADEDGMNSPGTLFASA---FIAGVPAAGLVTPADVIKTRLQVA 593          
BLAST of slc25a-6 vs. Ensembl Celegans
Match: K02F3.2 (Probable calcium-binding mitochondrial carrier K02F3.2 [Source:UniProtKB/Swiss-Prot;Acc:Q21153])

HSP 1 Score: 82.4185 bits (202), Expect = 4.835e-17
Identity = 67/220 (30.45%), Postives = 101/220 (45.91%), Query Frame = 3
Query:   99 GAVAGLVTDSILYPIDTIKTRIQSTRT---ILKSNLYKNLFSGIPTV----------------IAASAPNAAVFFLSYEFIK-KLNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY--QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLK-KNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            G+VAG    + +YPID +KTR+Q+ RT    +   +YKN       V                I   AP  A+     ++++ K       P+   + A G G +   +   P E++K R Q   +++    ++ + T+ +   F GLY+G      R+IPFS I FP + H K  +  E   N P   + SA   F AG  AA L TP DV KTR+ +A
Sbjct:  385 GSVAGACGATAVYPIDLVKTRMQNQRTSGSFVGEVMYKNSLDCFKKVVKFEGLLGLYRGLLPQIVGVAPEKAIKLTMNDYMRDKFTKDGKIPLYGEIIAGGTGGMCQVVFTNPLEIVKIRLQTAGEVQQAGKKIGVFTVLKELGFLGLYKGSRACFLRDIPFSAIYFPAYAHAKLASADEDGMNSPGTLFASA---FIAGVPAAGLVTPADVIKTRLQVA 601          
BLAST of slc25a-6 vs. Ensembl Celegans
Match: slc-25A21 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:O62347])

HSP 1 Score: 80.4925 bits (197), Expect = 5.320e-17
Identity = 58/215 (26.98%), Postives = 96/215 (44.65%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQSTRT----------ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATG--GEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFR-------GLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRI 677
            IT+G  AGLV   ++YP+D +KTR+Q  +            LK+      + GI   I A  P  A  F ++E  K     S  P+  +++  G    ++  ++ CPFEV+K R Q      + +          I+R       GLYRG    + R   ++++ F ++   ++ + + + N           GF AG  A++   P DVAK+RI
Sbjct:   11 ITAGGSAGLVEVCLMYPLDVVKTRLQLGQQDKGMMDCVVKTLKNEGIGGFYKGILPPILAETPKRATKFFTFEQYKIAFTHSEIPLPVTMSFAGLFSGLTEAIVICPFEVVKVRLQADRNSSVKEQRSTASMAREIYRNEGFGTSGLYRGLGATLGRHGAWNMVYFGLYHSCREVIPDAKQNPTSNLIGRIALGFTAGSLASIFNIPFDVAKSRI 225          
BLAST of slc25a-6 vs. Ensembl Fly
Match: CG4743 (gene:FBgn0039357 transcript:FBtr0084933)

HSP 1 Score: 152.525 bits (384), Expect = 1.912e-43
Identity = 90/212 (42.45%), Postives = 125/212 (58.96%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYE----FIKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQ--DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQS-----AICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            ++ +G VAG+V D  L+PIDT+KTR+QS     ++  ++ ++ G+    A SAP AA+FF +YE    F+  +      P +   AA+  E+ ACLIR P E+ KQRSQ     K    Q+ +      G+ RGLYRG+ + + REIPFS+IQFP+WE+ K          PL  + S     A+CG  AGG +A LTTPLDV KTRIM+AE
Sbjct:   30 ALVAGGVAGMVVDIALFPIDTVKTRLQSELGFWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWT------PLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAE 235          
BLAST of slc25a-6 vs. Ensembl Fly
Match: aralar1 (gene:FBgn0028646 transcript:FBtr0085693)

HSP 1 Score: 82.4185 bits (202), Expect = 6.136e-17
Identity = 62/225 (27.56%), Postives = 101/225 (44.89%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRT------------------ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQ------DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQN-NEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T G+ AG V  +++YPID +KTR+Q+ R                   +++   +  L+ G+   +   AP  A+     + ++    + +   P    + A G    S  +   P E++K R Q         K++ + V    + E G+F GLY+G    + R++PFS I FP + H K  + ++   N PL        G  AG  AA L TP DV KTR+ +
Sbjct:  331 TLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSKIRAWSV----VRELGLF-GLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLL---AAGAIAGVPAASLVTPADVIKTRLQV 547          
BLAST of slc25a-6 vs. Ensembl Fly
Match: aralar1 (gene:FBgn0028646 transcript:FBtr0085694)

HSP 1 Score: 82.4185 bits (202), Expect = 6.439e-17
Identity = 62/225 (27.56%), Postives = 101/225 (44.89%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRT------------------ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQ------DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQN-NEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T G+ AG V  +++YPID +KTR+Q+ R                   +++   +  L+ G+   +   AP  A+     + ++    + +   P    + A G    S  +   P E++K R Q         K++ + V    + E G+F GLY+G    + R++PFS I FP + H K  + ++   N PL        G  AG  AA L TP DV KTR+ +
Sbjct:  334 TLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSKIRAWSV----VRELGLF-GLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLL---AAGAIAGVPAASLVTPADVIKTRLQV 550          
BLAST of slc25a-6 vs. Ensembl Fly
Match: aralar1 (gene:FBgn0028646 transcript:FBtr0085695)

HSP 1 Score: 82.4185 bits (202), Expect = 6.439e-17
Identity = 62/225 (27.56%), Postives = 101/225 (44.89%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRT------------------ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQ------DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQN-NEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T G+ AG V  +++YPID +KTR+Q+ R                   +++   +  L+ G+   +   AP  A+     + ++    + +   P    + A G    S  +   P E++K R Q         K++ + V    + E G+F GLY+G    + R++PFS I FP + H K  + ++   N PL        G  AG  AA L TP DV KTR+ +
Sbjct:  334 TLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSKIRAWSV----VRELGLF-GLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLL---AAGAIAGVPAASLVTPADVIKTRLQV 550          
BLAST of slc25a-6 vs. Ensembl Fly
Match: aralar1 (gene:FBgn0028646 transcript:FBtr0330290)

HSP 1 Score: 82.4185 bits (202), Expect = 6.742e-17
Identity = 62/225 (27.56%), Postives = 101/225 (44.89%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRT------------------ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQ------DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQN-NEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T G+ AG V  +++YPID +KTR+Q+ R                   +++   +  L+ G+   +   AP  A+     + ++    + +   P    + A G    S  +   P E++K R Q         K++ + V    + E G+F GLY+G    + R++PFS I FP + H K  + ++   N PL        G  AG  AA L TP DV KTR+ +
Sbjct:  334 TLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSKIRAWSV----VRELGLF-GLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLL---AAGAIAGVPAASLVTPADVIKTRLQV 550          
BLAST of slc25a-6 vs. Ensembl Zebrafish
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:560478])

HSP 1 Score: 211.46 bits (537), Expect = 1.480e-66
Identity = 102/206 (49.51%), Postives = 140/206 (67.96%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST----CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K + +  T     P+   LAA+ GEI ACLIR P EV+KQR+Q  P +  Y+V +N++ E G FRGLYRGY + V REIPFS++QFP+WE+LK     RQ    L SWQ+A+CG  AGG AA +TTPLDVAKT IM+A+ 
Sbjct:    9 SLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSFPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPSISTYRVLLNSLQEEG-FRGLYRGYGSTVLREIPFSLVQFPLWEYLKAVWWRRQGGR-LDSWQAAVCGALAGGVAAFVTTPLDVAKTWIMLAKA 212          
BLAST of slc25a-6 vs. Ensembl Zebrafish
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:560478])

HSP 1 Score: 162.925 bits (411), Expect = 7.247e-49
Identity = 76/159 (47.80%), Postives = 109/159 (68.55%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST----CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLK 551
            S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K + +  T     P+   LAA+ GEI ACLIR P EV+KQR+Q  P +  Y+V +N++ E G FRGLYRGY + V REIPFS++QFP+WE+LK
Sbjct:    9 SLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSFPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPSISTYRVLLNSLQEEG-FRGLYRGYGSTVLREIPFSLVQFPLWEYLK 166          
BLAST of slc25a-6 vs. Ensembl Zebrafish
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:560478])

HSP 1 Score: 162.925 bits (411), Expect = 7.247e-49
Identity = 76/159 (47.80%), Postives = 109/159 (68.55%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST----CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLK 551
            S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K + +  T     P+   LAA+ GEI ACLIR P EV+KQR+Q  P +  Y+V +N++ E G FRGLYRGY + V REIPFS++QFP+WE+LK
Sbjct:    9 SLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSFPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPSISTYRVLLNSLQEEG-FRGLYRGYGSTVLREIPFSLVQFPLWEYLK 166          
BLAST of slc25a-6 vs. Ensembl Zebrafish
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:560478])

HSP 1 Score: 162.925 bits (411), Expect = 7.247e-49
Identity = 76/159 (47.80%), Postives = 109/159 (68.55%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST----CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLK 551
            S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K + +  T     P+   LAA+ GEI ACLIR P EV+KQR+Q  P +  Y+V +N++ E G FRGLYRGY + V REIPFS++QFP+WE+LK
Sbjct:    9 SLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSFPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPSISTYRVLLNSLQEEG-FRGLYRGYGSTVLREIPFSLVQFPLWEYLK 166          
BLAST of slc25a-6 vs. Ensembl Zebrafish
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:560478])

HSP 1 Score: 146.747 bits (369), Expect = 7.443e-42
Identity = 80/206 (38.83%), Postives = 116/206 (56.31%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST----CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K + +  T     P+   LAA+ GEI ACLIR P EV+KQR+Q  P +  Y+V +N++ E    R ++                    W         R+    L SWQ+A+CG  AGG AA +TTPLDVAKT IM+A+ 
Sbjct:    9 SLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSFPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPSISTYRVLLNSLQEE--VRAVW--------------------W---------RRQGGRLDSWQAAVCGALAGGVAAFVTTPLDVAKTWIMLAKA 183          
BLAST of slc25a-6 vs. Ensembl Xenopus
Match: slc25a26 (solute carrier family 25 (S-adenosylmethionine carrier), member 26 [Source:NCBI gene;Acc:448074])

HSP 1 Score: 193.356 bits (490), Expect = 2.384e-59
Identity = 104/205 (50.73%), Postives = 140/205 (68.29%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST---CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            S+ +G  AG+  D IL+P+DTIKTR+QS     KS  ++ +++G+P+    S PNAA FF++YE  K+L +  +    P+I   AA+ GE+ ACLIR P EVIKQR+Q  P    YQ+   T+ + GI +GLYRGY + V REIPFS++QFP+WE L K+L   +    + SWQSA+CG FAGG AA LTTPLDVAKTRIM+A+ 
Sbjct:    9 SLLAGGTAGMCVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGSFPNAAAFFVTYESAKQLLHSDSSYLSPIIHMAAASLGEVVACLIRVPSEVIKQRAQVSPSSTTYQMLSATLRQEGI-KGLYRGYKSTVLREIPFSLVQFPLWESL-KDLWSWKQGRAVDSWQSAVCGAFAGGFAAALTTPLDVAKTRIMLAKA 211          
BLAST of slc25a-6 vs. Ensembl Xenopus
Match: slc25a26 (solute carrier family 25 (S-adenosylmethionine carrier), member 26 [Source:NCBI gene;Acc:448074])

HSP 1 Score: 153.295 bits (386), Expect = 5.514e-44
Identity = 93/200 (46.50%), Postives = 126/200 (63.00%), Query Frame = 3
Query:  114 LVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST---CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFRE----IPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            +  D IL+P+DTIKTR+QS     KS  ++ +++G+P+    S PNAA FF++YE  K+L +  +    P+I   AA+ GE+ ACLIR P EVIKQR+Q  P    YQ+   T+ + GI +GLYRGY + V RE    I FS    P+     ++L   +    + SWQSA+CG FAGG AA LTTPLDVAKTRIM+A+ 
Sbjct:    1 MCVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGSFPNAAAFFVTYESAKQLLHSDSSYLSPIIHMAAASLGEVVACLIRVPSEVIKQRAQVSPSSTTYQMLSATLRQEGI-KGLYRGYKSTVLRENYSHIIFSSNYVPL---CLQDLWSWKQGRAVDSWQSAVCGAFAGGFAAALTTPLDVAKTRIMLAKA 196          
BLAST of slc25a-6 vs. Ensembl Xenopus
Match: tusc2 (tumor suppressor 2, mitochondrial calcium regulator [Source:Xenbase;Acc:XB-GENE-1217571])

HSP 1 Score: 91.2781 bits (225), Expect = 1.265e-19
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNL-YKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            T G++AG V  + +YPID +KTR+Q+ R+     L YKN                L+ G+   +   AP  A+     +F++        + P++  + A G    S  +   P E++K R Q   ++    +V+  T+ ++    GLY+G      R+IPFS I FP++ H K  L + Q +  + + Q    G  AG  AA L TP DV KTR+ +A
Sbjct:  323 TLGSIAGAVGATAVYPIDLVKTRMQNQRSSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLVGVAPEKAIKLTVNDFVRDKFTQKDGSIPLLAEIMAGGCAGGSQVIFTNPLEIVKIRLQVAGEISTGPKVSALTVLQDLGILGLYKGAKACFLRDIPFSAIYFPVYAHCKTLLADEQGH--IGALQLLTAGAIAGVPAASLVTPADVIKTRLQVA 539          
BLAST of slc25a-6 vs. Ensembl Xenopus
Match: tusc2 (tumor suppressor 2, mitochondrial calcium regulator [Source:Xenbase;Acc:XB-GENE-1217571])

HSP 1 Score: 91.2781 bits (225), Expect = 1.417e-19
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNL-YKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            T G++AG V  + +YPID +KTR+Q+ R+     L YKN                L+ G+   +   AP  A+     +F++        + P++  + A G    S  +   P E++K R Q   ++    +V+  T+ ++    GLY+G      R+IPFS I FP++ H K  L + Q +  + + Q    G  AG  AA L TP DV KTR+ +A
Sbjct:  330 TLGSIAGAVGATAVYPIDLVKTRMQNQRSSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLVGVAPEKAIKLTVNDFVRDKFTQKDGSIPLLAEIMAGGCAGGSQVIFTNPLEIVKIRLQVAGEISTGPKVSALTVLQDLGILGLYKGAKACFLRDIPFSAIYFPVYAHCKTLLADEQGH--IGALQLLTAGAIAGVPAASLVTPADVIKTRLQVA 546          
BLAST of slc25a-6 vs. Ensembl Xenopus
Match: tusc2 (tumor suppressor 2, mitochondrial calcium regulator [Source:Xenbase;Acc:XB-GENE-1217571])

HSP 1 Score: 91.2781 bits (225), Expect = 1.421e-19
Identity = 66/219 (30.14%), Postives = 105/219 (47.95%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNL-YKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            T G++AG V  + +YPID +KTR+Q+ R+     L YKN                L+ G+   +   AP  A+     +F++        + P++  + A G    S  +   P E++K R Q   ++    +V+  T+ ++    GLY+G      R+IPFS I FP++ H K  L + Q +  + + Q    G  AG  AA L TP DV KTR+ +A
Sbjct:  323 TLGSIAGAVGATAVYPIDLVKTRMQNQRSSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLVGVAPEKAIKLTVNDFVRDKFTQKDGSIPLLAEIMAGGCAGGSQVIFTNPLEIVKIRLQVAGEISTGPKVSALTVLQDLGILGLYKGAKACFLRDIPFSAIYFPVYAHCKTLLADEQGH--IGALQLLTAGAIAGVPAASLVTPADVIKTRLQVA 539          
BLAST of slc25a-6 vs. Ensembl Mouse
Match: Slc25a26 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 [Source:MGI Symbol;Acc:MGI:1914832])

HSP 1 Score: 194.512 bits (493), Expect = 7.533e-60
Identity = 106/205 (51.71%), Postives = 144/205 (70.24%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            S+ +G VAG+  D IL+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FFL+YE++K  L+  ST    PV   LAA+ GE+ ACLIR P EV+KQR+Q     K  Q+ +  +SE GI +GLYRGY + V REIPFS++QFP+WE LK     R+ +  + SWQSA+CG FAGG AA +TTPLDVAKTRIM+A+
Sbjct:    9 SLVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFRGIYAGVPSAAVGSFPNAAAFFLTYEYVKSLLHTDSTSHFKPVKHMLAASTGEVVACLIRVPSEVVKQRAQVSASSKTLQIFLTILSEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWAWRRGHV-VDSWQSAVCGAFAGGFAAAVTTPLDVAKTRIMLAK 211          
BLAST of slc25a-6 vs. Ensembl Mouse
Match: Slc25a26 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 [Source:MGI Symbol;Acc:MGI:1914832])

HSP 1 Score: 113.235 bits (282), Expect = 4.294e-30
Identity = 67/176 (38.07%), Postives = 97/176 (55.11%), Query Frame = 3
Query:  162 IQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKL-NNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRI 677
            +QS +   K+  ++ +++G+P+    S PNAA FFL+YE++K L +  ST    PV   LAA+ GE+ ACLIR P EV+KQR+Q     K  Q+ +  +SE GI +GLYRGY + V RE         +W   + ++        + SWQSA+CG FA         PLD  K  +
Sbjct:    2 LQSPQGFNKAGGFRGIYAGVPSAAVGSFPNAAAFFLTYEYVKSLLHTDSTSHFKPVKHMLAASTGEVVACLIRVPSEVVKQRAQVSASSKTLQIFLTILSEEGI-QGLYRGYKSTVLRE--------ALWAWRRGHV--------VDSWQSAVCGAFAASLG-----PLDYLKDNL 155          
BLAST of slc25a-6 vs. Ensembl Mouse
Match: Slc25a26 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26 [Source:MGI Symbol;Acc:MGI:1914832])

HSP 1 Score: 82.0333 bits (201), Expect = 8.607e-19
Identity = 42/99 (42.42%), Postives = 64/99 (64.65%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGE-ISACLIR 368
            S+ +G VAG+  D IL+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FFL+YE++K  L+  ST    PV   LAA+ GE +  C + 
Sbjct:    9 SLVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFRGIYAGVPSAAVGSFPNAAAFFLTYEYVKSLLHTDSTSHFKPVKHMLAASTGEVVHGCFVS 107          
BLAST of slc25a-6 vs. Ensembl Mouse
Match: Slc25a12 (solute carrier family 25 (mitochondrial carrier, Aralar), member 12 [Source:MGI Symbol;Acc:MGI:1926080])

HSP 1 Score: 85.5001 bits (210), Expect = 8.988e-18
Identity = 68/234 (29.06%), Postives = 106/234 (45.30%), Query Frame = 3
Query:   69 VATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTR---TILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQ------DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            +A      T G+VAG V  + +YPID +KTR+Q+ R   +++   +YKN                L+ G+   +   AP  A+     +F++        + P+   + A G    S  +   P E++K R Q        P++      +N + + G+F GLY+G      R+IPFS I FP++ H K  L +   N  +        G  AG  AA L TP DV KTR+ +A
Sbjct:  323 IAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGTGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTKRDGSIPLPAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVS----ALNVLQDLGLF-GLYKGAKACFLRDIPFSAIYFPVYAHCKLLLADE--NGRVGGINLLTAGALAGVPAASLVTPADVIKTRLQVA 549          
BLAST of slc25a-6 vs. Ensembl Mouse
Match: Slc25a13 (solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 13 [Source:MGI Symbol;Acc:MGI:1354721])

HSP 1 Score: 83.1889 bits (204), Expect = 5.543e-17
Identity = 61/219 (27.85%), Postives = 103/219 (47.03%), Query Frame = 3
Query:   99 GAVAGLVTDSILYPIDTIKTRIQ---STRTILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            G++AG V  + +YPID +KTR+Q   ST + +   +YKN                L+ G+   +   AP  A+     +F++   ++   + P++  + A G    S  +   P E++K R Q   ++    +V+  ++  +  F G+Y+G      R+IPFS I FP + H+K +         +      + G  AG  AA L TP DV KTR+ +A
Sbjct:  336 GSIAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQ--VSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVA 552          
BLAST of slc25a-6 vs. UniProt/SwissProt
Match: sp|Q4V9P0|SAMC_DANRE (S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio OX=7955 GN=slc25a26 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.117e-65
Identity = 102/206 (49.51%), Postives = 140/206 (67.96%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST----CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K + +  T     P+   LAA+ GEI ACLIR P EV+KQR+Q  P +  Y+V +N++ E G FRGLYRGY + V REIPFS++QFP+WE+LK     RQ    L SWQ+A+CG  AGG AA +TTPLDVAKT IM+A+ 
Sbjct:    9 SLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSFPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPSISTYRVLLNSLQEEG-FRGLYRGYGSTVLREIPFSLVQFPLWEYLKAVWWRRQGGR-LDSWQAAVCGALAGGVAAFVTTPLDVAKTWIMLAKA 212          
BLAST of slc25a-6 vs. UniProt/SwissProt
Match: sp|Q5U680|SAMC_MOUSE (S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus OX=10090 GN=Slc25a26 PE=1 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 5.269e-59
Identity = 106/205 (51.71%), Postives = 144/205 (70.24%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            S+ +G VAG+  D IL+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FFL+YE++K  L+  ST    PV   LAA+ GE+ ACLIR P EV+KQR+Q     K  Q+ +  +SE GI +GLYRGY + V REIPFS++QFP+WE LK     R+ +  + SWQSA+CG FAGG AA +TTPLDVAKTRIM+A+
Sbjct:    9 SLVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFRGIYAGVPSAAVGSFPNAAAFFLTYEYVKSLLHTDSTSHFKPVKHMLAASTGEVVACLIRVPSEVVKQRAQVSASSKTLQIFLTILSEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWAWRRGHV-VDSWQSAVCGAFAGGFAAAVTTPLDVAKTRIMLAK 211          
BLAST of slc25a-6 vs. UniProt/SwissProt
Match: sp|Q6GLA2|SAMC_XENTR (S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis OX=8364 GN=slc25a26 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.600e-58
Identity = 104/205 (50.73%), Postives = 140/205 (68.29%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKL---NNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            S+ +G  AG+  D IL+P+DTIKTR+QS     KS  ++ +++G+P+    S PNAA FF++YE  K+L   ++    P+I   AA+ GE+ ACLIR P EVIKQR+Q  P    YQ+   T+ + GI +GLYRGY + V REIPFS++QFP+WE L K+L   +    + SWQSA+CG FAGG AA LTTPLDVAKTRIM+A+ 
Sbjct:    9 SLLAGGTAGMCVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGSFPNAAAFFVTYESAKQLLRSDSSYLSPIIHMAAASLGEVVACLIRVPSEVIKQRAQVSPSSTTYQMLSATLRQEGI-KGLYRGYKSTVLREIPFSLVQFPLWESL-KDLWSWKQGRAVDSWQSAVCGAFAGGFAAALTTPLDVAKTRIMLAKA 211          
BLAST of slc25a-6 vs. UniProt/SwissProt
Match: sp|Q641C8|SAMC_XENLA (S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis OX=8355 GN=slc25a26 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.217e-56
Identity = 105/205 (51.22%), Postives = 139/205 (67.80%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQST--CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            S+ +G  AG+  D IL+P+DTIKTR+QS     KS  ++ +++G+P+    S PNAA FF++YE  K+ L + S+   P+I   AA  GE+ ACLIR P EVIKQR+Q  P    YQ+   T+ E GI +GLYRGY + V REIPFS++QFP+WE L KNL   +    +  WQSA+CG FAGG AA +TTPLDVAKTRIM+A+ 
Sbjct:    9 SLLAGGAAGMSVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGSFPNAAAFFVTYESAKRFLGSDSSYLSPIIHMAAAFLGELVACLIRVPSEVIKQRAQVSPSSTTYQMLSVTLREEGI-KGLYRGYKSTVLREIPFSLVQFPLWEFL-KNLWSWKQGRAVDCWQSAVCGAFAGGFAAAVTTPLDVAKTRIMLAKA 211          
BLAST of slc25a-6 vs. UniProt/SwissProt
Match: sp|Q70HW3|SAMC_HUMAN (S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens OX=9606 GN=SLC25A26 PE=1 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 1.267e-56
Identity = 101/208 (48.56%), Postives = 144/208 (69.23%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            + ++ +G VAG+  D IL+P+DTIKTR+QS +   K+  +  +++G+P+    S PNAA FF++YE++K  L+  S+    P+   LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + E GI +GLYRGY + V REIPFS++QFP+WE LK     RQ++  + SWQSA+CG FAGG AA +TTPLDVAKTRI +A+ 
Sbjct:    7 VAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGSFPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGI-QGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHV-VDSWQSAVCGAFAGGFAAAVTTPLDVAKTRITLAKA 212          
BLAST of slc25a-6 vs. TrEMBL
Match: A0A0H3YJB7 (Slc25a-6 OS=Schmidtea mediterranea OX=79327 GN=slc25a-6 PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.078e-146
Identity = 207/208 (99.52%), Postives = 207/208 (99.52%), Query Frame = 3
Query:   66 MVATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            MVATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGI RGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE
Sbjct:    1 MVATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGILRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 208          
BLAST of slc25a-6 vs. TrEMBL
Match: A0A5N5L2N5 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00111950 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.310e-64
Identity = 104/208 (50.00%), Postives = 141/208 (67.79%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLN----NQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            I S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K L     +    PV   LAA+ GEI ACLIR P EV+KQR+Q  P L  + V + T+ E G+ RGLYRG+ + V REIPFS++QFP+WE+L K L  R+  E L SWQ+A+CG  AGG AA +TTPLDVAKTRIM+A+ 
Sbjct:    7 IASLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAVGSFPNAAAFFVTYESTKSLLSGCFSARMAPVTHMLAASLGEIVACLIRVPTEVVKQRTQASPSLHTHHVLLATLREEGV-RGLYRGFGSTVLREIPFSLVQFPLWEYL-KTLWRRRQGERLDSWQAAVCGAVAGGVAAFITTPLDVAKTRIMLAKA 212          
BLAST of slc25a-6 vs. TrEMBL
Match: A0A5F5Y770 (Solute carrier family 25 member 26 OS=Felis catus OX=9685 GN=SLC25A26 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.477e-63
Identity = 105/203 (51.72%), Postives = 144/203 (70.94%), Query Frame = 3
Query:   96 SGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            +G VAG+  D ILYP+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE++K  L+  S+    PV   LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + + GI RGLYRGY + V REIPFS++QFP+WE LK     RQ++  +  WQSA+CG FAGG AAV+TTPLDVAKTRIM+A+V
Sbjct:    4 AGGVAGVSVDLILYPLDTIKTRLQSPQGFNKAGGFRGIYAGVPSAAIGSFPNAAAFFITYEYVKWFLHTDSSSYLMPVKHMLAASAGEVVACLIRVPSEVVKQRAQVSSSSRTFQIFSNVLYQEGI-RGLYRGYTSTVLREIPFSLVQFPLWESLKALWSWRQDHV-VDCWQSAVCGAFAGGFAAVVTTPLDVAKTRIMLAKV 204          
BLAST of slc25a-6 vs. TrEMBL
Match: B2GQ56 (Slc25a26 protein OS=Danio rerio OX=7955 GN=slc25a26 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.310e-63
Identity = 102/206 (49.51%), Postives = 140/206 (67.96%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQST----CPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K + +  T     P+   LAA+ GEI ACLIR P EV+KQR+Q  P +  Y+V +N++ E G FRGLYRGY + V REIPFS++QFP+WE+LK     RQ    L SWQ+A+CG  AGG AA +TTPLDVAKT IM+A+ 
Sbjct:    9 SLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSFPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANPSISTYRVLLNSLQEEG-FRGLYRGYGSTVLREIPFSLVQFPLWEYLKAVWWRRQGGR-LDSWQAAVCGALAGGVAAFVTTPLDVAKTWIMLAKA 212          
BLAST of slc25a-6 vs. TrEMBL
Match: A0A5F5XZW8 (Solute carrier family 25 member 26 OS=Felis catus OX=9685 GN=SLC25A26 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 6.193e-63
Identity = 106/208 (50.96%), Postives = 147/208 (70.67%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTC---PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            + S+ +G VAG+  D ILYP+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE++K  L+  S+    PV   LAA+ GE+ ACLIR P EV+KQR+Q     + +Q+  N + + GI RGLYRGY + V REIPFS++QFP+WE LK     RQ++  +  WQSA+CG FAGG AAV+TTPLDVAKTRIM+A+V
Sbjct:   29 MASLVAGGVAGVSVDLILYPLDTIKTRLQSPQGFNKAGGFRGIYAGVPSAAIGSFPNAAAFFITYEYVKWFLHTDSSSYLMPVKHMLAASAGEVVACLIRVPSEVVKQRAQVSSSSRTFQIFSNVLYQEGI-RGLYRGYTSTVLREIPFSLVQFPLWESLKALWSWRQDHV-VDCWQSAVCGAFAGGFAAVVTTPLDVAKTRIMLAKV 234          
BLAST of slc25a-6 vs. Ensembl Cavefish
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:560478])

HSP 1 Score: 157.532 bits (397), Expect = 9.138e-46
Identity = 92/207 (44.44%), Postives = 130/207 (62.80%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTC----PVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            + S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K L   S      P+   +AA+ GEI ACLIR P EV+KQR+Q  P    + V + T+ E      +      +VF +IPFS++QFP+WE+LK     RQ  E L SWQ+A+CG  AG  AA +TTPLDVAKTRIM+A+
Sbjct:    7 VASLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAVGSFPNAAAFFVTYEGTKSLLAGSVSTHMTPITHMIAASIGEIVACLIRVPTEVVKQRTQASPSQHTHHVLLATLREE-----IITDESVLVF-QIPFSLVQFPLWEYLKTVWWRRQ-GERLDSWQAAVCGAVAGAVAAFVTTPLDVAKTRIMLAK 206          
BLAST of slc25a-6 vs. Ensembl Cavefish
Match: SLC25A12 (solute carrier family 25 member 12 [Source:NCBI gene;Acc:103036993])

HSP 1 Score: 88.9669 bits (219), Expect = 4.328e-19
Identity = 67/221 (30.32%), Postives = 103/221 (46.61%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQ---STRTILKSNLYKNLFS----------------GIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            T G++AG    + +YPID +KTR+Q   ST + +   +YKN F                 G+   +   AP  A+     +F++    +   T P+   + A G    S  +   P E++K R Q   ++    +V+  T+  +  F GLY+G      R+IPFS I FP++ H K  L + +    L + Q    G  AG  AA L TP DV KTR+ +A
Sbjct:  330 TLGSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFIGFYRGLLPQLIGVAPEKAIKLTVNDFVRDKFTDKDDTIPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEIATGPRVSALTVVRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHAKIQLTDEEGR--LGALQLLTAGAIAGVPAASLVTPADVIKTRLQVA 548          
BLAST of slc25a-6 vs. Ensembl Cavefish
Match: SLC25A12 (solute carrier family 25 member 12 [Source:NCBI gene;Acc:103036993])

HSP 1 Score: 88.9669 bits (219), Expect = 4.441e-19
Identity = 67/221 (30.32%), Postives = 103/221 (46.61%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQ---STRTILKSNLYKNLFS----------------GIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            T G++AG    + +YPID +KTR+Q   ST + +   +YKN F                 G+   +   AP  A+     +F++    +   T P+   + A G    S  +   P E++K R Q   ++    +V+  T+  +  F GLY+G      R+IPFS I FP++ H K  L + +    L + Q    G  AG  AA L TP DV KTR+ +A
Sbjct:  297 TLGSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFIGFYRGLLPQLIGVAPEKAIKLTVNDFVRDKFTDKDDTIPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEIATGPRVSALTVVRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHAKIQLTDEEGR--LGALQLLTAGAIAGVPAASLVTPADVIKTRLQVA 515          
BLAST of slc25a-6 vs. Ensembl Cavefish
Match: slc25a13 (solute carrier family 25 member 13 [Source:NCBI gene;Acc:103028716])

HSP 1 Score: 88.9669 bits (219), Expect = 5.360e-19
Identity = 71/234 (30.34%), Postives = 106/234 (45.30%), Query Frame = 3
Query:   69 VATEIISITSGAVAGLVTDSILYPIDTIKTRIQ---STRTILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFI--KKLNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQ------DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            +A      T G+VAG V  + +YPID +KTR+Q   ST + +   +YKN                L+ G+   +   AP  A+     +F+  K +    T P+   + A G    S  +   P E++K R Q        P++      ++ I + G F GLY+G      R+IPFS I FP + HLK  L +      +   +  + G  AG  AA L TP DV KTR+ +A
Sbjct:  323 IAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVVRYEGFFGLYRGLVPQLLGVAPEKAIKLTVNDFVRGKTMQRDGTVPLPYEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVS----ALSVIRDLGFF-GLYKGAKACFLRDIPFSAIYFPCYAHLKAGLADEDGR--VGPGRLLLAGAVAGMPAASLVTPADVIKTRLQVA 549          
BLAST of slc25a-6 vs. Ensembl Cavefish
Match: SLC25A12 (solute carrier family 25 member 12 [Source:NCBI gene;Acc:103036993])

HSP 1 Score: 88.5817 bits (218), Expect = 6.775e-19
Identity = 67/221 (30.32%), Postives = 103/221 (46.61%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQ---STRTILKSNLYKNLFS----------------GIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            T G++AG    + +YPID +KTR+Q   ST + +   +YKN F                 G+   +   AP  A+     +F++    +   T P+   + A G    S  +   P E++K R Q   ++    +V+  T+  +  F GLY+G      R+IPFS I FP++ H K  L + +    L + Q    G  AG  AA L TP DV KTR+ +A
Sbjct:  231 TLGSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFIGFYRGLLPQLIGVAPEKAIKLTVNDFVRDKFTDKDDTIPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEIATGPRVSALTVVRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHAKIQLTDEEGR--LGALQLLTAGAIAGVPAASLVTPADVIKTRLQVA 449          
BLAST of slc25a-6 vs. Ensembl Sea Lamprey
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:560478])

HSP 1 Score: 166.007 bits (419), Expect = 1.081e-49
Identity = 93/207 (44.93%), Postives = 133/207 (64.25%), Query Frame = 3
Query:   84 ISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEI----SACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            +S+ +G +AG   D  L+P+DT+KTR+QS +   ++  ++ +++G+P+    S PNAA FF++YE +K     S  P+    AA+ GE      ACLIR P EV+KQR+Q   ++   QV   T+   GI+ GLYRG+ + + REIPFS +QFP+WE LK      Q +E + SWQ+A CG  AGG AA +TTPLDVAKTRIM+A+ 
Sbjct:    8 VSVCAGGLAGASVDLTLFPLDTLKTRLQSAQGFARAGGFRGVYAGVPSAAVGSFPNAAAFFVTYETVKGALGSS--PLSHMAAASIGEALREQVACLIRVPVEVVKQRAQ-ATRVATRQVLAATLQREGIW-GLYRGFKSTIAREIPFSFVQFPLWELLKDRWAIHQGHE-VDSWQAATCGAVAGGLAAAVTTPLDVAKTRIMLAKA 209          
BLAST of slc25a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008980.1 (pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 gene:ENSPMAG00000008118.1 transcript:ENSPMAT00000008980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 1.248e-15
Identity = 63/215 (29.30%), Postives = 98/215 (45.58%), Query Frame = 3
Query:  117 VTDSILYPIDTIKTRIQ---STRTILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLYQ--VTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNN-EPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            V  + +YPID +KTR+Q   ST + +   +YKN                L+ G+   +   AP  A+     + I+        + P+I  + A G    S  +   P E++K R Q   ++        +N + + G F GLY+G      R+IPFS I FP++ H K +  + + +  PL    +   G  AG  AA L TP DV KTR+ +A
Sbjct:    2 VGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVVRYEGVFGLYRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDKSIPLIGEIIAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLG-FLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKGHVGPLHLLTA---GAIAGMPAASLVTPADVIKTRLQVA 212          
BLAST of slc25a-6 vs. Ensembl Sea Lamprey
Match: SLC25A40 (solute carrier family 25 member 40 [Source:HGNC Symbol;Acc:HGNC:29680])

HSP 1 Score: 63.1586 bits (152), Expect = 1.704e-11
Identity = 47/179 (26.26%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  180 ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-----LNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKL--KLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKE----RQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            I++     +L+SG+   +  + P   ++F SY+ ++       N+Q   P I  +A     + A  +  P E+I+ + Q +     +L +   ++++++G +R L+RG+   VFR++PFS + +  +E +K  L       Q    +     A+ G FAG    + T P DV KTR  I
Sbjct:   63 IVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLRDSLARHFNSQH--PSIPFVAGAVARLGAVTVISPLELIRTKMQSRQLTYKELSECVRHSLAQDG-WRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGLMGSAGVNQATFLIHFTSGAVSGTFAG----IATLPFDVVKTRRQI 234          
BLAST of slc25a-6 vs. Ensembl Sea Lamprey
Match: slc25a55b (solute carrier family 25 member 55b [Source:ZFIN;Acc:ZDB-GENE-040801-184])

HSP 1 Score: 58.5362 bits (140), Expect = 5.929e-10
Identity = 58/259 (22.39%), Postives = 100/259 (38.61%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFS----------------GIPTVIAASAPNAAVFFLSYEFIKKL---NNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRG--------LYRGYFT-------------------------------MVFREIPFSIIQFPIWEHLKKNLK-----ERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRI 677
            + +G VAGL+  + ++PID  KTR+Q+ R      +Y+++F                 G    +A   P  A+   + +  ++    + +        +A  G  +   ++  P E++K + QD  +L   Q     IS  G+           L R Y                                  + R++PFSII FP++ +L +  +       + N P   + S + G  AG  AAV  +P DV KTR+
Sbjct:   12 LINGGVAGLIGVTCVFPIDLAKTRLQNQRQ--GQRVYRSMFDCLVKTVRSEGVFGMYRGAAVNLALVTPEKAIKLAANDVFRQFLSRDGKGLSVWREMMAGCGAGVCQVVVTTPMEMLKIQLQDAGRLVAQQKLSANISSAGLGSAKMGAVTPVLSRAYVAHSAPPPRSAVTIARHLLHTQGLGGLYRGLGATLLRDVPFSIIYFPLFANLNELGRLACETGLEGNAPF--YHSFLSGCLAGSVAAVSVSPCDVVKTRL 266          
BLAST of slc25a-6 vs. Ensembl Sea Lamprey
Match: slc25a38b (solute carrier family 25 member 38b [Source:NCBI gene;Acc:571961])

HSP 1 Score: 56.9954 bits (136), Expect = 1.267e-9
Identity = 51/226 (22.57%), Postives = 99/226 (43.81%), Query Frame = 3
Query:   72 ATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRT-----------------ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITS---LAATGGEISA-CLIRCPFEVIKQRSQDQPKLKLYQV--TMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIW---EHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKT 671
             + + ++  GA++G  +  +L P+D +KTR+Q  R                  ++++   + L+ G+   +    P   ++F +   +++   +   P       L  +   ISA C++  P  V+K R +   + K   V   +++I +    R L+ G    + R+ PFS I   I+   +H+  +  ER+   P +      CG  AG  A+++T P D  KT
Sbjct:    3 GSALRALLCGALSGSCSTLLLQPLDLVKTRVQLLRAAGTPRSPRVRMVSVLTHVVRTESVRGLWKGLGPSLVRCVPGVGIYFCTLHSLRESFFRDRAPSALDSLLLGLSARTISAVCML--PVTVVKTRYESG-RFKYRSVLGALSSIRKTEGIRALFSGLTATLARDAPFSGIYVMIYTQAKHMLLHGVEREGQAPTR----FACGVLAGVVASLVTQPADTIKT 221          
BLAST of slc25a-6 vs. Ensembl Yeast
Match: PET8 (S-adenosylmethionine transporter of the mitochondrial inner membrane; member of the mitochondrial carrier family; required for biotin biosynthesis and respiratory growth [Source:SGD;Acc:S000004948])

HSP 1 Score: 176.407 bits (446), Expect = 1.173e-53
Identity = 93/230 (40.43%), Postives = 141/230 (61.30%), Query Frame = 3
Query:   84 ISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIK--------KLNNQSTCPVITS----LAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISEN----GIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEVVIILNKLEYKI 725
            +S+ SGA AG  TD + +PIDTIKTR+Q+      +  YK ++ G+ + + ASAP A++FF+SY+++K        KL +Q +  +I +    L+++ GEI ACL+R P EV+KQR+Q       +Q T+ +I  N    G+ + LYRG+ T + REIPF+ IQFP++E+LKK   +      ++ W+ AICG  AGG AA  TTPLD  KTR+M+ +    L  +  +I
Sbjct:    6 LSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANGGYKGIYRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEVVKQRTQVHSTNSSWQ-TLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIRI 234          
BLAST of slc25a-6 vs. Ensembl Yeast
Match: MRS4 (Iron transporter of the mitochondrial carrier family; mediates Fe2+ transport across the inner mitochondrial membrane; active under low-iron conditions; may transport other cations; protein abundance increases in response to DNA replication stress; MRS4 has a paralog, MRS3, that arose from the whole genome duplication [Source:SGD;Acc:S000001760])

HSP 1 Score: 105.531 bits (262), Expect = 1.368e-26
Identity = 71/215 (33.02%), Postives = 110/215 (51.16%), Query Frame = 3
Query:   96 SGAVAGLVTDSILYPIDTIKTRIQ------STRTILKSNLYK--------NLFSGIPTVIAASAPNAAVFFLSYEFIKKL-----NNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            +GA AG++  S+++PID +KTR+Q      +  T + S + K         L+ G+ +VI  + P  AV+F +YEF K       + Q+  P+ T+L+ T   I+A  +  PF+ +KQR Q    L+++ VT   I +N  F   Y  Y T +   IPF+   F I+E   K    + +  PL      +CG  +G T A LTTPLD  KT + +
Sbjct:   29 AGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVT-KQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPLI---HCLCGGISGATCAALTTPLDCIKTVLQV 239          
BLAST of slc25a-6 vs. Ensembl Yeast
Match: MRS3 (Iron transporter, mediates Fe2+ transport across inner mito membrane; mitochondrial carrier family member; active under low-iron conditions; may transport other cations; MRS3 has a paralog, MRS4, that arose from the whole genome duplication [Source:SGD;Acc:S000003669])

HSP 1 Score: 100.523 bits (249), Expect = 8.164e-25
Identity = 67/215 (31.16%), Postives = 103/215 (47.91%), Query Frame = 3
Query:   96 SGAVAGLVTDSILYPIDTIKTRIQS--TRTILKSNLYKN------------LFSGIPTVIAASAPNAAVFFLSYEFIKK-----LNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            +GA AG++  S+++PID +KTRIQS   +++   N+               L+ G+ +VI  + P  AV+F +YEF KK      + Q+  P  T+++      ++  +  PF+ IKQR Q      ++Q T       G+    Y  Y T +   IPF+   F I+E   K L       PL      +CG  +G T A +TTPLD  KT + I
Sbjct:   39 AGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQIYQSEGL-AAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLI---HCLCGSISGSTCAAITTPLDCIKTVLQI 249          
BLAST of slc25a-6 vs. Ensembl Yeast
Match: AGC1 (Mitochondrial amino acid transporter; acts both as a glutamate uniporter and as an aspartate-glutamate exchanger; involved in nitrogen metabolism and nitrogen compound biosynthesis; human homolog SLC25A13 complements yeast null mutant [Source:SGD;Acc:S000006225])

HSP 1 Score: 103.219 bits (256), Expect = 1.141e-24
Identity = 75/228 (32.89%), Postives = 110/228 (48.25%), Query Frame = 3
Query:   99 GAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIK-----KLNNQSTCPVITSLAATGGEISACLI--RCPFEVIKQRSQDQPK-----LKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNL-----KERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            G++AG +  +++YPID IKTR+Q+ R++ +   YKN                L+SG+   +   AP  A+     +F++     K    S  P I S A+ G    AC +    P E++K R Q Q       ++    T   I +    RGLY G    + R++PFS I FP + HLKK+L      ++     LK+W+    G  AG  AA LTTP DV KTR+ I
Sbjct:  537 GSIAGCIGATVVYPIDFIKTRMQAQRSLAQ---YKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAG----ACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQI 757          
BLAST of slc25a-6 vs. Ensembl Yeast
Match: MME1 (Transporter of the mitochondrial inner membrane that exports magnesium; involved in mitochondrial Mg2+ homeostasis; has similarity to human mitochondrial ATP-Mg/Pi carriers [Source:SGD;Acc:S000004776])

HSP 1 Score: 96.6709 bits (239), Expect = 4.287e-23
Identity = 73/241 (30.29%), Postives = 116/241 (48.13%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQST-------------RTI-LKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAAT-GGEISACLIRCPFEVIKQRSQDQPKLK--LYQVTMN----------TISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKK-----NLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEVVIILNK 710
            + SG + G + DS ++ +DT+KTR Q               RTI L+  + + L+ G    +  S P+AA+FF +YE+ K+  + +      IT L+A   G+  +  +  P EV+K R Q Q +     +Q   N           I E G FR L+ GY   + R++PFS +QF  +E  ++       K+ ++ E L      + G  AGG A ++TTP+DV KTR+   +     NK
Sbjct:   57 VVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEG-FRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGE-LSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNK 295          
BLAST of slc25a-6 vs. Ensembl Nematostella
Match: EDO49303 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH70])

HSP 1 Score: 102.449 bits (254), Expect = 5.321e-25
Identity = 74/230 (32.17%), Postives = 104/230 (45.22%), Query Frame = 3
Query:   84 ISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSN---LYKNLFS----------------GIPTVIAASAPNAAVFFLSYEFIKKL---NNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQ--DQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEVVII 701
            + + +G  AG++   ++YP+D +KTR+QS    LK N    Y N+                  GI  V   + P  A++F SYE IKKL   NN +  P    LA     +       P EVIKQR Q    P   +     +   E GI R  YR Y T +   IPF  + F ++E+ +K L      +P       I G  AG  A+ +TTPLDVAKT +   E  ++
Sbjct:   16 VHLLAGGAAGVMEHCVMYPVDCVKTRMQS----LKPNPNAQYNNMIHAIKKMIQSEGILAPLRGINIVAMGAGPAHALYFSSYEAIKKLLIGNNTTHSPTAYVLAGACATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKEEGI-RAFYRSYTTQLSMNIPFQTLHFTVYEYARKALNPLGGYDPKT---HVIAGATAGAVASAITTPLDVAKTLLNTQERSVV 237          
BLAST of slc25a-6 vs. Ensembl Nematostella
Match: EDO42462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1I1])

HSP 1 Score: 88.5817 bits (218), Expect = 2.446e-19
Identity = 67/226 (29.65%), Postives = 106/226 (46.90%), Query Frame = 3
Query:   69 VATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSN-LYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKKL--NNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNL-KERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
             A +    + G+VAG    + +YPID +KTR+Q+ R +L++  +YKN                L+ G+   +   +P  A+   + +F++ +  ++     +   + A G G  +  +   P E++K R Q   +    QVT     +   F GLYRG      R+IPFS I FP + H K     E  +N  L  + SA+    AG  AA L TP DV KTR+ +
Sbjct:  343 TAQQAYRFSLGSVAGATGATAVYPIDLVKTRMQNQRAVLEAEKVYKNSIDCFFKVVRNEGPIGLYRGLLPQLLGVSPEKAIKLTTNDFVRGIFSDDDGFISLPYEIVAGGCGGAAQVMFTNPLEIVKIRLQVAGETPGRQVTAWQCVKELGFGGLYRGARACFLRDIPFSAIYFPSYAHFKMYFADENGHNGALGLFGSAM---LAGVPAAALVTPADVIKTRLQV 565          
BLAST of slc25a-6 vs. Ensembl Nematostella
Match: EDO45549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE2])

HSP 1 Score: 78.1814 bits (191), Expect = 1.275e-16
Identity = 59/213 (27.70%), Postives = 99/213 (46.48%), Query Frame = 3
Query:   96 SGAVAGLVTDSILYPIDTIKTRIQSTR-------------TILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVIT-SLAATGGEISA-CLIRCPFEVIKQR--SQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            +GA +G  +  +  P+D +KTR+Q+               T+ +++    L+ G+   I    P  A++F S   +    ++   P+ +  L AT   I+  C++  P  V+K R  S +     + Q  ++  +  G  RGLY G    V R+ PFS +    +  +K+  K       L S Q+ ICG  AG  A+V+T P DV KTR+ +
Sbjct:   13 AGAFSGTCSTILFQPLDLVKTRLQTRAIASGNGGMFYTFYTVFRADHVAGLWRGLTPSIYRCVPGVAMYFTSLHGLSSFVSEDPSPLQSIVLGATARTIAGVCMM--PVTVVKTRYESGNFNYTSMRQALVSIWTNEG-GRGLYSGLVATVARDAPFSGLYLMFYTQIKRRAKGLLQVGDLTSGQNFICGIMAGAMASVVTQPADVVKTRLQM 222          
BLAST of slc25a-6 vs. Ensembl Nematostella
Match: EDO33353 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE4])

HSP 1 Score: 77.411 bits (189), Expect = 4.395e-16
Identity = 60/245 (24.49%), Postives = 116/245 (47.35%), Query Frame = 3
Query:   87 SITSGAVAGLVTDSILYPIDTIKTRIQ---------------STRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIK-KLNNQSTCPVITSLAATG---GEISACLIRCPFEVIK-----QRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEVVIILNKLEYKINLHTFCGF 749
            +I +G +AG +     +P + +KT++Q                 +  +K +    L+ G+ +++  S P A+V F  +E++K K+ +++         A+G   G   A ++ CP E IK      ++Q  PK K +   + TI +   F G+Y+G    V ++    +I+F ++ +LK  L+   +++ + + ++ + G  AG  +    TP+DV KTR+   E     N L+  I +    GF
Sbjct:   43 AILAGGIAGGLEICCTFPTEYVKTQLQLDEKAAKPIYRGPIDCVKKTVKGHGVLGLYRGLSSLLYGSVPKASVRFAVFEYLKNKMADENGKLTQFQTLASGLGAGVSEAVVVVCPMETIKVKFIHDQTQPNPKYKGFFSGVRTILKTEGFFGVYKGLTATVIKQGSNQMIRFFVYSNLKSWLQGGDSSKDIGAVKTFLIGGVAGAASVFGNTPVDVVKTRMQGLEAHKYKNTLDCTIRIAKHEGF 287          
BLAST of slc25a-6 vs. Ensembl Nematostella
Match: EDO47003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN42])

HSP 1 Score: 64.3142 bits (155), Expect = 1.077e-11
Identity = 68/233 (29.18%), Postives = 99/233 (42.49%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNL-----------YKNLFSG-IPTVIAASAPNAAVFFL---SYEFIKKLNNQSTCPVIT----SLAATGGEISACLIRCPFEVIKQRSQDQ-----------PKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNN------EPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T+GA+ G        P DTIK ++Q+  ++ K+ L           +K L++G IP++ A  A N+ +F         IK L  +     +T    + A +G       + CP E+IK R Q Q           PK  +  VTM  I  +G F+GL+RG      RE+P     F  +E  +  L     +       PLK     +CG FAG        P DV K+RI I
Sbjct:   14 TAGAMGGTACVFAGQPFDTIKVKMQTFPSMSKNALDCGIKTFKQEGFKGLYAGTIPSLAANIAENSFLFLFYGQCLSLIKTLTGKKHESELTIFHNACAGSGAAFFMSFVLCPAELIKCRLQAQHQTNLISGMAGPKSGVIDVTMQIIRNDG-FQGLFRGMTATWAREVPGYFFFFGGYEFSRYMLTPSGGDVRDVVKSPLKM---ILCGGFAGTCLWTAIFPADVVKSRIQI 242          
BLAST of slc25a-6 vs. Ensembl Medaka
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:101163894])

HSP 1 Score: 200.675 bits (509), Expect = 2.475e-62
Identity = 99/211 (46.92%), Postives = 135/211 (63.98%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKL-------NNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEV 692
            + S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K L             PV   LAA+ GE+ ACLIR P EV+KQR+Q  P    Y   + T+ E G+ RGLYRGY + V REIPFS++QFP+WE+L K L  R+    L  WQSA+CG  AG  +A +TTPLDVAKTRIM+A+ 
Sbjct:    7 VASLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFHKAGGFRGIYAGVPSAAVGSFPNAAAFFVTYECAKSLLGAGGAPAAPQAAPVTHMLAASLGEVVACLIRVPAEVVKQRTQASPSSSTYSTLLATLREEGV-RGLYRGYGSTVLREIPFSLVQFPLWEYL-KTLWSRRQGHMLSPWQSAVCGALAGAVSAFVTTPLDVAKTRIMLAKA 215          
BLAST of slc25a-6 vs. Ensembl Medaka
Match: slc25a26 (solute carrier family 25 member 26 [Source:NCBI gene;Acc:101163894])

HSP 1 Score: 126.716 bits (317), Expect = 7.352e-34
Identity = 63/156 (40.38%), Postives = 94/156 (60.26%), Query Frame = 3
Query:   81 IISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKL-------NNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQ 527
            + S+ +G  AG+  D  L+P+DTIKTR+QS +   K+  ++ +++G+P+    S PNAA FF++YE  K L             PV   LAA+ GE+ ACLIR P EV+KQR+Q  P    Y   + T+ E G+ RGLYRGY + V RE+  ++++
Sbjct:    7 VASLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFHKAGGFRGIYAGVPSAAVGSFPNAAAFFVTYECAKSLLGAGGAPAAPQAAPVTHMLAASLGEVVACLIRVPAEVVKQRTQASPSSSTYSTLLATLREEGV-RGLYRGYGSTVLREVEATLVR 161          
BLAST of slc25a-6 vs. Ensembl Medaka
Match: slc25a22a (mitochondrial glutamate carrier 1 [Source:NCBI gene;Acc:101168864])

HSP 1 Score: 85.5001 bits (210), Expect = 1.873e-18
Identity = 61/233 (26.18%), Postives = 107/233 (45.92%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQSTRT--------------ILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKK-LNNQSTCPVITS-LAATGGEISACLIRCPFEVIKQRSQDQPKLKL---------------------YQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRI 677
            + +G +AGL+  + ++PID  KTR+Q+ +                ++S  Y  ++ G    +    P  A+   + +F ++ L+      ++   LA  G      ++  P E++K + QD  ++                        Q+T   + E GI  GLY+G    + R++PFSII FP++ +L  N+ ++  + P   + S I G  AG TAAV   P+DV KTR+
Sbjct:   12 LINGGIAGLIGVTCVFPIDLAKTRLQNQQNGSRLYTSMSDCLIKTIRSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRQHLSKDGKLTLVKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKLMPETVAAGTVETKSPTAMQLTRQLLQEKGI-AGLYKGLGATLLRDVPFSIIYFPLFANLN-NIGKKDVDGPAPFYVSFISGCLAGSTAAVAVNPVDVIKTRL 242          
BLAST of slc25a-6 vs. Ensembl Medaka
Match: slc25a12 (calcium-binding mitochondrial carrier protein Aralar1 [Source:NCBI gene;Acc:101159534])

HSP 1 Score: 87.0409 bits (214), Expect = 2.149e-18
Identity = 66/219 (30.14%), Postives = 101/219 (46.12%), Query Frame = 3
Query:   99 GAVAGLVTDSILYPIDTIKTRIQ---STRTILKSNLYKNLFS----------------GIPTVIAASAPNAAVFFLSYEFIKK--LNNQSTCPVITSLAATG-GEISACLIRCPFEVIKQRSQDQPKLKLY-QVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIA 686
            G++AG    + +YPID +KTR+Q   ST + +   +YKN F                 G+   +   AP  A+     +F++        T P+   + A G    S  +   P E++K R Q   ++    +V+  ++  +  F GLY+G      R+IPFS I FP++ H K  L +   N  L + Q    G  AG  AA L TP DV KTR+ +A
Sbjct:  334 GSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFFGFYRGLVPQLIGVAPEKAIKLTVNDFVRDKFTQKDDTIPLFAEIMAGGCAGASQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGLYKGAKACFLRDIPFSAIYFPMYAHTKTQLADE--NGRLGALQLLTAGAIAGVPAASLVTPADVIKTRLQVA 550          
BLAST of slc25a-6 vs. Ensembl Medaka
Match: slc25a55b (mitochondrial glutamate carrier 1 [Source:NCBI gene;Acc:101158273])

HSP 1 Score: 79.337 bits (194), Expect = 2.832e-16
Identity = 63/252 (25.00%), Postives = 103/252 (40.87%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNL----------------FSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVIT---SLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTM--------------------NTISENGIFR-----------------GLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRI 677
            + +G +AG+V  + ++PID  KTR+Q+ R+     LYKN+                + G    +    P  A+   + +F +   +Q    +      LA     +   +I  P E++K + QD  +L   Q  M                    NTI    + R                 GLYRG    + R+IPFS++ FP++ HL +  +    +  +  + S + G  AG  AAV  +P DV KTR+
Sbjct:   13 LINGGIAGIVGVTCVFPIDLAKTRLQNQRS--GQQLYKNMMDCLIKTVRSEGYFGIYRGAAVNLTLVTPEKAIKLAANDFFRHQLSQDGARLTVFKEMLAGCCAGMCQVIITTPMEMLKIQMQDAGRLVAQQRVMPSVVPTMKMGGTSTVLSRSYNTIHAPQVVRMSALQITKELLRTKGIMGLYRGLGATLMRDIPFSVVYFPLFAHLHQLGQHSSEHPSVPFYWSFMSGCLAGSIAAVAVSPCDVVKTRL 262          
BLAST of slc25a-6 vs. Planmine SMEST
Match: SMESG000006261.1 (SMESG000006261.1)

HSP 1 Score: 423.705 bits (1088), Expect = 3.236e-150
Identity = 207/208 (99.52%), Postives = 207/208 (99.52%), Query Frame = 3
Query:   66 MVATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 689
            MVATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGI RGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE
Sbjct:    1 MVATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGILRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAE 208          
BLAST of slc25a-6 vs. Planmine SMEST
Match: SMESG000069729.1 (SMESG000069729.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.882e-18
Identity = 61/226 (26.99%), Postives = 107/226 (47.35%), Query Frame = 3
Query:   90 ITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFS---------GIPTVIAASA-------PNAAVFFLSYEFIK---KLNNQSTCPVITSLAATGGEISACLIRCPFEVIKQRSQDQPKLKL-----------YQVTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRI 677
            I +G +AG+V  + +YPID +KTR+Q+ ++ +K  LY  +F          G   +   SA       P  A+  +  +F +   K   +   P+   +A  G      ++  P E++K + QD+ + ++            ++ +N + E GIF GLY+G      R++ FS I FP++ +  K   +R+N +    + S   G  AG  A++   P DV KTR+
Sbjct:   15 ILNGGIAGIVGVTCVYPIDLVKTRLQNQQSGVK--LYNGMFDCAKKTFKSEGFFKMYRGSAVNLFLITPEKAIKLVGNDFFRYHLKPTGKPLNPLREMIAGGGAGACQIIVTTPMELLKIQLQDEGRTRIKGQTGATKASASRIALNLLKEKGIF-GLYKGMGATFLRDVTFSAIYFPLFANFNKLGPQRENGKGTVFYWSFGSGCLAGCIASLSVNPFDVVKTRL 237          
BLAST of slc25a-6 vs. Planmine SMEST
Match: SMESG000002626.1 (SMESG000002626.1)

HSP 1 Score: 72.7886 bits (177), Expect = 7.009e-14
Identity = 67/224 (29.91%), Postives = 103/224 (45.98%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTR--TILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPV----ITSLAATGGEISACLI--RCPFEVIKQRSQDQPKLKLYQ--VTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQN-NEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T G VAG +  + +YPID +KTR+Q+ R  +I+   +YK+                L+ G+   +   AP  A+     +F+K   +Q T P     + +   +GG    C +    P E++K R Q   ++   +    ++ + E G F GLY+G      R+IPFS I FP + HLK    +    N P       +    AG  AA L TP DV KTR+ +
Sbjct:  152 TLGGVAGALGATTVYPIDLVKTRMQNQRLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGLAPQLLGVAPEKAIKLTMNDFMK---DQLTPPDGNIPLWAECVSGGIAGGCQVIFTNPLEIVKIRLQVAGEIASAKRVAALHHVRELG-FMGLYKGARACFLRDIPFSAIYFPAYNHLKMAFADEDGINTPASLL---VAATIAGAPAAFLCTPADVIKTRLQV 368          

HSP 2 Score: 50.8322 bits (120), Expect = 7.688e-7
Identity = 42/180 (23.33%), Postives = 73/180 (40.56%), Query Frame = 3
Query:  324 SLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGI-----------FRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEVVIILNKLEYKINLHTFCGFYFRFLVEPRR--FMNDVSIKYVAFPIF 824
            +L    G + A  +  P +++K R Q+Q   +L  +    + ++             F GLYRG    +    P   I+  + + +K  L     N PL  W   + G  AGG   + T PL++ K R+ +A  +    ++     LH      F  L +  R  F+ D+    + FP +
Sbjct:  152 TLGGVAGALGATTV-YPIDLVKTRMQNQ---RLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGLAPQLLGVAPEKAIKLTMNDFMKDQLTPPDGNIPL--WAECVSGGIAGGCQVIFTNPLEIVKIRLQVAGEIASAKRV---AALHHVRELGFMGLYKGARACFLRDIPFSAIYFPAY 322          
BLAST of slc25a-6 vs. Planmine SMEST
Match: SMESG000002626.1 (SMESG000002626.1)

HSP 1 Score: 72.7886 bits (177), Expect = 7.225e-14
Identity = 67/224 (29.91%), Postives = 103/224 (45.98%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTR--TILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPV----ITSLAATGGEISACLI--RCPFEVIKQRSQDQPKLKLYQ--VTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQN-NEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T G VAG +  + +YPID +KTR+Q+ R  +I+   +YK+                L+ G+   +   AP  A+     +F+K   +Q T P     + +   +GG    C +    P E++K R Q   ++   +    ++ + E G F GLY+G      R+IPFS I FP + HLK    +    N P       +    AG  AA L TP DV KTR+ +
Sbjct:  337 TLGGVAGALGATTVYPIDLVKTRMQNQRLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGLAPQLLGVAPEKAIKLTMNDFMK---DQLTPPDGNIPLWAECVSGGIAGGCQVIFTNPLEIVKIRLQVAGEIASAKRVAALHHVRELG-FMGLYKGARACFLRDIPFSAIYFPAYNHLKMAFADEDGINTPASLL---VAATIAGAPAAFLCTPADVIKTRLQV 553          

HSP 2 Score: 50.447 bits (119), Expect = 1.247e-6
Identity = 42/180 (23.33%), Postives = 73/180 (40.56%), Query Frame = 3
Query:  324 SLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGI-----------FRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEVVIILNKLEYKINLHTFCGFYFRFLVEPRR--FMNDVSIKYVAFPIF 824
            +L    G + A  +  P +++K R Q+Q   +L  +    + ++             F GLYRG    +    P   I+  + + +K  L     N PL  W   + G  AGG   + T PL++ K R+ +A  +    ++     LH      F  L +  R  F+ D+    + FP +
Sbjct:  337 TLGGVAGALGATTV-YPIDLVKTRMQNQ---RLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGLAPQLLGVAPEKAIKLTMNDFMKDQLTPPDGNIPL--WAECVSGGIAGGCQVIFTNPLEIVKIRLQVAGEIASAKRV---AALHHVRELGFMGLYKGARACFLRDIPFSAIYFPAY 507          
BLAST of slc25a-6 vs. Planmine SMEST
Match: SMESG000002626.1 (SMESG000002626.1)

HSP 1 Score: 72.4034 bits (176), Expect = 7.719e-14
Identity = 67/224 (29.91%), Postives = 103/224 (45.98%), Query Frame = 3
Query:   93 TSGAVAGLVTDSILYPIDTIKTRIQSTR--TILKSNLYKN----------------LFSGIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPV----ITSLAATGGEISACLI--RCPFEVIKQRSQDQPKLKLYQ--VTMNTISENGIFRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQN-NEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMI 683
            T G VAG +  + +YPID +KTR+Q+ R  +I+   +YK+                L+ G+   +   AP  A+     +F+K   +Q T P     + +   +GG    C +    P E++K R Q   ++   +    ++ + E G F GLY+G      R+IPFS I FP + HLK    +    N P       +    AG  AA L TP DV KTR+ +
Sbjct:  108 TLGGVAGALGATTVYPIDLVKTRMQNQRLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGLAPQLLGVAPEKAIKLTMNDFMK---DQLTPPDGNIPLWAECVSGGIAGGCQVIFTNPLEIVKIRLQVAGEIASAKRVAALHHVRELG-FMGLYKGARACFLRDIPFSAIYFPAYNHLKMAFADEDGINTPASLL---VAATIAGAPAAFLCTPADVIKTRLQV 324          

HSP 2 Score: 50.8322 bits (120), Expect = 7.881e-7
Identity = 42/180 (23.33%), Postives = 73/180 (40.56%), Query Frame = 3
Query:  324 SLAATGGEISACLIRCPFEVIKQRSQDQPKLKLYQVTMNTISENGI-----------FRGLYRGYFTMVFREIPFSIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVAKTRIMIAEVVIILNKLEYKINLHTFCGFYFRFLVEPRR--FMNDVSIKYVAFPIF 824
            +L    G + A  +  P +++K R Q+Q   +L  +    + ++             F GLYRG    +    P   I+  + + +K  L     N PL  W   + G  AGG   + T PL++ K R+ +A  +    ++     LH      F  L +  R  F+ D+    + FP +
Sbjct:  108 TLGGVAGALGATTV-YPIDLVKTRMQNQ---RLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGLAPQLLGVAPEKAIKLTMNDFMKDQLTPPDGNIPL--WAECVSGGIAGGCQVIFTNPLEIVKIRLQVAGEIASAKRV---AALHHVRELGFMGLYKGARACFLRDIPFSAIYFPAY 278          
The following BLAST results are available for this feature:
BLAST of slc25a-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A262.639e-5748.56solute carrier family 25 member 26 [Source:HGNC Sy... [more]
SLC25A262.639e-5748.56solute carrier family 25 member 26 [Source:HGNC Sy... [more]
SLC25A262.148e-3457.02solute carrier family 25 member 26 [Source:HGNC Sy... [more]
SLC25A262.148e-3457.02solute carrier family 25 member 26 [Source:HGNC Sy... [more]
SLC25A261.511e-3357.02solute carrier family 25 member 26 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc-25A265.520e-5143.78SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-25A18.21.335e-1826.91SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
K02F3.24.764e-1730.45Probable calcium-binding mitochondrial carrier K02... [more]
K02F3.24.835e-1730.45Probable calcium-binding mitochondrial carrier K02... [more]
slc-25A215.320e-1726.98SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG47431.912e-4342.45gene:FBgn0039357 transcript:FBtr0084933[more]
aralar16.136e-1727.56gene:FBgn0028646 transcript:FBtr0085693[more]
aralar16.439e-1727.56gene:FBgn0028646 transcript:FBtr0085694[more]
aralar16.439e-1727.56gene:FBgn0028646 transcript:FBtr0085695[more]
aralar16.742e-1727.56gene:FBgn0028646 transcript:FBtr0330290[more]
back to top
BLAST of slc25a-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a261.480e-6649.51solute carrier family 25 member 26 [Source:NCBI ge... [more]
slc25a267.247e-4947.80solute carrier family 25 member 26 [Source:NCBI ge... [more]
slc25a267.247e-4947.80solute carrier family 25 member 26 [Source:NCBI ge... [more]
slc25a267.247e-4947.80solute carrier family 25 member 26 [Source:NCBI ge... [more]
slc25a267.443e-4238.83solute carrier family 25 member 26 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a262.384e-5950.73solute carrier family 25 (S-adenosylmethionine car... [more]
slc25a265.514e-4446.50solute carrier family 25 (S-adenosylmethionine car... [more]
tusc21.265e-1930.14tumor suppressor 2, mitochondrial calcium regulato... [more]
tusc21.417e-1930.14tumor suppressor 2, mitochondrial calcium regulato... [more]
tusc21.421e-1930.14tumor suppressor 2, mitochondrial calcium regulato... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a267.533e-6051.71solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a264.294e-3038.07solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a268.607e-1942.42solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a128.988e-1829.06solute carrier family 25 (mitochondrial carrier, A... [more]
Slc25a135.543e-1727.85solute carrier family 25 (mitochondrial carrier, a... [more]
back to top
BLAST of slc25a-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4V9P0|SAMC_DANRE1.117e-6549.51S-adenosylmethionine mitochondrial carrier protein... [more]
sp|Q5U680|SAMC_MOUSE5.269e-5951.71S-adenosylmethionine mitochondrial carrier protein... [more]
sp|Q6GLA2|SAMC_XENTR1.600e-5850.73S-adenosylmethionine mitochondrial carrier protein... [more]
sp|Q641C8|SAMC_XENLA1.217e-5651.22S-adenosylmethionine mitochondrial carrier protein... [more]
sp|Q70HW3|SAMC_HUMAN1.267e-5648.56S-adenosylmethionine mitochondrial carrier protein... [more]
back to top
BLAST of slc25a-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJB71.078e-14699.52Slc25a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A5N5L2N51.310e-6450.00Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A5F5Y7702.477e-6351.72Solute carrier family 25 member 26 OS=Felis catus ... [more]
B2GQ563.310e-6349.51Slc25a26 protein OS=Danio rerio OX=7955 GN=slc25a2... [more]
A0A5F5XZW86.193e-6350.96Solute carrier family 25 member 26 OS=Felis catus ... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a269.138e-4644.44solute carrier family 25 member 26 [Source:NCBI ge... [more]
SLC25A124.328e-1930.32solute carrier family 25 member 12 [Source:NCBI ge... [more]
SLC25A124.441e-1930.32solute carrier family 25 member 12 [Source:NCBI ge... [more]
slc25a135.360e-1930.34solute carrier family 25 member 13 [Source:NCBI ge... [more]
SLC25A126.775e-1930.32solute carrier family 25 member 12 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a261.081e-4944.93solute carrier family 25 member 26 [Source:NCBI ge... [more]
ENSPMAT00000008980.11.248e-1529.30pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 ... [more]
SLC25A401.704e-1126.26solute carrier family 25 member 40 [Source:HGNC Sy... [more]
slc25a55b5.929e-1022.39solute carrier family 25 member 55b [Source:ZFIN;A... [more]
slc25a38b1.267e-922.57solute carrier family 25 member 38b [Source:NCBI g... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PET81.173e-5340.43S-adenosylmethionine transporter of the mitochondr... [more]
MRS41.368e-2633.02Iron transporter of the mitochondrial carrier fami... [more]
MRS38.164e-2531.16Iron transporter, mediates Fe2+ transport across i... [more]
AGC11.141e-2432.89Mitochondrial amino acid transporter; acts both as... [more]
MME14.287e-2330.29Transporter of the mitochondrial inner membrane th... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493035.321e-2532.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424622.446e-1929.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455491.275e-1627.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333534.395e-1624.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470031.077e-1129.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a262.475e-6246.92solute carrier family 25 member 26 [Source:NCBI ge... [more]
slc25a267.352e-3440.38solute carrier family 25 member 26 [Source:NCBI ge... [more]
slc25a22a1.873e-1826.18mitochondrial glutamate carrier 1 [Source:NCBI gen... [more]
slc25a122.149e-1830.14calcium-binding mitochondrial carrier protein Aral... [more]
slc25a55b2.832e-1625.00mitochondrial glutamate carrier 1 [Source:NCBI gen... [more]
back to top
BLAST of slc25a-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006261.13.236e-15099.52SMESG000006261.1[more]
SMESG000069729.12.882e-1826.99SMESG000069729.1[more]
SMESG000002626.17.009e-1429.91SMESG000002626.1[more]
SMESG000002626.17.225e-1429.91SMESG000002626.1[more]
SMESG000002626.17.719e-1429.91SMESG000002626.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009256
GenBankAKN21574.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009256 ID=SMED30009256|Name=slc25a-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1038bp
TTTACAGATATATTCAAAATTTTAAAATCCTTTAATTACTTATATAAAGT
CTTAAGTTACTATTAATGGTTGCTACTGAAATTATTTCCATAACGTCTGG
TGCTGTGGCAGGATTAGTTACTGATTCAATTTTGTACCCTATCGATACAA
TTAAAACTCGTATTCAAAGTACTCGTACTATATTAAAGTCAAATCTATAT
AAAAATCTTTTTTCTGGTATACCAACAGTAATAGCAGCATCTGCTCCAAA
TGCTGCAGTTTTCTTTTTGTCATATGAATTTATAAAGAAGTTAAATAACC
AAAGTACTTGTCCAGTAATAACTTCTCTTGCAGCCACTGGCGGGGAAATT
TCAGCATGTTTAATAAGATGTCCTTTTGAAGTAATCAAACAGCGCTCACA
AGATCAACCAAAATTAAAACTATACCAAGTGACTATGAATACAATTTCTG
AAAACGGCATTTTTCGAGGCTTGTATAGAGGTTATTTTACAATGGTTTTT
CGAGAAATTCCGTTTTCTATTATTCAGTTTCCTATTTGGGAACACCTTAA
AAAAAATTTAAAGGAACGACAAAACAATGAGCCATTAAAATCCTGGCAGT
CGGCTATTTGTGGGTTTTTTGCCGGTGGAACTGCAGCCGTTCTCACTACT
CCCTTGGATGTTGCTAAAACTCGAATAATGATTGCTGAGGTAGTTATAAT
TTTAAATAAACTAGAATATAAAATAAATTTACATACTTTTTGTGGATTCT
ATTTCAGATTCTTAGTTGAACCTAGACGCTTCATGAATGATGTCTCGATT
AAATATGTCGCATTCCCAATTTTCATAAAAAGGTTCTTTAAACCACTAAT
AGAGTATCGAAAAAAAATTTTTTCCTTGATTTTTGTATATAATTTTGTCT
GCTCCCAAAGAACAAGACTTATAGGATTCCAGGACAAAAATATTAAGAAT
AACCAAAAACTACCTCTGATTATAGTCTGAATTGCATTTTGCACGTTTTC
TTGCACTTAATAACCAATAATTATATTTTTATGGTGCA
back to top

protein sequence of SMED30009256-orf-1

>SMED30009256-orf-1 ID=SMED30009256-orf-1|Name=SMED30009256-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=305bp
MVATEIISITSGAVAGLVTDSILYPIDTIKTRIQSTRTILKSNLYKNLFS
GIPTVIAASAPNAAVFFLSYEFIKKLNNQSTCPVITSLAATGGEISACLI
RCPFEVIKQRSQDQPKLKLYQVTMNTISENGIFRGLYRGYFTMVFREIPF
SIIQFPIWEHLKKNLKERQNNEPLKSWQSAICGFFAGGTAAVLTTPLDVA
KTRIMIAEVVIILNKLEYKINLHTFCGFYFRFLVEPRRFMNDVSIKYVAF
PIFIKRFFKPLIEYRKKIFSLIFVYNFVCSQRTRLIGFQDKNIKNNQKLP
LIIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
GO:0000095S-adenosyl-L-methionine transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0006810transport
GO:0006839mitochondrial transport
GO:0015805S-adenosyl-L-methionine transport
GO:0055085transmembrane transport
GO:1901962S-adenosyl-L-methionine transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 8..78
e-value: 6.6E-9
score: 35.6
coord: 174..207
e-value: 3.8E-7
score: 29.9
coord: 88..167
e-value: 9.9E-10
score: 38.2
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 174..256
score: 7.989
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 81..164
score: 13.009
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 3..76
score: 16.399
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 5..229
e-value: 1.0E-40
score: 141.3
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 7..210
NoneNo IPR availablePANTHERPTHR45667:SF9S-ADENOSYLMETHIONINE MITOCHONDRIAL CARRIER PROTEINcoord: 8..208
NoneNo IPR availablePANTHERPTHR45667FAMILY NOT NAMEDcoord: 8..208
NoneNo IPR availableTMHMMTMhelixcoord: 47..69
NoneNo IPR availableTMHMMTMhelixcoord: 4..26