Solute carrier family 12 member 9

Overview
NameSolute carrier family 12 member 9
Smed IDSMED30009255
Length (bp)3344
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Solute carrier family 12 member 9 (SMED30009255) t-SNE clustered cells

Violin plots show distribution of expression levels for Solute carrier family 12 member 9 (SMED30009255) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Solute carrier family 12 member 9 (SMED30009255) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Solute carrier family 12 member 9 (SMED30009255) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009255

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009255SMESG000060496.1 SMESG000033021.1 PL030017B20H02ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009255SMESG000060496.1 SMESG000033021.1 Contig5531GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30009255SMESG000033021.1 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30009255SMESG000033021.1 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009255SMESG000033021.1 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009255SMESG000033021.1 dd_Smed_v4_1738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Solute carrier family 12 member 9 vs. Ensembl Human
Match: SLC12A9 (solute carrier family 12 member 9 [Source:HGNC Symbol;Acc:HGNC:17435])

HSP 1 Score: 416.387 bits (1069), Expect = 7.728e-132
Identity = 234/476 (49.16%), Postives = 323/476 (67.86%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP--LGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQV---PIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ-KLRKNERFPKNQGIY 2073
            S+CAI+TNGA++GGG YFMISRTLGPEVGGSIG++F+LANV   A+ +   VE ++D FG    G     ++ + +GWN L+ + +     GVC +G  L+A+ +   F++V     SV++SF+      +   P P  N     +S   +FG++TG + +T  +NL A Y  D+TT   M F +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  Y++ FFLS+ TCDR LL  +Y F +A +LW P V+IG++ T +SA++ + IGASRIL ALA+DD+FG+ L PAK+ ++GGNP  +V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C  L+WA+A NFRPTF  FSW+T LLGVA CL M FL S   + G   L  ++  +L  R    SWG +SQALLFHQVRKYLL +D+RK+HVK+WRPQ+LLL+ NPR    L +     K  G+Y
Sbjct:   89 SVCAIATNGAVQGGGAYFMISRTLGPEVGGSIGLMFYLANVCGCAVSLLGLVESVLDVFGADATGPSGLRVLPQGYGWNLLYGSLLLGLVGGVCTLGAGLYARASFLTFLLVSGSLASVLISFVAVGPRDIRLTPRPGPN----GSSLPPRFGHFTGFNSSTLKDNLGAGYAEDYTTGAVMNFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRTLLQEDYGFFRAISLWPPLVLIGIYATALSASMSSLIGASRILHALARDDLFGVILAPAKVVSRGGNPWAAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLAALLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPRGALPLLRLANQLKKGGLY 560          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Human
Match: SLC12A9 (solute carrier family 12 member 9 [Source:HGNC Symbol;Acc:HGNC:17435])

HSP 1 Score: 416.772 bits (1070), Expect = 1.045e-128
Identity = 230/458 (50.22%), Postives = 317/458 (69.21%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP--LGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQV---PIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR 2022
            S+CAI+TNGA++GGG YFMISRTLGPEVGGSIG++F+LANV   A+ +   VE ++D FG    G     ++ + +GWN L+ + +     GVC +G  L+A+ +   F++V     SV++SF+      +   P P  N     +S   +FG++TG + +T  +NL A Y  D+TT   M F +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  Y++ FFLS+ TCDR LL  +Y F +A +LW P V+IG++ T +SA++ + IGASRIL ALA+DD+FG+ L PAK+ ++GGNP  +V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C  L+WA+A NFRPTF  FSW+T LLGVA CL M FL S   + G   L  ++  +L  R    SWG +SQALLFHQVRKYLL +D+RK+HVK+WRPQ+LLL+ NPR
Sbjct:   89 SVCAIATNGAVQGGGAYFMISRTLGPEVGGSIGLMFYLANVCGCAVSLLGLVESVLDVFGADATGPSGLRVLPQGYGWNLLYGSLLLGLVGGVCTLGAGLYARASFLTFLLVSGSLASVLISFVAVGPRDIRLTPRPGPN----GSSLPPRFGHFTGFNSSTLKDNLGAGYAEDYTTGAVMNFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRTLLQEDYGFFRAISLWPPLVLIGIYATALSASMSSLIGASRILHALARDDLFGVILAPAKVVSRGGNPWAAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLAALLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPR 542          

HSP 2 Score: 90.5077 bits (223), Expect = 1.244e-17
Identity = 65/245 (26.53%), Postives = 109/245 (44.49%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEH--NVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFH-----------------VSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKV 3244
            +YV  +AD +KM KN+ L R    +  + +   +  +S+  ++DVWP+N  +P G   Y+D   +F+LQ++ IL M   W S  ++R+++CL     G  E     +G    LL+Q RI+AE++ V W +     E     +    N+   + +          +   +  N L++                     P TA+ F YLP  P       + +Y+  L  LT DL P++ V G   V
Sbjct:  682 DYVATVADALKMNKNVVLARASGALPPERLSRGSGGTSQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILGMVPAWHS-ARLRIFLCL-----GPREAPGAAEGRLRALLSQLRIRAEVQEVVWGEGAGAGEPEAEEEGDFVNSGRGDAEA---------EALARSANALVRAQQGRGTGGGPGGPEGGDAEGPITALTFLYLPRPP--ADPARYPRYLALLETLTRDLGPTLLVHGVTPV 909          

HSP 3 Score: 57.7658 bits (138), Expect = 1.415e-7
Identity = 22/53 (41.51%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+D
Sbjct:  587 SLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQD 639          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Human
Match: SLC12A9 (solute carrier family 12 member 9 [Source:HGNC Symbol;Acc:HGNC:17435])

HSP 1 Score: 345.125 bits (884), Expect = 3.819e-106
Identity = 201/421 (47.74%), Postives = 280/421 (66.51%), Query Frame = 1
Query:  772 FLANVFSSALFMAAFVEGL-VDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQV---PIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR 2022
            FL  V  + L M + V  L +D  GP G     ++ + +GWN L+ + +     GVC +G  L+A+ +   F++V     SV++SF+      +   P P  N     +S   +FG++TG + +T  +NL A Y  D+TT   M F +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  Y++ FFLS+ TCDR LL  +Y F +A +LW P V+IG++ T +SA++ + IGASRIL ALA+DD+FG+ L PAK+ ++GGNP  +V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C  L+WA+A NFRPTF  FSW+T LLGVA CL M FL S   + G   L  ++  +L  R    SWG +SQALLFHQVRKYLL +D+RK+HVK+WRPQ+LLL+ NPR
Sbjct:   40 FLGVVVPTVLSMFSIVVFLRIDATGPSG---LRVLPQGYGWNLLYGSLLLGLVGGVCTLGAGLYARASFLTFLLVSGSLASVLISFVAVGPRDIRLTPRPGPN----GSSLPPRFGHFTGFNSSTLKDNLGAGYAEDYTTGAVMNFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRTLLQEDYGFFRAISLWPPLVLIGIYATALSASMSSLIGASRILHALARDDLFGVILAPAKVVSRGGNPWAAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLAALLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPR 453          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Human
Match: SLC12A9 (solute carrier family 12 member 9 [Source:HGNC Symbol;Acc:HGNC:17435])

HSP 1 Score: 207.223 bits (526), Expect = 6.746e-60
Identity = 101/184 (54.89%), Postives = 139/184 (75.54%), Query Frame = 1
Query: 1153 ANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLAC 1704
            A Y  D+TT   M F +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  Y++ FFLS+ TCDR LL  +Y F +A +LW P V+IG++ T +SA++ + IGASRIL ALA+DD+FG+ L PAK+ ++GGNP  +V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C
Sbjct:   61 AGYAEDYTTGAVMNFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRTLLQEDYGFFRAISLWPPLVLIGIYATALSASMSSLIGASRILHALARDDLFGVILAPAKVVSRGGNPWAAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSC 244          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Human
Match: SLC12A9 (solute carrier family 12 member 9 [Source:HGNC Symbol;Acc:HGNC:17435])

HSP 1 Score: 174.481 bits (441), Expect = 1.047e-49
Identity = 86/156 (55.13%), Postives = 117/156 (75.00%), Query Frame = 1
Query: 1189 MTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPV 1656
            M F +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  Y++ FFLS+ TCDR LL  +Y F +A +LW P V+IG++ T +SA++ + IGASRIL ALA+DD+FG+ L PAK+ ++GGNP  +V+ S+ LVQ+VLL GK+N +A V
Sbjct:    1 MNFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRTLLQEDYGFFRAISLWPPLVLIGIYATALSASMSSLIGASRILHALARDDLFGVILAPAKVVSRGGNPWAAVLYSWGLVQLVLLAGKLNTLAAV 156          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Celegans
Match: T04B8.5 (pep chromosome:WBcel235:II:614767:620909:-1 gene:WBGene00020207.1 transcript:T04B8.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04B8.5)

HSP 1 Score: 385.956 bits (990), Expect = 6.293e-118
Identity = 218/468 (46.58%), Postives = 310/468 (66.24%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVY--------------SNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAIS+NGA++GGGVY+MISR+LGPE GG+IG+LFF+ANVFS AL+++ F E L+++ G     D+        W +++   V +  L + L+G +LFAKT L  F+++ VC+ + IVS +F+   +V IPK+NT  Y               + N+T   NYTG S  T   N++  YT+D+TT+K   F  +FAI+F GVTG+M GANMSGEL +P+VSIPRGT+ A   T   Y+++ FL A T  R+LL N+Y  M  TN  + F++IG+F T + +++ N IG+SR+L  L+ D +FG  L+PAK+     NP+ SVVI+++ V +V L+G +N IA + S+FFLL+Y  VN+A   L+  +A NFRPTFKYFSW T  LGV     M  +     S     +   +I++L++++   S GSISQAL++HQVRKYLL++D+RKEHVKYWRPQILLL+S P S
Sbjct:   63 SLCAISSNGAVEGGGVYYMISRSLGPEFGGAIGVLFFVANVFSCALYISGFTEALMNNIGNGQFPDSP------AWRFVYCVLVSLVLLVLSLLGSALFAKTALITFVLISVCYGTWIVSVIFNGRMEVLIPKVNTPAYRVLVNASDPSQGTVEDFNQTLTANYTGWSFHTLGENMFPEYTMDYTTEKPTDFALMFAIIFSGVTGLMAGANMSGELARPSVSIPRGTVQAVFMTLFVYVMTAFLMATTSSRYLLQNDYTVMMDTNFHRVFILIGIFSTTLFSSMSNLIGSSRVLNRLSHDKLFGCLLRPAKIEIGDRNPVVSVVITWMCVVLVFLVGAMNKIAKLTSIFFLLSYMGVNVATLALELTSAPNFRPTFKYFSWQTCALGVVATATMMLVVDASMSALGVVVLMSLIMVLHYQAPSVSSGSISQALIYHQVRKYLLLLDVRKEHVKYWRPQILLLVSRPAS 524          

HSP 2 Score: 130.183 bits (326), Expect = 2.391e-30
Identity = 75/237 (31.65%), Postives = 130/237 (54.85%), Query Frame = 2
Query: 2552 NNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPG-SGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            N ++++ V+YV ++ D + M KN+C+ RHF  +D   L    + + +YIDVWP++  +P  +G   DN+ +F+LQLSCIL+MS++W S  K+RV+IC++        H  +     +L   RI+ E   V WD ++ + +        SANT +  +         LP  Y+   N+++K + S + A+    LP+ P+        +Y++ +  LT+ LPP++ V G   VI++AL
Sbjct:  659 NLERLTPVDYVNVLKDVLHMTKNLCVARHFSKLDKEALARGWNGQKRYIDVWPVDLQKPQETGLGWDNSSLFLLQLSCILSMSSRWRSYTKLRVFICVNSL---QDMHRRERQLKNMLQTLRIEGESSVVPWDHVVCHYQPP--NATASANTATPSVD--------LPPAYVSAFNDMVKRY-SEDAAITLLNLPVPPDNADIDA-DRYLEMVRNLTDALPPTLLVHGVSSVISTAL 880          

HSP 3 Score: 50.447 bits (119), Expect = 7.405e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query: 2048 DFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKK 2209
            D+LK+KAF+++T++  IR G +QL  L GLG +  NTV IGF + +  +  L++
Sbjct:  572 DYLKLKAFVELTMSNNIRHGIQQLMRLSGLGAMKPNTVVIGFHELAPSQVTLQE 625          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Celegans
Match: T04B8.5 (pep chromosome:WBcel235:II:614770:621330:-1 gene:WBGene00020207.1 transcript:T04B8.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04B8.5)

HSP 1 Score: 385.571 bits (989), Expect = 3.323e-117
Identity = 217/468 (46.37%), Postives = 310/468 (66.24%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVY--------------SNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAIS+NGA++GGGVY+MISR+LGPE GG+IG+LFF+ANVFS AL+++ F E L+++ G           ++  W +++   V +  L + L+G +LFAKT L  F+++ VC+ + IVS +F+   +V IPK+NT  Y               + N+T   NYTG S  T   N++  YT+D+TT+K   F  +FAI+F GVTG+M GANMSGEL +P+VSIPRGT+ A   T   Y+++ FL A T  R+LL N+Y  M  TN  + F++IG+F T + +++ N IG+SR+L  L+ D +FG  L+PAK+     NP+ SVVI+++ V +V L+G +N IA + S+FFLL+Y  VN+A   L+  +A NFRPTFKYFSW T  LGV     M  +     S     +   +I++L++++   S GSISQAL++HQVRKYLL++D+RKEHVKYWRPQILLL+S P S
Sbjct:  122 SLCAISSNGAVEGGGVYYMISRSLGPEFGGAIGVLFFVANVFSCALYISGFTEALMNNIG------NGQFPDSPAWRFVYCVLVSLVLLVLSLLGSALFAKTALITFVLISVCYGTWIVSVIFNGRMEVLIPKVNTPAYRVLVNASDPSQGTVEDFNQTLTANYTGWSFHTLGENMFPEYTMDYTTEKPTDFALMFAIIFSGVTGLMAGANMSGELARPSVSIPRGTVQAVFMTLFVYVMTAFLMATTSSRYLLQNDYTVMMDTNFHRVFILIGIFSTTLFSSMSNLIGSSRVLNRLSHDKLFGCLLRPAKIEIGDRNPVVSVVITWMCVVLVFLVGAMNKIAKLTSIFFLLSYMGVNVATLALELTSAPNFRPTFKYFSWQTCALGVVATATMMLVVDASMSALGVVVLMSLIMVLHYQAPSVSSGSISQALIYHQVRKYLLLLDVRKEHVKYWRPQILLLVSRPAS 583          

HSP 2 Score: 130.954 bits (328), Expect = 1.548e-30
Identity = 75/237 (31.65%), Postives = 130/237 (54.85%), Query Frame = 2
Query: 2552 NNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPG-SGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            N ++++ V+YV ++ D + M KN+C+ RHF  +D   L    + + +YIDVWP++  +P  +G   DN+ +F+LQLSCIL+MS++W S  K+RV+IC++        H  +     +L   RI+ E   V WD ++ + +        SANT +  +         LP  Y+   N+++K + S + A+    LP+ P+        +Y++ +  LT+ LPP++ V G   VI++AL
Sbjct:  718 NLERLTPVDYVNVLKDVLHMTKNLCVARHFSKLDKEALARGWNGQKRYIDVWPVDLQKPQETGLGWDNSSLFLLQLSCILSMSSRWRSYTKLRVFICVNSL---QDMHRRERQLKNMLQTLRIEGESSVVPWDHVVCHYQPP--NATASANTATPSVD--------LPPAYVSAFNDMVKRY-SEDAAITLLNLPVPPDNADIDA-DRYLEMVRNLTDALPPTLLVHGVSSVISTAL 939          

HSP 3 Score: 50.8322 bits (120), Expect = 7.103e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query: 2048 DFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKK 2209
            D+LK+KAF+++T++  IR G +QL  L GLG +  NTV IGF + +  +  L++
Sbjct:  631 DYLKLKAFVELTMSNNIRHGIQQLMRLSGLGAMKPNTVVIGFHELAPSQVTLQE 684          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Celegans
Match: T04B8.5 (pep chromosome:WBcel235:II:614770:624543:-1 gene:WBGene00020207.1 transcript:T04B8.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T04B8.5)

HSP 1 Score: 385.956 bits (990), Expect = 3.423e-117
Identity = 217/468 (46.37%), Postives = 310/468 (66.24%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVY--------------SNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAIS+NGA++GGGVY+MISR+LGPE GG+IG+LFF+ANVFS AL+++ F E L+++ G           ++  W +++   V +  L + L+G +LFAKT L  F+++ VC+ + IVS +F+   +V IPK+NT  Y               + N+T   NYTG S  T   N++  YT+D+TT+K   F  +FAI+F GVTG+M GANMSGEL +P+VSIPRGT+ A   T   Y+++ FL A T  R+LL N+Y  M  TN  + F++IG+F T + +++ N IG+SR+L  L+ D +FG  L+PAK+     NP+ SVVI+++ V +V L+G +N IA + S+FFLL+Y  VN+A   L+  +A NFRPTFKYFSW T  LGV     M  +     S     +   +I++L++++   S GSISQAL++HQVRKYLL++D+RKEHVKYWRPQILLL+S P S
Sbjct:  135 SLCAISSNGAVEGGGVYYMISRSLGPEFGGAIGVLFFVANVFSCALYISGFTEALMNNIG------NGQFPDSPAWRFVYCVLVSLVLLVLSLLGSALFAKTALITFVLISVCYGTWIVSVIFNGRMEVLIPKVNTPAYRVLVNASDPSQGTVEDFNQTLTANYTGWSFHTLGENMFPEYTMDYTTEKPTDFALMFAIIFSGVTGLMAGANMSGELARPSVSIPRGTVQAVFMTLFVYVMTAFLMATTSSRYLLQNDYTVMMDTNFHRVFILIGIFSTTLFSSMSNLIGSSRVLNRLSHDKLFGCLLRPAKIEIGDRNPVVSVVITWMCVVLVFLVGAMNKIAKLTSIFFLLSYMGVNVATLALELTSAPNFRPTFKYFSWQTCALGVVATATMMLVVDASMSALGVVVLMSLIMVLHYQAPSVSSGSISQALIYHQVRKYLLLLDVRKEHVKYWRPQILLLVSRPAS 596          

HSP 2 Score: 130.568 bits (327), Expect = 1.650e-30
Identity = 75/237 (31.65%), Postives = 130/237 (54.85%), Query Frame = 2
Query: 2552 NNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPG-SGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            N ++++ V+YV ++ D + M KN+C+ RHF  +D   L    + + +YIDVWP++  +P  +G   DN+ +F+LQLSCIL+MS++W S  K+RV+IC++        H  +     +L   RI+ E   V WD ++ + +        SANT +  +         LP  Y+   N+++K + S + A+    LP+ P+        +Y++ +  LT+ LPP++ V G   VI++AL
Sbjct:  731 NLERLTPVDYVNVLKDVLHMTKNLCVARHFSKLDKEALARGWNGQKRYIDVWPVDLQKPQETGLGWDNSSLFLLQLSCILSMSSRWRSYTKLRVFICVNSL---QDMHRRERQLKNMLQTLRIEGESSVVPWDHVVCHYQPP--NATASANTATPSVD--------LPPAYVSAFNDMVKRY-SEDAAITLLNLPVPPDNADIDA-DRYLEMVRNLTDALPPTLLVHGVSSVISTAL 952          

HSP 3 Score: 50.447 bits (119), Expect = 8.166e-6
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 2
Query: 2048 DFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKK 2209
            D+LK+KAF+++T++  IR G +QL  L GLG +  NTV IGF + +  +  L++
Sbjct:  644 DYLKLKAFVELTMSNNIRHGIQQLMRLSGLGAMKPNTVVIGFHELAPSQVTLQE 697          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Celegans
Match: nkcc-1 (Na-K-Cl Cotransporter homolog [Source:UniProtKB/TrEMBL;Acc:L8E912])

HSP 1 Score: 216.083 bits (549), Expect = 1.981e-57
Identity = 155/488 (31.76%), Postives = 244/488 (50.00%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFG-------WN-YLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRF------LLWNN-------------------YLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            S CAI TNG +KGGG YF+ISR+LGPE GGSIGI+F +AN   +A+++  F E   D           LI  N G       W+  +     C+  +G+  +G    +K  L + +I+ V                      N +  S     +     G +G + ++ L +N+   FT     TFF+VF++ FP  TGIM GAN+SG+L  P  +IP GTL A L T I Y+++ +++ +T   F       ++NN                   Y  ++ ++ W P +  G+F   +S+AL + + A ++  A+ +D +F      AK   K   P  + V+ F L   ++ IG +NVIAP++S FFL +YA +N AC    +A +  FRP F Y++ + SL+G   C+ + F+  +  +L  F  F  I + L  R  D +WGS +QA  +      ++ +   +EHVK +RPQ+L+L  NP S+
Sbjct:  296 STCAICTNGDVKGGGAYFLISRSLGPEFGGSIGIIFSIANAVGAAMYIVGFAESFRDV----------LIDYNIGTIFDGGLWDVRVIGFVTCVILMGIVFIGSEFESKMQLGLLVILLVSIA-------------------NYVFGSFFPPNEIAMNRGATGYS-LDTLQSNFMPHFTENN--TFFSVFSVYFPAATGIMAGANISGDLANPQQAIPLGTLLAILVTTIVYLLTVWMTGSTVVAFSNGTEPAVFNNSYFVPPDCTPDCPFGLVSYYQVVEMSSFWGPLITAGIFAATLSSALASLVSAPKVFQAVCKDRLFPRIDYFAKTYGKNEEPKRAYVLGFFLAMGIVAIGDLNVIAPIISNFFLGSYALINYACFDQSFADSPGFRPGFTYYNMWISLVGALLCVFVMFIIDWFSALVTFFCFGAIFMYLLHRKPDVNWGSSTQAHSYKNALSAMIKLSTTEEHVKNYRPQVLVLSGNPASR 751          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Celegans
Match: nkcc-1 (Na-K-Cl Cotransporter homolog [Source:UniProtKB/TrEMBL;Acc:L8E912])

HSP 1 Score: 215.698 bits (548), Expect = 5.978e-57
Identity = 155/488 (31.76%), Postives = 244/488 (50.00%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFG-------WN-YLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRF------LLWNN-------------------YLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            S CAI TNG +KGGG YF+ISR+LGPE GGSIGI+F +AN   +A+++  F E   D           LI  N G       W+  +     C+  +G+  +G    +K  L + +I+ V                      N +  S     +     G +G + ++ L +N+   FT     TFF+VF++ FP  TGIM GAN+SG+L  P  +IP GTL A L T I Y+++ +++ +T   F       ++NN                   Y  ++ ++ W P +  G+F   +S+AL + + A ++  A+ +D +F      AK   K   P  + V+ F L   ++ IG +NVIAP++S FFL +YA +N AC    +A +  FRP F Y++ + SL+G   C+ + F+  +  +L  F  F  I + L  R  D +WGS +QA  +      ++ +   +EHVK +RPQ+L+L  NP S+
Sbjct:  272 STCAICTNGDVKGGGAYFLISRSLGPEFGGSIGIIFSIANAVGAAMYIVGFAESFRDV----------LIDYNIGTIFDGGLWDVRVIGFVTCVILMGIVFIGSEFESKMQLGLLVILLVSIA-------------------NYVFGSFFPPNEIAMNRGATGYS-LDTLQSNFMPHFTENN--TFFSVFSVYFPAATGIMAGANISGDLANPQQAIPLGTLLAILVTTIVYLLTVWMTGSTVVAFSNGTEPAVFNNSYFVPPDCTPDCPFGLVSYYQVVEMSSFWGPLITAGIFAATLSSALASLVSAPKVFQAVCKDRLFPRIDYFAKTYGKNEEPKRAYVLGFFLAMGIVAIGDLNVIAPIISNFFLGSYALINYACFDQSFADSPGFRPGFTYYNMWISLVGALLCVFVMFIIDWFSALVTFFCFGAIFMYLLHRKPDVNWGSSTQAHSYKNALSAMIKLSTTEEHVKNYRPQVLVLSGNPASR 727          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Fly
Match: CG10413 (gene:FBgn0032689 transcript:FBtr0343829)

HSP 1 Score: 386.726 bits (992), Expect = 1.548e-117
Identity = 234/463 (50.54%), Postives = 308/463 (66.52%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRV---DADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQ--VPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTK-KYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRS---LDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGAI+GGGVYFMISRTLG E GGSIG LFF ANV  SA+ ++   EG++D+FGP G     D+ L   ++ W +L ++ +    L VCLVG +LFAKT++ I   V VC F+   SFLF  A    +P+P  N +    SN T F +YTGL+ TT  +NL ++Y  D+T+  K + F T F +LF GVTGIM GANMSGEL  P+ SIP GTL+A  FTF+ YII  FL + T   F + NNYLF+   NLW PF  IG+     S +L N IG+SRIL AL++D +FG  L      T  GNPI +V +S+ LV+ +LLIG  N+IA + SV F+L+Y + NLAC  ++   A NFRP FK+F+W+T L+G+   L M F+ ++IY+     L  I+++ L+  S       WGSISQAL+FHQVRKYLLM+D RK+HVK+WRPQILLL+S+PRS
Sbjct:  117 SVCAISTNGAIEGGGVYFMISRTLGLEFGGSIGTLFFFANVVGSAMAISGCTEGIMDNFGPRGHFVSGDSHLPDGDW-WRFLTSSMINTLQLLVCLVGAALFAKTSVIILATVTVCLFATYFSFLFVGATNNTIPVPGDNIL----SNTTTFLDYTGLNATTLRDNLGSHYGRDYTSNGKQVDFSTTFGVLFSGVTGIMAGANMSGELKNPSKSIPYGTLSAVAFTFVSYIILSFLMSCTTPYFTMQNNYLFLMPVNLWPPFTAIGILTATFSTSLSNLIGSSRILEALSKDQVFGSLLNFVIHGTWKGNPIAAVAVSWCLVECILLIGSFNIIAQINSVLFMLSYLATNLACLGIELTGAPNFRPLFKFFTWHTCLVGLLGTLIMMFVINFIYASSCIILCLILVIALHLFSPATQAAQWGSISQALMFHQVRKYLLMLDPRKDHVKFWRPQILLLVSSPRS 574          

HSP 2 Score: 105.531 bits (262), Expect = 1.409e-22
Identity = 80/247 (32.39%), Postives = 122/247 (49.39%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICL--DYYTIGTTEHNVQGL-------WNELLNQWRIQA---EIKTVGWDDIMVNLEANLGGKIMSANTL----SDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGT---SQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            EYV I+ D ++M+KN+CLCR+F+ +D   +  S S   +YIDVWPIN F P SG   D   +FM+QL+ I  M A+W    ++R+++C   D  T+GT +     +         + L + RI A   EI+    D         L      A+ +     DE+   +L    L   Y++  N +I+   S  TA+ F YL   P +     +Q    Y++ LT LT DLPP++ V G   V ++ L
Sbjct:  704 EYVQILCDTLRMKKNLCLCRNFQRLDKNFI--SMSKHVKYIDVWPINIFNPTSGDPFDMVSLFMMQLAVI--MLAKW-KHLRVRIFLCEANDERTVGTFDTQTPQMEIFSKMKLEQSLKELRITADIVEIQEWSRDTDFSRHARTLKQFTAQADNVVLEDDDEVGEETLNRSLL---YMQRANQIIR-ERSDQTALSFIYLAAPPKLSAPDFAQRSASYMELLTELTADLPPTILVHGVSTVTSTTL 941          

HSP 3 Score: 51.9878 bits (123), Expect = 3.669e-6
Identity = 25/83 (30.12%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2048 DFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSF 2296
            D +++KAF +VT++ +IR+G + L  L G+G +  NT+ +GF D   P+D  +      N  +P+     + +    G++Q+F
Sbjct:  618 DHMRVKAFTEVTLSRSIREGVQHLIRLSGIGAMKPNTIILGFYDSEAPRDFFQ------NGSSPY-----KTDDFNNGEIQNF 689          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Fly
Match: CG10413 (gene:FBgn0032689 transcript:FBtr0081080)

HSP 1 Score: 386.726 bits (992), Expect = 1.548e-117
Identity = 234/463 (50.54%), Postives = 308/463 (66.52%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRV---DADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQ--VPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTK-KYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRS---LDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGAI+GGGVYFMISRTLG E GGSIG LFF ANV  SA+ ++   EG++D+FGP G     D+ L   ++ W +L ++ +    L VCLVG +LFAKT++ I   V VC F+   SFLF  A    +P+P  N +    SN T F +YTGL+ TT  +NL ++Y  D+T+  K + F T F +LF GVTGIM GANMSGEL  P+ SIP GTL+A  FTF+ YII  FL + T   F + NNYLF+   NLW PF  IG+     S +L N IG+SRIL AL++D +FG  L      T  GNPI +V +S+ LV+ +LLIG  N+IA + SV F+L+Y + NLAC  ++   A NFRP FK+F+W+T L+G+   L M F+ ++IY+     L  I+++ L+  S       WGSISQAL+FHQVRKYLLM+D RK+HVK+WRPQILLL+S+PRS
Sbjct:  117 SVCAISTNGAIEGGGVYFMISRTLGLEFGGSIGTLFFFANVVGSAMAISGCTEGIMDNFGPRGHFVSGDSHLPDGDW-WRFLTSSMINTLQLLVCLVGAALFAKTSVIILATVTVCLFATYFSFLFVGATNNTIPVPGDNIL----SNTTTFLDYTGLNATTLRDNLGSHYGRDYTSNGKQVDFSTTFGVLFSGVTGIMAGANMSGELKNPSKSIPYGTLSAVAFTFVSYIILSFLMSCTTPYFTMQNNYLFLMPVNLWPPFTAIGILTATFSTSLSNLIGSSRILEALSKDQVFGSLLNFVIHGTWKGNPIAAVAVSWCLVECILLIGSFNIIAQINSVLFMLSYLATNLACLGIELTGAPNFRPLFKFFTWHTCLVGLLGTLIMMFVINFIYASSCIILCLILVIALHLFSPATQAAQWGSISQALMFHQVRKYLLMLDPRKDHVKFWRPQILLLVSSPRS 574          

HSP 2 Score: 105.531 bits (262), Expect = 1.409e-22
Identity = 80/247 (32.39%), Postives = 122/247 (49.39%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICL--DYYTIGTTEHNVQGL-------WNELLNQWRIQA---EIKTVGWDDIMVNLEANLGGKIMSANTL----SDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGT---SQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            EYV I+ D ++M+KN+CLCR+F+ +D   +  S S   +YIDVWPIN F P SG   D   +FM+QL+ I  M A+W    ++R+++C   D  T+GT +     +         + L + RI A   EI+    D         L      A+ +     DE+   +L    L   Y++  N +I+   S  TA+ F YL   P +     +Q    Y++ LT LT DLPP++ V G   V ++ L
Sbjct:  704 EYVQILCDTLRMKKNLCLCRNFQRLDKNFI--SMSKHVKYIDVWPINIFNPTSGDPFDMVSLFMMQLAVI--MLAKW-KHLRVRIFLCEANDERTVGTFDTQTPQMEIFSKMKLEQSLKELRITADIVEIQEWSRDTDFSRHARTLKQFTAQADNVVLEDDDEVGEETLNRSLL---YMQRANQIIR-ERSDQTALSFIYLAAPPKLSAPDFAQRSASYMELLTELTADLPPTILVHGVSTVTSTTL 941          

HSP 3 Score: 51.9878 bits (123), Expect = 3.669e-6
Identity = 25/83 (30.12%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2048 DFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSF 2296
            D +++KAF +VT++ +IR+G + L  L G+G +  NT+ +GF D   P+D  +      N  +P+     + +    G++Q+F
Sbjct:  618 DHMRVKAFTEVTLSRSIREGVQHLIRLSGIGAMKPNTIILGFYDSEAPRDFFQ------NGSSPY-----KTDDFNNGEIQNF 689          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Fly
Match: NKCC (gene:FBgn0051547 transcript:FBtr0078765)

HSP 1 Score: 192.971 bits (489), Expect = 3.669e-53
Identity = 141/484 (29.13%), Postives = 232/484 (47.93%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGN-YTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDR----------------------------FLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            S+ AISTNG +KGGGVYF+ISR+LGPE G S+G++F  AN  S+++    F E L      L   D  ++        +  +   +  + +C VG     K   F+ + + +  F+ +               I   +    NE Q    + G S  T   N  ++Y   +       FF+VFAI FP VTGI  GAN+ G+L     +IP+GT  + L +   Y +    +     R                            + L+N+Y  MQ  +LW P +  G F   +S AL N +   R++ AL  D I+   +  +K   K G P    V++F +    LLIG++N+IAP++S F+L +YA +N       +     +RPTFKY++ + SL G A C+ + FL +Y+ ++  F + F + +++ +R  + +WGS +QA  +      +  +    +HVK + PQ+L+L  +P+++
Sbjct:  115 SLSAISTNGEVKGGGVYFIISRSLGPEFGASVGVVFAFANAVSASMNTIGFCESLNV---LLKNNDLKIVDNGINDIRIVGSITVLVLILICCVGMEWETKAQNFLIVTIVLAIFNFL---------------IGAAIGPQGNEEQISRGFVGFSWATLKENFGSDYR--YAEGVNHDFFSVFAIFFPSVTGIQAGANICGDLKDAGAAIPKGTFWSLLISMSSYALFVLFAGGAAVRDASGIPADLVNGTIVSSELPCMATGNCTWGLFNSYEMMQEMSLWGPLIYAGCFAATLSTALTNLLSVPRLVQALGIDQIYPGLIFFSKPYGKHGEPYRGYVLTFFITTGFLLIGELNLIAPLISTFYLASYALINFCTFHAAFVKPLGWRPTFKYYNAWLSLFGFAMCVAIMFLINYVAAIITFGIIFALYLVVMYRKPEANWGSTTQAQQYKAALMAVHRLQNVSDHVKNYHPQVLVLSGDPKTR 578          

HSP 2 Score: 36.965 bits (84), Expect = 3.669e-53
Identity = 19/55 (34.55%), Postives = 30/55 (54.55%), Query Frame = 2
Query: 2018 HAVRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDD 2182
            H V++  K  D  KIKAF +V    ++ DG   L+   G G ++ N V +G++ D
Sbjct:  612 HLVKDGQKYLDARKIKAFYNVIDGFSLEDGINALTKSTGFGKMSPNIVLVGYKPD 666          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Fly
Match: NKCC (gene:FBgn0051547 transcript:FBtr0078764)

HSP 1 Score: 191.815 bits (486), Expect = 5.830e-53
Identity = 141/484 (29.13%), Postives = 232/484 (47.93%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGN-YTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDR----------------------------FLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            S+ AISTNG +KGGGVYF+ISR+LGPE G S+G++F  AN  S+++    F E L      L   D  ++        +  +   +  + +C VG     K   F+ + + +  F+ +               I   +    NE Q    + G S  T   N  ++Y   +       FF+VFAI FP VTGI  GAN+ G+L     +IP+GT  + L +   Y +    +     R                            + L+N+Y  MQ  +LW P +  G F   +S AL N +   R++ AL  D I+   +  +K   K G P    V++F +    LLIG++N+IAP++S F+L +YA +N       +     +RPTFKY++ + SL G A C+ + FL +Y+ ++  F + F + +++ +R  + +WGS +QA  +      +  +    +HVK + PQ+L+L  +P+++
Sbjct:  188 SLSAISTNGEVKGGGVYFIISRSLGPEFGASVGVVFAFANAVSASMNTIGFCESL---NVLLKNNDLKIVDNGINDIRIVGSITVLVLILICCVGMEWETKAQNFLIVTIVLAIFNFL---------------IGAAIGPQGNEEQISRGFVGFSWATLKENFGSDYR--YAEGVNHDFFSVFAIFFPSVTGIQAGANICGDLKDAGAAIPKGTFWSLLISMSSYALFVLFAGGAAVRDASGIPADLVNGTIVSSELPCMATGNCTWGLFNSYEMMQEMSLWGPLIYAGCFAATLSTALTNLLSVPRLVQALGIDQIYPGLIFFSKPYGKHGEPYRGYVLTFFITTGFLLIGELNLIAPLISTFYLASYALINFCTFHAAFVKPLGWRPTFKYYNAWLSLFGFAMCVAIMFLINYVAAIITFGIIFALYLVVMYRKPEANWGSTTQAQQYKAALMAVHRLQNVSDHVKNYHPQVLVLSGDPKTR 651          

HSP 2 Score: 37.3502 bits (85), Expect = 5.830e-53
Identity = 19/55 (34.55%), Postives = 30/55 (54.55%), Query Frame = 2
Query: 2018 HAVRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDD 2182
            H V++  K  D  KIKAF +V    ++ DG   L+   G G ++ N V +G++ D
Sbjct:  685 HLVKDGQKYLDARKIKAFYNVIDGFSLEDGINALTKSTGFGKMSPNIVLVGYKPD 739          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Fly
Match: Ncc69 (gene:FBgn0036279 transcript:FBtr0333842)

HSP 1 Score: 167.162 bits (422), Expect = 1.460e-41
Identity = 107/347 (30.84%), Postives = 182/347 (52.45%), Query Frame = 1
Query: 1063 INTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDR-------------------------FLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            I + +   S+      + G + T F NNL+A+Y  +    ++  FF+VFAI FP  TGI+ GAN+SG+L  P  SIP+GT+ A + T   Y+I      AT  R                         + L N++  ++  + + P +  G +   +S+AL + + A ++  AL +D+++   +  AK   K   P+   V++F++    +LIG++N+IAP++S FFL AY  +N +      A    +RPTFKY++ + SLLG   C+ + FL S+  +L  F+    + +I+ +R  D +WGS +QA  +      +  ++  +EHVK +RPQIL+L   P ++
Sbjct:  379 IGSFIGPKSDAEMAKGFLGYNATLFKNNLFADYRPEKGGIQH-DFFSVFAIFFPAATGILAGANISGDLKDPQKSIPKGTILAIVITTGTYLIMVLQCGATVARDATGNLSDVVNGTFAFLDCQPGECNYGLQNSFQVIELVSAFGPLIYAGCYAATLSSALASLVSAPKVFQALCKDELYPKIVWFAKGYGKNNEPVRGYVLTFIIACAFILIGELNLIAPLISNFFLAAYMLINFSTFHASLAKPVGWRPTFKYYNMWLSLLGAILCVAVMFLISWATALITFAAVLALYLIVAYRKPDVNWGSTTQAQTYKNALMSVQQLNNVEEHVKNYRPQILVLSGLPNTR 724          

HSP 2 Score: 73.9442 bits (180), Expect = 7.786e-13
Identity = 33/56 (58.93%), Postives = 44/56 (78.57%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLV 831
            S+ AISTNG IKGGG Y+MISR+LGPE GGSIG++F LAN  + A+++  F E ++
Sbjct:  264 SMSAISTNGVIKGGGTYYMISRSLGPEFGGSIGLIFSLANAVACAMYVVGFCESML 319          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Zebrafish
Match: zgc:153039 (zgc:153039 [Source:ZFIN;Acc:ZDB-GENE-060929-736])

HSP 1 Score: 414.846 bits (1065), Expect = 5.405e-154
Identity = 238/463 (51.40%), Postives = 321/463 (69.33%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVE------GLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNET---QFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLANV  SAL++   VE      GL DD G L    + ++   + W+ L+ T + + C+ VCLVG  ++AK    IFIIV V   ++ +SF     F VP     T+    SN T      N+TG    T   NL A+YT+D+TTK  M+F TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FTFI Y +   L + TCDR LL  +Y F++  N+W PFV +G++ + +SAA+ N IGASRILFALA+DD+FG  L PAK T+  GNP  SV+IS+ LVQ+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C  M FL + IY+    +   ++++++++ S   SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQ+LL++SNPRS
Sbjct:  108 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFLANVCGSALYVLGLVEAVLTTFGLPDD-GSLSMSRSAVLPVGYWWSLLYGTVILLLCVLVCLVGAHIYAKATFLIFIIVMVVLGTIFISF-----FAVPF---RTVQLPGSNSTIGPSRANFTGFKLDTLTGNLQADYTLDYTTKAMMSFATVFAVMFNGCTGIMAGSNMSGDLKNPSYSIPRGTITAVIFTFIIYNLLSLLISCTCDRILLQKDYGFLRDINVWGPFVTVGVYSSTLSAAMSNLIGASRILFALAKDDLFGRVLSPAKRTSASGNPWVSVLISWFLVQLVLFSGKLNTIASIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCVLGIIGCAVMMFLINAIYASASIAFMLLLLLLIHYLSPVSSWGCISQALIFHQVRKYLLMLDVRKDHVKFWRPQVLLMVSNPRS 561          

HSP 2 Score: 152.14 bits (383), Expect = 5.405e-154
Identity = 122/427 (28.57%), Postives = 186/427 (43.56%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQ---YIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMV-------NLEANLGGKIMSANTLSDEIKTISLFDCTLP-------DTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            ++  + D L IKAF+++T+A +IR G + L  + GLGG+  NT+ +GF DD+ P+D L+                                    S   SK +  S+   D E+ +                 +P F    PP+R       G +        Q                  EYV IIAD +KM KN+ L R+F   D       ++   Q   ++DVWP+N  +P S +Y+D   +F+LQL+CILNM+  W  K ++R+++C++    G +    +     LL   R++A+I TV WD  +         L+ N   K     +    ++    F  + P       D YL+ VN LI        AV F YLP  P   TS+Y   Y++QL LLT DL P++ + G   VIT+ L
Sbjct:  602 SWLSLVDHLNIKAFVNLTLADSIRHGVQHLLFISGLGGMRPNTLVLGFYDDASPQDQLQD----------------------------------SSLSMSKFLDNSSQNEDPEDQD-----------------EPPF--HFPPVRGGVAVGRGAVWGGKSLGPQ------------------EYVCIIADAVKMLKNVALARYFGQFD-------HTHALQGPIFVDVWPVNLLRPDSAAYVDTCSLFLLQLACILNMTRAW-QKARLRLFLCVEE---GRSLKGTEQKLGHLLKDLRMKADICTVPWDSEVALHWQRQTRLDRNE--KEEELESEEGGVEADKFFSNSFPSNTSRVSDEYLQAVNKLILEQKLRPPAVRFLYLP-RPPADTSRY-SDYLNQLELLTRDLGPTLLIHGVTPVITTDL 942          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Zebrafish
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 382.104 bits (980), Expect = 3.656e-116
Identity = 220/461 (47.72%), Postives = 316/461 (68.55%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDADL--IQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTN--XXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNE-TQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            SICAISTNGA++GGG YFMISR+LGPE GGSIG++F+LA V +  +++   VE ++D FG  P   V   L  + + + +  L+++ V + C+ VCLVG  ++AK +  + + + V +    +    +  + F +      T  Y N++  T   +YTG + TT  NNL   Y++D++T   M+F TVFA++F   TGIM GANMSGEL  P+ SIP+GT+ A  +TF  Y++ + L ++TCDR LL N+Y   Q  N+W PFV IG++   +SAA+ + IGASRIL ALA D +FG+ L PA +T+  GNP  SV+ ++ LVQ  L  G++NVIA +V+VF+LLAYA+V+LAC  L+WA+A NFRPTF++FSW+T LLG+  C+ M F+ + +YS     L  ++++ L++RS   SWG ISQAL+FHQVRKYLLM+D RK+HVK+WRPQ+LL++SNPRS
Sbjct:   95 SICAISTNGAVEGGGAYFMISRSLGPEFGGSIGLMFYLAKVCACGVYVLGLVEAIMDVFGQDPGSSVAQGLRVLPQGYWYTVLYSSVVLLLCMLVCLVGAHIYAKASFLILLVVTVSLISIIISPLIVSPQGFNI------THTYGNNHSVTVSPSYTGFNSTTLKNNLGPRYSLDYSTNTMMSFATVFAVMFTSCTGIMAGANMSGELKNPSESIPKGTIMAVAYTFTVYVLLYLLLSSTCDRSLLLNDYAVFQRVNVWPPFVTIGVYCASLSAAMCSMIGASRILHALALDQLFGLPLAPAAVTSSSGNPWVSVLYTWALVQCTLFAGQLNVIAGIVTVFYLLAYAAVDLACLALEWASAPNFRPTFQFFSWHTCLLGIISCVVMMFVINPVYSSASIVLLLLLLLFLHYRSPTSSWGYISQALIFHQVRKYLLMLDSRKDHVKFWRPQVLLMVSNPRS 549          

HSP 2 Score: 58.5362 bits (140), Expect = 3.656e-116
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 2
Query: 2012 PIHAVRNF-AKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
            P+    NF   + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D+S P+D
Sbjct:  583 PVQPQYNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLVLGFYDNSYPED 645          

HSP 3 Score: 122.479 bits (306), Expect = 8.624e-28
Identity = 81/237 (34.18%), Postives = 119/237 (50.21%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKAS---NSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGL------WNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            EYV II D +KM KNICL R+F  +      A+          IDVWP N   PGS SY D   +F+LQ++C+LNM++ W  + ++R+++C++      +E   QG       + ELL + RI+A IK V WD        N+   +   NT S  +           + +L  VN L+K H S   AV F YLP  P+  + +   +Y+ QL  LT DL P++ + G   V  + L
Sbjct:  691 EYVSIIQDAIKMGKNICLARYFFQLPPESKGATYMWGKDSMDTIDVWPTNLLTPGSASYADVGSLFLLQMACVLNMASGW-RRARLRIFVCVE------SESEDQGWLAKEEQFRELLGKLRIRAAIKIVAWD--------NVARMVRGPNTESQPVS----------EDFLCAVNGLLKEH-SSTAAVRFLYLPDPPS--SCELSQQYLTQLDTLTRDLGPTLLIHGVTPVTCTEL 899          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Zebrafish
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 382.104 bits (980), Expect = 3.656e-116
Identity = 220/461 (47.72%), Postives = 316/461 (68.55%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDADL--IQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTN--XXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNE-TQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            SICAISTNGA++GGG YFMISR+LGPE GGSIG++F+LA V +  +++   VE ++D FG  P   V   L  + + + +  L+++ V + C+ VCLVG  ++AK +  + + + V +    +    +  + F +      T  Y N++  T   +YTG + TT  NNL   Y++D++T   M+F TVFA++F   TGIM GANMSGEL  P+ SIP+GT+ A  +TF  Y++ + L ++TCDR LL N+Y   Q  N+W PFV IG++   +SAA+ + IGASRIL ALA D +FG+ L PA +T+  GNP  SV+ ++ LVQ  L  G++NVIA +V+VF+LLAYA+V+LAC  L+WA+A NFRPTF++FSW+T LLG+  C+ M F+ + +YS     L  ++++ L++RS   SWG ISQAL+FHQVRKYLLM+D RK+HVK+WRPQ+LL++SNPRS
Sbjct:   95 SICAISTNGAVEGGGAYFMISRSLGPEFGGSIGLMFYLAKVCACGVYVLGLVEAIMDVFGQDPGSSVAQGLRVLPQGYWYTVLYSSVVLLLCMLVCLVGAHIYAKASFLILLVVTVSLISIIISPLIVSPQGFNI------THTYGNNHSVTVSPSYTGFNSTTLKNNLGPRYSLDYSTNTMMSFATVFAVMFTSCTGIMAGANMSGELKNPSESIPKGTIMAVAYTFTVYVLLYLLLSSTCDRSLLLNDYAVFQRVNVWPPFVTIGVYCASLSAAMCSMIGASRILHALALDQLFGLPLAPAAVTSSSGNPWVSVLYTWALVQCTLFAGQLNVIAGIVTVFYLLAYAAVDLACLALEWASAPNFRPTFQFFSWHTCLLGIISCVVMMFVINPVYSSASIVLLLLLLLFLHYRSPTSSWGYISQALIFHQVRKYLLMLDSRKDHVKFWRPQVLLMVSNPRS 549          

HSP 2 Score: 58.5362 bits (140), Expect = 3.656e-116
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 2
Query: 2012 PIHAVRNF-AKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
            P+    NF   + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D+S P+D
Sbjct:  583 PVQPQYNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLVLGFYDNSYPED 645          

HSP 3 Score: 122.479 bits (306), Expect = 8.624e-28
Identity = 81/237 (34.18%), Postives = 119/237 (50.21%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKAS---NSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGL------WNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            EYV II D +KM KNICL R+F  +      A+          IDVWP N   PGS SY D   +F+LQ++C+LNM++ W  + ++R+++C++      +E   QG       + ELL + RI+A IK V WD        N+   +   NT S  +           + +L  VN L+K H S   AV F YLP  P+  + +   +Y+ QL  LT DL P++ + G   V  + L
Sbjct:  691 EYVSIIQDAIKMGKNICLARYFFQLPPESKGATYMWGKDSMDTIDVWPTNLLTPGSASYADVGSLFLLQMACVLNMASGW-RRARLRIFVCVE------SESEDQGWLAKEEQFRELLGKLRIRAAIKIVAWD--------NVARMVRGPNTESQPVS----------EDFLCAVNGLLKEH-SSTAAVRFLYLPDPPS--SCELSQQYLTQLDTLTRDLGPTLLIHGVTPVTCTEL 899          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Zebrafish
Match: zgc:153039 (zgc:153039 [Source:ZFIN;Acc:ZDB-GENE-060929-736])

HSP 1 Score: 259.225 bits (661), Expect = 5.376e-76
Identity = 163/336 (48.51%), Postives = 216/336 (64.29%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVE------GLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNET---QFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNV 1644
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLANV  SAL++   VE      GL DD G L    + ++   + W+ L+ T + + C+ VCLVG  ++AK    IFIIV V   ++ +SF     F VP     T+    SN T      N+TG    T   NL A+YT+D+TTK  M+F TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FTFI Y +   L + TCDR LL  +Y F++  N+W PFV +G++ + +SAA+ N IGASRILFALA+DD+FG  L PAK T+  GNP  SV+IS+ LVQ+ +     N+
Sbjct:  108 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFLANVCGSALYVLGLVEAVLTTFGLPDD-GSLSMSRSAVLPVGYWWSLLYGTVILLLCVLVCLVGAHIYAKATFLIFIIVMVVLGTIFISF-----FAVPF---RTVQLPGSNSTIGPSRANFTGFKLDTLTGNLQADYTLDYTTKAMMSFATVFAVMFNGCTGIMAGSNMSGDLKNPSYSIPRGTITAVIFTFIIYNLLSLLISCTCDRILLQKDYGFLRDINVWGPFVTVGVYSSTLSAAMSNLIGASRILFALAKDDLFGRVLSPAKRTSASGNPWVSVLISWFLVQVCVSFSTANI 434          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Zebrafish
Match: slc12a2 (solute carrier family 12 member 2 [Source:ZFIN;Acc:ZDB-GENE-040625-53])

HSP 1 Score: 185.652 bits (470), Expect = 1.812e-50
Identity = 149/518 (28.76%), Postives = 253/518 (48.84%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCD------------------------------------------RFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQK--LRKNERFPKNQGIY*CNN 2085
            S  AI+TNG ++GGG Y++ISR+LGPE GGSIG++F  AN  + A+++  F E +V+     G +  D   +      +  T   I  LG+ + G    AK  +F+ +I+    F+                 I + +  +S + +FG ++  +G      L  N+  DF   +  TFF+VF+I FP  TGI+ GAN+SG+L  P ++IP+GTL A L T + Y+    +SA  C                                           +F L N++  M   + + P +  G+F   +S+AL + + A ++  AL +D+I+       K   K   P+    ++F +    +LI ++NVIAP++S FFL +YA +N +      A +  +RP+FKY++ + SL G   C  + F+ ++  +L    +   + + ++++  D +WGS +QAL +HQ   + L +    +H+K +RPQ L++   P S+   L     F KN G+  C +
Sbjct:  259 STSAIATNGFVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVELLMDSGLLMIDQTNDI----RVIGTITVILLLGISVAGMEWEAKAQIFLLVILITAIFNYF---------------IGSFIAVDSKK-KFGFFSYDAGI-----LAENFGPDF---RGQTFFSVFSIFFPAATGILAGANISGDLADPQMAIPKGTLLAILITGLVYV-GVAISAGACIVRDATGIESNFTLISNCTDAACKYGYDFSSCRPTVEGEVSSCKFGLHNDFQVMSVVSGFSPLISAGIFSATLSSALASLVSAPKVFQALCKDNIYPGIAIFGKGYGKNNEPLRGYFLTFGIALAFILIAELNVIAPIISNFFLASYALINFSVFHASLANSPGWRPSFKYYNMWASLAGAILCCVVMFIINWWAALLTNVIVLSLYIYVSYKKPDVNWGSSTQALTYHQALTHSLQLCGVADHIKTFRPQCLVMTGAPNSRPAILHLVHAFTKNVGLMLCGH 747          

HSP 2 Score: 35.8094 bits (81), Expect = 1.812e-50
Identity = 18/46 (39.13%), Postives = 25/46 (54.35%), Query Frame = 2
Query: 2063 KAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDI 2200
            KAF    +A  +R G + +    GLG L  NT+ IGF++D    DI
Sbjct:  777 KAFYTCVVAEDLRQGTQYMLQAAGLGRLRPNTLVIGFKNDWRTGDI 822          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Xenopus
Match: ENSXETT00000045638.1 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:100498108])

HSP 1 Score: 429.098 bits (1102), Expect = 1.418e-133
Identity = 235/458 (51.31%), Postives = 327/458 (71.40%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQK 2031
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLANV  SAL++   VE +VD FG  P  +    ++   + + +L+ T + + CL VCLVG S++AK    IF++V V   SV +SF   K   VP+P+ NT +  N      G +TG   +T  NNLY +Y+VD+TT + M+F TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FT+I Y +   +   TC+R LL  +Y F++  N+W PFV IG++ + +SA++ N IGASRIL+ALA+D++FG  L PAK T++GGNP  SV++S+ LVQ+VL  GK+N IA +V++FFLL YA+V LAC  L+WA+A NFRPTF+YF+WYT +LG+  CL M FL   IY+    +   ++++ L++ S ++SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQILL++S+P + K
Sbjct:   89 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFLANVCGSALYILGLVEAIVDMFGFSPAVKNGLHVLPITYWYEFLYGTVLLLICLVVCLVGASIYAKATFIIFLVVMVVLISVFISFFAVKETVVPLPQGNTSISVN------GTFTGFKLSTLKNNLYPDYSVDYTTGRMMSFTTVFAVMFNGCTGIMAGSNMSGDLKNPSFSIPRGTITAVIFTYIIYNLLSLMVCCTCERALLKYDYGFLRDINIWHPFVTIGIYCSTLSASMSNLIGASRILYALAKDELFGKLLMPAKKTSRGGNPWVSVIMSWFLVQLVLFAGKLNTIAAIVTIFFLLVYAAVGLACLALEWASAPNFRPTFRYFTWYTCILGILGCLIMIFLIQPIYASASVAFMLVLLLCLHYMSPNHSWGFISQALIFHQVRKYLLMLDVRKDHVKFWRPQILLMVSSPHNHK 540          

HSP 2 Score: 118.242 bits (295), Expect = 2.608e-26
Identity = 81/251 (32.27%), Postives = 129/251 (51.39%), Query Frame = 2
Query: 2567 SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQ------YIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGL---WNELLNQWRIQAEIKTVGWDDIM---------VNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFH--VSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            S  EYV II+D +KM KN+ L R+F   D        SS C+      YIDVWP+N  +P S +Y+D   +F+LQ++C+LNM   W  K K+R+++C++       E  +QG      +LL   RI+A I TV WD ++         V+ EA    + +  N  ++ I+        + + YL+ VN +I     +SP  AV F YLP  P    +  + +++ QL  +T +L P++ + G   V ++ L
Sbjct:  663 SPWEYVAIISDTIKMSKNVALARYFSEFD-------KSSVCKLRGKETYIDVWPLNLLRPDSTAYVDTCSLFLLQMACVLNMVRSW-KKAKLRLFLCIE------AESGLQGQEVKLKQLLKDLRIKASINTVAWDSVVALHWLKQGTVDSEA---AEEVYLNFPNNSIR--------ISEEYLEAVNQMILMQNPLSP-PAVRFLYLPRPP--ADTAVYNRFLHQLEAVTRNLGPTLLIHGVSAVTSTEL 885          

HSP 3 Score: 55.0694 bits (131), Expect = 6.824e-7
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILK 2206
            ++ D L IKAF+++T++ ++R G +QL  + GLGG+  NTV +GF   S P+D+ K
Sbjct:  582 QLVDELNIKAFVNLTLSDSVRHGVQQLLFISGLGGMRPNTVVLGFYSRSAPQDLQK 637          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Xenopus
Match: ENSXETT00000045625.1 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:100498108])

HSP 1 Score: 428.713 bits (1101), Expect = 2.189e-133
Identity = 235/458 (51.31%), Postives = 327/458 (71.40%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQK 2031
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLANV  SAL++   VE +VD FG  P  +    ++   + + +L+ T + + CL VCLVG S++AK    IF++V V   SV +SF   K   VP+P+ NT +  N      G +TG   +T  NNLY +Y+VD+TT + M+F TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FT+I Y +   +   TC+R LL  +Y F++  N+W PFV IG++ + +SA++ N IGASRIL+ALA+D++FG  L PAK T++GGNP  SV++S+ LVQ+VL  GK+N IA +V++FFLL YA+V LAC  L+WA+A NFRPTF+YF+WYT +LG+  CL M FL   IY+    +   ++++ L++ S ++SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQILL++S+P + K
Sbjct:  100 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFLANVCGSALYILGLVEAIVDMFGFSPAVKNGLHVLPITYWYEFLYGTVLLLICLVVCLVGASIYAKATFIIFLVVMVVLISVFISFFAVKETVVPLPQGNTSISVN------GTFTGFKLSTLKNNLYPDYSVDYTTGRMMSFTTVFAVMFNGCTGIMAGSNMSGDLKNPSFSIPRGTITAVIFTYIIYNLLSLMVCCTCERALLKYDYGFLRDINIWHPFVTIGIYCSTLSASMSNLIGASRILYALAKDELFGKLLMPAKKTSRGGNPWVSVIMSWFLVQLVLFAGKLNTIAAIVTIFFLLVYAAVGLACLALEWASAPNFRPTFRYFTWYTCILGILGCLIMIFLIQPIYASASVAFMLVLLLCLHYMSPNHSWGFISQALIFHQVRKYLLMLDVRKDHVKFWRPQILLMVSSPHNHK 551          

HSP 2 Score: 118.242 bits (295), Expect = 2.519e-26
Identity = 81/251 (32.27%), Postives = 129/251 (51.39%), Query Frame = 2
Query: 2567 SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQ------YIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGL---WNELLNQWRIQAEIKTVGWDDIM---------VNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFH--VSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            S  EYV II+D +KM KN+ L R+F   D        SS C+      YIDVWP+N  +P S +Y+D   +F+LQ++C+LNM   W  K K+R+++C++       E  +QG      +LL   RI+A I TV WD ++         V+ EA    + +  N  ++ I+        + + YL+ VN +I     +SP  AV F YLP  P    +  + +++ QL  +T +L P++ + G   V ++ L
Sbjct:  674 SPWEYVAIISDTIKMSKNVALARYFSEFD-------KSSVCKLRGKETYIDVWPLNLLRPDSTAYVDTCSLFLLQMACVLNMVRSW-KKAKLRLFLCIE------AESGLQGQEVKLKQLLKDLRIKASINTVAWDSVVALHWLKQGTVDSEA---AEEVYLNFPNNSIR--------ISEEYLEAVNQMILMQNPLSP-PAVRFLYLPRPP--ADTAVYNRFLHQLEAVTRNLGPTLLIHGVSAVTSTEL 896          

HSP 3 Score: 55.4546 bits (132), Expect = 6.567e-7
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILK 2206
            ++ D L IKAF+++T++ ++R G +QL  + GLGG+  NTV +GF   S P+D+ K
Sbjct:  593 QLVDELNIKAFVNLTLSDSVRHGVQQLLFISGLGGMRPNTVVLGFYSRSAPQDLQK 648          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Xenopus
Match: SLC12A9 (solute carrier family 12, member 9 [Source:NCBI gene;Acc:100493856])

HSP 1 Score: 367.466 bits (942), Expect = 5.045e-112
Identity = 200/407 (49.14%), Postives = 289/407 (71.01%), Query Frame = 1
Query:  856 VDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ-KLRKNERFPKNQGIY 2073
            + + LI   +G+N+L+A+ + + C+ +CLVG S++++ + FIF++VFV   ++++SFL  +   V I           N T  G YTG++ +T  +NL A+Y++D+TT   M F TVFA++F G TGIM G N+SGEL +P+ SIP GT+ A + TF  Y+I F  +A TCDR LL  +Y F +  N+W PFV+IG++ T +SA++   IGASRIL ALA+DD+FG+ L PAKL +KGGNP G+V+ ++ LVQ+VLL GK+N IA +V+VF+L+AYA+++LAC  L+WA+A NFRPTF+ FSW+T LLG+  CL M FL +  Y+ G   L  +++  ++FRS   SWG ISQAL+FHQVRKYLL++D+RK+HVK+WRPQILL++SNPR+  +L K     K  G+Y
Sbjct:   13 LSSPLILSGYGYNFLYASIILLLCMAICLVGASIYSQASFFIFLLVFVVLLTILISFLAVRPLTVTI-------RHGGNVTFTGVYTGINSSTLHDNLQADYSLDYTTGNLMNFATVFAVMFNGCTGIMAGCNLSGELKQPSRSIPIGTIIAVIITFFVYLILFIFTALTCDRTLLREDYGFFRPINIWPPFVLIGVYATSLSASMSTLIGASRILHALAKDDLFGVLLAPAKLVSKGGNPWGAVIYTWALVQLVLLAGKLNTIAGIVTVFYLIAYAAIDLACLALEWASAPNFRPTFRLFSWHTCLLGILSCLVMMFLINPAYASGSIVLLLLLLGSIHFRSSSSSWGYISQALIFHQVRKYLLLLDVRKDHVKFWRPQILLMVSNPRTSCQLIKFVNDLKKGGLY 412          

HSP 2 Score: 117.472 bits (293), Expect = 3.092e-26
Identity = 71/233 (30.47%), Postives = 119/233 (51.07%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEH-----NVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            +YV +I D +KM KNI L R+F  +    ++   SS   YIDVWP++  +P + +Y+D   +F+LQ++CILNM+A W  + ++RV++C++    G ++        +  + ELL++ RI+A I+ V WD +      N  G+ ++   +S E              YLK  N  ++      T V F YLP  P         +Y+++L  LT  L P++ + G   V  + L
Sbjct:  537 DYVAMICDALKMHKNIVLARNFPLL----VRPEASSPAMYIDVWPLDLLRPQASAYVDVCSLFLLQMACILNMAASW-RRFQLRVFLCVESRGGGGSDGASGWIAAEAKFRELLSKLRIRALIRVVAWDRVAALRGPNAEGQALNREPISCE--------------YLKAANRAVEEEGGAETGVRFLYLPRPP--ADPALHQRYLEELDTLTAGLGPTLLIHGLTPVTCTEL 748          

HSP 3 Score: 56.6102 bits (135), Expect = 2.328e-7
Identity = 23/53 (43.40%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D L +KAF+D+T+ P++R G + L  + GLGG+  NT+ +GF DD+ P D
Sbjct:  439 SLVDKLNVKAFVDLTLCPSVRQGAQHLLRITGLGGMKPNTLVLGFYDDASPDD 491          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Xenopus
Match: SLC12A9 (solute carrier family 12, member 9 [Source:NCBI gene;Acc:100493856])

HSP 1 Score: 364.77 bits (935), Expect = 2.756e-111
Identity = 198/398 (49.75%), Postives = 285/398 (71.61%), Query Frame = 1
Query:  883 FGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ-KLRKNERFPKNQGIY 2073
            +G+N+L+A+ + + C+ +CLVG S++++ + FIF++VFV   ++++SFL  +   V I           N T  G YTG++ +T  +NL A+Y++D+TT   M F TVFA++F G TGIM G N+SGEL +P+ SIP GT+ A + TF  Y+I F  +A TCDR LL  +Y F +  N+W PFV+IG++ T +SA++   IGASRIL ALA+DD+FG+ L PAKL +KGGNP G+V+ ++ LVQ+VLL GK+N IA +V+VF+L+AYA+++LAC  L+WA+A NFRPTF+ FSW+T LLG+  CL M FL +  Y+ G   L  +++  ++FRS   SWG ISQAL+FHQVRKYLL++D+RK+HVK+WRPQILL++SNPR+  +L K     K  G+Y
Sbjct:    3 YGYNFLYASIILLLCMAICLVGASIYSQASFFIFLLVFVVLLTILISFLAVRPLTVTI-------RHGGNVTFTGVYTGINSSTLHDNLQADYSLDYTTGNLMNFATVFAVMFNGCTGIMAGCNLSGELKQPSRSIPIGTIIAVIITFFVYLILFIFTALTCDRTLLREDYGFFRPINIWPPFVLIGVYATSLSASMSTLIGASRILHALAKDDLFGVLLAPAKLVSKGGNPWGAVIYTWALVQLVLLAGKLNTIAGIVTVFYLIAYAAIDLACLALEWASAPNFRPTFRLFSWHTCLLGILSCLVMMFLINPAYASGSIVLLLLLLGSIHFRSSSSSWGYISQALIFHQVRKYLLLLDVRKDHVKFWRPQILLMVSNPRTSCQLIKFVNDLKKGGLY 393          

HSP 2 Score: 117.472 bits (293), Expect = 2.898e-26
Identity = 71/233 (30.47%), Postives = 119/233 (51.07%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEH-----NVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            +YV +I D +KM KNI L R+F  +    ++   SS   YIDVWP++  +P + +Y+D   +F+LQ++CILNM+A W  + ++RV++C++    G ++        +  + ELL++ RI+A I+ V WD +      N  G+ ++   +S E              YLK  N  ++      T V F YLP  P         +Y+++L  LT  L P++ + G   V  + L
Sbjct:  518 DYVAMICDALKMHKNIVLARNFPLL----VRPEASSPAMYIDVWPLDLLRPQASAYVDVCSLFLLQMACILNMAASW-RRFQLRVFLCVESRGGGGSDGASGWIAAEAKFRELLSKLRIRALIRVVAWDRVAALRGPNAEGQALNREPISCE--------------YLKAANRAVEEEGGAETGVRFLYLPRPP--ADPALHQRYLEELDTLTAGLGPTLLIHGLTPVTCTEL 729          

HSP 3 Score: 56.6102 bits (135), Expect = 2.187e-7
Identity = 23/53 (43.40%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D L +KAF+D+T+ P++R G + L  + GLGG+  NT+ +GF DD+ P D
Sbjct:  420 SLVDKLNVKAFVDLTLCPSVRQGAQHLLRITGLGGMKPNTLVLGFYDDASPDD 472          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Xenopus
Match: tinagl1 (tubulointerstitial nephritis antigen-like 1 [Source:Xenbase;Acc:XB-GENE-991634])

HSP 1 Score: 202.601 bits (514), Expect = 1.569e-55
Identity = 152/511 (29.75%), Postives = 250/511 (48.92%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDR-------------------------------------FLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNP--RSQKLRKNERFPKNQGIY*C 2079
            S+ AI TNG ++GGG Y++ISR+LGPE GGSIG++F  AN  + A+++  F E +V+       +  D + +      +  T   I  LG+ + G    AK  + + +I+ +   +                 I T++   + E +   +     T F  N    +  DF   +   FF+VFAI FP  TGI+ GAN+SG+L  P  +IP+GT+ A L T I Y+     +AA+  R                                     + L NN+  M   + + P +I G+F   +S+AL + + A ++  AL +D+I+      AK   K   PI   V++FV+    +LI ++NVIAP++S FFL +YA +N +C    +A +  +RP FKY++ + SL G   C G+ F+ ++  +L  +++   + + + ++  D +WGS +QAL F       L ++  ++HVK +RPQ ++L   P  R   L     F KN G+  C
Sbjct:  200 SMSAICTNGVVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFSETVVEILKDTNTIMVDEVNDI----RIIGTITVILLLGISVAGMEWEAKAQVVLLVILLIAIVNFF---------------IGTVI-PTTKEKRAQGFFNYQATIFAEN----FGPDFRNGE--GFFSVFAIFFPAATGILAGANISGDLKDPQGAIPKGTMWAILITTIAYLGVAICAAASVVRDATGNLNDTITSAFKCNGSAACGLGYDFSICETQTCNYGLMNNFQVMSMVSGFGPLIIAGIFSATLSSALASLVSAPKVFQALCKDNIYKGLHFFAKGHGKNNEPIRGYVLTFVIALAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAFKYYNMWVSLFGAMLCCGVMFVINWWAALITYAIELFLYIYVTYKKPDVNWGSSTQALQFKNALDSALGLNCIEDHVKNFRPQCIVLTGVPMTRPALLDITHSFTKNSGLCIC 684          

HSP 2 Score: 36.1946 bits (82), Expect = 1.569e-55
Identity = 21/51 (41.18%), Postives = 26/51 (50.98%), Query Frame = 2
Query: 2057 KIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDD---SEPKDI 2200
            K KAF     A   RDG R L    GLG L  NT+ +GF+ D   + P D+
Sbjct:  710 KRKAFYAAVAADNFRDGVRTLLQASGLGRLKPNTLVMGFKKDWRQASPVDL 760          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Mouse
Match: Slc12a9 (solute carrier family 12 (potassium/chloride transporters), member 9 [Source:MGI Symbol;Acc:MGI:1933532])

HSP 1 Score: 429.483 bits (1103), Expect = 1.293e-133
Identity = 235/456 (51.54%), Postives = 320/456 (70.18%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP--LGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPI-PKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR 2022
            S+CAI+TNGA++GGG YFMISRTLGPEVGGSIG++F+LANV   A+ +   VE ++D FG    G     ++ + +GWN L+ + +     GVC +G  L+A+ +   F++V     SV+VSF+      +P+ P+  T   ++S   + G++TG +G+T  +NL A Y  D+TT   MTF +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  YI+ FFLS+ TCDR LL  +Y F +  +LW P V+IG++ T +SA++ + IGASRIL ALAQDD+FG+ L PAK+ + GGNP G+V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C  L+WA+A NFRPTF  FSW+T LLGVA CL M FL S   + G   L  ++  +L  R    SWG +SQALLFHQVRKYLL +D+RKEHVK+WRPQ+LLL+ NPR
Sbjct:   89 SVCAIATNGAVRGGGAYFMISRTLGPEVGGSIGLMFYLANVCGCAVSLLGLVESILDVFGADATGSSGIQVLPQGYGWNLLYGSLLLGLVGGVCTLGAGLYARASFLTFLLVSGSLASVLVSFVAVGPRNIPLAPRPGT--NASSVPHRHGHFTGFNGSTLRDNLGAGYAEDYTTGAMMTFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIIAVAYTFFIYILLFFLSSFTCDRALLQEDYGFFRDISLWPPLVLIGIYATALSASMSSLIGASRILHALAQDDLFGVILAPAKVVSGGGNPWGAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLSALLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKEHVKFWRPQLLLLVGNPR 542          

HSP 2 Score: 91.2781 bits (225), Expect = 4.206e-18
Identity = 66/240 (27.50%), Postives = 109/240 (45.42%), Query Frame = 2
Query: 2564 VSEVEYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEH--NVQGLWNELLNQWRIQAEIKTVGWDDIMVNLE--------ANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKV 3244
            +S  +YV  +AD +KM KN+ L R    +  + +   +S+S++  ++DVWP+N  +P G   Y+D   +F+LQ++ IL+M   W S  ++R+++CL     G  E     +G    LL+Q RI+AE++ V W +     E         N G     A  L+     +                        P TA+ F YLP  P       + +Y+  L  L+ DL P++ + G   V
Sbjct:  678 LSPQDYVATVADALKMNKNVVLARACGALPPERLSRGSSSSAQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILSMVPAWHS-ARLRIFLCL-----GPREAPGAAEGRLRALLSQLRIRAEVQEVVWGEGAETGEPEEEEGDFVNGGRGDEEAEALACSANALVRAQQGRGTVGGPGGPEGRDGEEGPTTALTFLYLPRPP--ADPARYPRYLALLETLSRDLGPTLLIHGVTPV 909          

HSP 3 Score: 58.9214 bits (141), Expect = 3.388e-8
Identity = 22/53 (41.51%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+D
Sbjct:  587 SLVDLAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQD 639          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Mouse
Match: Slc12a1 (solute carrier family 12, member 1 [Source:MGI Symbol;Acc:MGI:103150])

HSP 1 Score: 191.815 bits (486), Expect = 3.361e-49
Identity = 147/511 (28.77%), Postives = 246/511 (48.14%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYI------------------ISFFLSAATCD-------------------RFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNP--RSQKLRKNERFPKNQGIY*C 2079
            S+ AI TNG ++GGG Y++ISR+LGPE GGSIG++F  AN  + A+++  F E +VD    L   D+ ++        + +  V I  LG+ + G    AK  + + +I+ +   +                 I T++ SN NE +   +     + F  N   ++T      K   FF+VFAI FP  TGI+ GAN+SG+L  P  +IPRGT+ A   T + YI                      +S   C+                   ++ L NN+  M   + + P +  G+F   +S+AL + + A ++  AL +D+IF      AK   K   P+    ++FV+    +LI ++NVIAP++S FFL +YA +N +C    +A +  +RP +  ++ + SL G   C  + F+ ++  ++  + +   + + + ++  D +WGS +QAL +       L +   ++HVK +RPQ ++L   P  R   L     F KN G+  C
Sbjct:  220 SMSAICTNGVVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVD---LLKESDSMMVDPTNDIRIIGSITVVIL-LGISVAGMEWEAKAQVILLVILLIAIANFF---------------IGTVIPSN-NEKKSRGFFNYQASIFAENFGPSFT------KGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIFITTVAYIGVAICVAACVVRDATGSMNDTIVSGMNCNGSAACGLGYDFSRCQHEPCQYGLMNNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIFKGLQFFAKGYGKNNEPLRGYFLTFVIAMAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYGIYNMWVSLFGAILCCAVMFVINWWAAVITYVIELFLYIYVTYKKPDVNWGSSTQALSYVSALDNALELTTVEDHVKNFRPQCIVLTGGPMTRPALLDITHAFTKNSGLCIC 704          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Mouse
Match: Slc12a1 (solute carrier family 12, member 1 [Source:MGI Symbol;Acc:MGI:103150])

HSP 1 Score: 191.045 bits (484), Expect = 5.726e-49
Identity = 147/511 (28.77%), Postives = 246/511 (48.14%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYI------------------ISFFLSAATCD-------------------RFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNP--RSQKLRKNERFPKNQGIY*C 2079
            S  AI+TNG ++GGG Y++ISR+LGPE GGSIG++F  AN  + A+++  F E +VD    L   D+ ++        + +  V I  LG+ + G    AK  + + +I+ +   +                 I T++ SN NE +   +     + F  N   ++T      K   FF+VFAI FP  TGI+ GAN+SG+L  P  +IPRGT+ A   T + YI                      +S   C+                   ++ L NN+  M   + + P +  G+F   +S+AL + + A ++  AL +D+IF      AK   K   P+    ++FV+    +LI ++NVIAP++S FFL +YA +N +C    +A +  +RP +  ++ + SL G   C  + F+ ++  ++  + +   + + + ++  D +WGS +QAL +       L +   ++HVK +RPQ ++L   P  R   L     F KN G+  C
Sbjct:  220 STSAIATNGYVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVD---LLKESDSMMVDPTNDIRIIGSITVVIL-LGISVAGMEWEAKAQVILLVILLIAIANFF---------------IGTVIPSN-NEKKSRGFFNYQASIFAENFGPSFT------KGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIFITTVAYIGVAICVAACVVRDATGSMNDTIVSGMNCNGSAACGLGYDFSRCQHEPCQYGLMNNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIFKGLQFFAKGYGKNNEPLRGYFLTFVIAMAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYGIYNMWVSLFGAILCCAVMFVINWWAAVITYVIELFLYIYVTYKKPDVNWGSSTQALSYVSALDNALELTTVEDHVKNFRPQCIVLTGGPMTRPALLDITHAFTKNSGLCIC 704          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Mouse
Match: Slc12a1 (solute carrier family 12, member 1 [Source:MGI Symbol;Acc:MGI:103150])

HSP 1 Score: 190.66 bits (483), Expect = 8.120e-49
Identity = 147/511 (28.77%), Postives = 246/511 (48.14%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYI------------------ISFFLSAATCD-------------------RFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNP--RSQKLRKNERFPKNQGIY*C 2079
            S  AI+TNG ++GGG Y++ISR+LGPE GGSIG++F  AN  + A+++  F E +VD    L   D+ ++        + +  V I  LG+ + G    AK  + + +I+ +   +                 I T++ SN NE +   +     + F  N   ++T      K   FF+VFAI FP  TGI+ GAN+SG+L  P  +IPRGT+ A   T + YI                      +S   C+                   ++ L NN+  M   + + P +  G+F   +S+AL + + A ++  AL +D+IF      AK   K   P+    ++FV+    +LI ++NVIAP++S FFL +YA +N +C    +A +  +RP +  ++ + SL G   C  + F+ ++  ++  + +   + + + ++  D +WGS +QAL +       L +   ++HVK +RPQ ++L   P  R   L     F KN G+  C
Sbjct:  220 STSAIATNGFVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVD---LLKESDSMMVDPTNDIRIIGSITVVIL-LGISVAGMEWEAKAQVILLVILLIAIANFF---------------IGTVIPSN-NEKKSRGFFNYQASIFAENFGPSFT------KGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIFITTVAYIGVAICVAACVVRDATGSMNDTIVSGMNCNGSAACGLGYDFSRCQHEPCQYGLMNNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIFKGLQFFAKGYGKNNEPLRGYFLTFVIAMAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYGIYNMWVSLFGAILCCAVMFVINWWAAVITYVIELFLYIYVTYKKPDVNWGSSTQALSYVSALDNALELTTVEDHVKNFRPQCIVLTGGPMTRPALLDITHAFTKNSGLCIC 704          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Mouse
Match: Slc12a2 (solute carrier family 12, member 2 [Source:MGI Symbol;Acc:MGI:101924])

HSP 1 Score: 188.348 bits (477), Expect = 4.916e-48
Identity = 147/514 (28.60%), Postives = 255/514 (49.61%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYI---------------------ISFFLS---AATCD-------------RFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQK--LRKNERFPKNQGIY*CNNC 2088
            S  AI+TNG ++GGG Y++ISR+LGPE GG+IG++F  AN  + A+++  F E +V+    L +  + L+ +      +      +  LG+ + G    AK  + + +I+ +     +               I T +   S + +   + G     F      N+  DF  ++  TFF+VFAI FP  TGI+ GAN+SG+L  P  +IP+GTL A L T + YI                     I+  L+   +A C               + L NN+  M   + + P +  G+F   +S+AL + + A +I  AL +D+I+  F   AK   K   P+   +++F++    +LI ++NVIAP++S FFL +YA +N +      A +  +RP FKY++ + SL+G   C  + F+ ++  +L  + +   + + + ++  D +WGS +QAL +    ++ + +   ++HVK +RPQ L++  +P S+   L     F KN G+  C + 
Sbjct:  331 STSAIATNGFVRGGGAYYLISRSLGPEFGGAIGLIFAFANAVAVAMYVVGFAETVVE----LLKEHSILMIDEINDIRIIGAITVVILLGISVAGMEWEAKAQIVLLVILLLAIADFV---------------IGTFISLESKKPK--GFFGYKSEIF----NENFGPDF--REEETFFSVFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTVVYIGIAVSVGSCVVRDATGNVNDTITTELTNCTSAACKLNFDFSYCESNTCSYGLMNNFQVMSMVSGFAPLISAGIFSATLSSALASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLIGAILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLSALQHSIRLSGVEDHVKNFRPQCLVMTGSPNSRPALLHLVHDFTKNVGLMICGHV 817          
BLAST of Solute carrier family 12 member 9 vs. UniProt/SwissProt
Match: sp|Q0VGW6|S12A9_XENLA (Solute carrier family 12 member 9 OS=Xenopus laevis OX=8355 GN=slc12a9 PE=2 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 1.602e-138
Identity = 239/474 (50.42%), Postives = 342/474 (72.15%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDA-DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR-SQKLRKNERFPKNQGIY 2073
            S+CAISTNGA++GGG YFMISRTLGPE GGSIG++F+LANVF+  +++   VE ++D FG  P    D+   + + +G+++L+A+ + + C+ +CLVG S++++ + FIF++VFV   ++++SFL  +   V I           N T  G YTG++ +T  NNL A+Y++D+TT   M F TVFA++F G TGIM G N+SGEL +P+ SIP GT+ A + TF  Y+I F  +A TCDR LL  +Y F ++ N+W PFV+IG++ T +SA++   IGASRIL ALA+DD+FG+ L PAKL +KGGNP G+VV ++ LVQ+VLL GK+N IA +V+VF+L+AYA+++LAC  L+WA+A NFRPTF++FSW+T LLG+   L M FL +  Y+ G   L  +++  ++FRS   SWG ISQAL+FHQVRKYLL++D+RK+HVK+WRPQILL++SNPR S +L +     K  G+Y
Sbjct:   97 SVCAISTNGAVQGGGAYFMISRTLGPEFGGSIGLMFYLANVFACGVYVLGLVEAVLDVFGRDPSDVTDSLRSLPQGYGYSFLYASIILLLCMAICLVGASIYSQASFFIFLLVFVVLLTILISFLAVRPLTVSI-------RHGGNVTMTGVYTGINSSTLHNNLQADYSLDYTTGNLMNFATVFAVMFNGCTGIMAGCNLSGELKQPSRSIPMGTIIAVIITFFVYLILFIFTAFTCDRTLLREDYGFFRSINIWPPFVLIGVYATSLSASMSTLIGASRILHALAKDDLFGVLLAPAKLVSKGGNPWGAVVYTWALVQLVLLAGKLNTIAGIVTVFYLIAYAAIDLACLALEWASAPNFRPTFRFFSWHTCLLGILSSLVMMFLINPAYASGSIVLLLLLLGSIHFRSSSSSWGYISQALIFHQVRKYLLLLDVRKDHVKFWRPQILLMVSNPRTSSQLIRFVNDLKKGGLY 563          

HSP 2 Score: 127.872 bits (320), Expect = 1.489e-28
Identity = 76/237 (32.07%), Postives = 129/237 (54.43%), Query Frame = 2
Query: 2564 VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEH-----NVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            +S  +YV +I D +KM KNI L R+F    L+  +AS+SS   YIDVWP++  +P + +Y+D   +F+LQ++CILNM+A W  + ++RV++C++  + G ++        +  + ELL++ RI+A I+ V WD +      N+GG++++   +S E              YL    + +       TAV F YLP  P    S    +Y+++L  LT+ L P++ + G   V  + L
Sbjct:  684 LSAKDYVSMICDALKMHKNIVLARNFPL--LVRPEASSSSPATYIDVWPLDLLRPQASAYVDVCSLFLLQMACILNMAASW-RRYQLRVFLCVE--SRGGSDGASGWLAAEAKFRELLSKLRIRALIRVVAWDRVAAFRVQNMGGQVLNREPISSE--------------YLNAAKSAVTDEGGTETAVRFLYLPRPP--ADSSLHERYLEELDTLTSGLGPTLLIHGLTPVTCTEL 899          

HSP 3 Score: 55.8398 bits (133), Expect = 2.057e-6
Identity = 24/53 (45.28%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D L +KAF+D+T+ P++R G + L  + GLGG+  NTV +GF DD+ P D
Sbjct:  590 SLVDKLNVKAFVDLTLCPSVRQGTQHLLRITGLGGMKPNTVVLGFYDDACPDD 642          
BLAST of Solute carrier family 12 member 9 vs. UniProt/SwissProt
Match: sp|Q99MR3|S12A9_MOUSE (Solute carrier family 12 member 9 OS=Mus musculus OX=10090 GN=Slc12a9 PE=1 SV=2)

HSP 1 Score: 429.483 bits (1103), Expect = 9.047e-133
Identity = 235/456 (51.54%), Postives = 320/456 (70.18%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP--LGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPI-PKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR 2022
            S+CAI+TNGA++GGG YFMISRTLGPEVGGSIG++F+LANV   A+ +   VE ++D FG    G     ++ + +GWN L+ + +     GVC +G  L+A+ +   F++V     SV+VSF+      +P+ P+  T   ++S   + G++TG +G+T  +NL A Y  D+TT   MTF +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  YI+ FFLS+ TCDR LL  +Y F +  +LW P V+IG++ T +SA++ + IGASRIL ALAQDD+FG+ L PAK+ + GGNP G+V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C  L+WA+A NFRPTF  FSW+T LLGVA CL M FL S   + G   L  ++  +L  R    SWG +SQALLFHQVRKYLL +D+RKEHVK+WRPQ+LLL+ NPR
Sbjct:   89 SVCAIATNGAVRGGGAYFMISRTLGPEVGGSIGLMFYLANVCGCAVSLLGLVESILDVFGADATGSSGIQVLPQGYGWNLLYGSLLLGLVGGVCTLGAGLYARASFLTFLLVSGSLASVLVSFVAVGPRNIPLAPRPGT--NASSVPHRHGHFTGFNGSTLRDNLGAGYAEDYTTGAMMTFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIIAVAYTFFIYILLFFLSSFTCDRALLQEDYGFFRDISLWPPLVLIGIYATALSASMSSLIGASRILHALAQDDLFGVILAPAKVVSGGGNPWGAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLSALLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKEHVKFWRPQLLLLVGNPR 542          

HSP 2 Score: 91.2781 bits (225), Expect = 2.942e-17
Identity = 66/240 (27.50%), Postives = 109/240 (45.42%), Query Frame = 2
Query: 2564 VSEVEYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEH--NVQGLWNELLNQWRIQAEIKTVGWDDIMVNLE--------ANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKV 3244
            +S  +YV  +AD +KM KN+ L R    +  + +   +S+S++  ++DVWP+N  +P G   Y+D   +F+LQ++ IL+M   W S  ++R+++CL     G  E     +G    LL+Q RI+AE++ V W +     E         N G     A  L+     +                        P TA+ F YLP  P       + +Y+  L  L+ DL P++ + G   V
Sbjct:  678 LSPQDYVATVADALKMNKNVVLARACGALPPERLSRGSSSSAQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILSMVPAWHS-ARLRIFLCL-----GPREAPGAAEGRLRALLSQLRIRAEVQEVVWGEGAETGEPEEEEGDFVNGGRGDEEAEALACSANALVRAQQGRGTVGGPGGPEGRDGEEGPTTALTFLYLPRPP--ADPARYPRYLALLETLSRDLGPTLLIHGVTPV 909          

HSP 3 Score: 58.9214 bits (141), Expect = 2.370e-7
Identity = 22/53 (41.51%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+D
Sbjct:  587 SLVDLAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQD 639          
BLAST of Solute carrier family 12 member 9 vs. UniProt/SwissProt
Match: sp|Q66HR0|S12A9_RAT (Solute carrier family 12 member 9 OS=Rattus norvegicus OX=10116 GN=Slc12a9 PE=1 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.684e-131
Identity = 235/458 (51.31%), Postives = 317/458 (69.21%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP--LGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQV---PIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR 2022
            S+CAI+TNGA++GGG YFMISRTLGPEVGGSIG++F+LANV   A+ +   VE ++D FG    G     ++ + +GWN L+ + +     GVC +G  L+A+ +   F++V     SV+VSF+      +   P P  N     +S   + G++TG +G+T  +NL A Y  D+TT   MTF +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  YI+ FFLS+ TCDR LL  +Y F +  +LW P V+IG++ T +SA++ + IGASRIL ALAQDD+FG+ L PAK+ + GGNP G+V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C  L+WA+A NFRPTF  FSW+T LLGVA CL M FL S   + G   L  ++  +L  R    SWG +SQALLFHQVRKYLL +D+RKEHVK+WRPQ+LLL+ NPR
Sbjct:   89 SVCAIATNGAVRGGGAYFMISRTLGPEVGGSIGLMFYLANVCGCAVSLLGLVESILDVFGADVTGSSGIKVLPQGYGWNLLYGSLLLGLVGGVCALGAGLYARASFLTFLLVSGSLASVLVSFVAVGPRNITLAPRPGTN----GSSVPPRHGHFTGFNGSTLKDNLGAGYAEDYTTGAMMTFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIIAVAYTFFIYILLFFLSSFTCDRALLQGDYGFFRDISLWPPLVLIGIYATALSASMSSLIGASRILHALAQDDLFGVILAPAKVVSGGGNPWGAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLSALLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKEHVKFWRPQLLLLVGNPR 542          

HSP 2 Score: 90.1225 bits (222), Expect = 7.652e-17
Identity = 63/239 (26.36%), Postives = 106/239 (44.35%), Query Frame = 2
Query: 2561 QVSEVEYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLE--------ANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKV 3244
             +S  +YV  +AD +KM KN+ L R    +  + +   + +S++  ++DVWP+N  +P G   Y+D   +F+LQ++ IL+M   W S  ++R+++CL            +G    LL+Q RI+AE++ V W +     E         N G     A  L+     +                        P TA+ F YLP  P       + +Y+  L  L+ DL P++ + G   V
Sbjct:  677 ALSPQDYVATVADALKMNKNVVLARACGALPPERLSRGSGSSAQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILSMVPAWHS-ARLRIFLCLGPR---EAPGAAEGRLRALLSQLRIRAEVQEVVWGEGAEAGEPEEEEGDFVNGGRGDEEAEALACSANALVRAQQGRGTGGGPGGPEGRDGEEGPTTALTFLYLPRPP--ADPARYPRYLALLETLSRDLGPTLLIHGVTPV 909          

HSP 3 Score: 58.9214 bits (141), Expect = 2.515e-7
Identity = 22/53 (41.51%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+D
Sbjct:  587 SLVDLAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQD 639          
BLAST of Solute carrier family 12 member 9 vs. UniProt/SwissProt
Match: sp|Q9BXP2|S12A9_HUMAN (Solute carrier family 12 member 9 OS=Homo sapiens OX=9606 GN=SLC12A9 PE=1 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 5.017e-128
Identity = 230/458 (50.22%), Postives = 317/458 (69.21%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP--LGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQV---PIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPR 2022
            S+CAI+TNGA++GGG YFMISRTLGPEVGGSIG++F+LANV   A+ +   VE ++D FG    G     ++ + +GWN L+ + +     GVC +G  L+A+ +   F++V     SV++SF+      +   P P  N     +S   +FG++TG + +T  +NL A Y  D+TT   M F +VFA+LF G TGIM GANMSGEL  P+ +IP GT+ A  +TF  Y++ FFLS+ TCDR LL  +Y F +A +LW P V+IG++ T +SA++ + IGASRIL ALA+DD+FG+ L PAK+ ++GGNP  +V+ S+ LVQ+VLL GK+N +A VV+VF+L+AYA+V+L+C  L+WA+A NFRPTF  FSW+T LLGVA CL M FL S   + G   L  ++  +L  R    SWG +SQALLFHQVRKYLL +D+RK+HVK+WRPQ+LLL+ NPR
Sbjct:   89 SVCAIATNGAVQGGGAYFMISRTLGPEVGGSIGLMFYLANVCGCAVSLLGLVESVLDVFGADATGPSGLRVLPQGYGWNLLYGSLLLGLVGGVCTLGAGLYARASFLTFLLVSGSLASVLISFVAVGPRDIRLTPRPGPN----GSSLPPRFGHFTGFNSSTLKDNLGAGYAEDYTTGAVMNFASVFAVLFNGCTGIMAGANMSGELKDPSRAIPLGTIVAVAYTFFVYVLLFFLSSFTCDRTLLQEDYGFFRAISLWPPLVLIGIYATALSASMSSLIGASRILHALARDDLFGVILAPAKVVSRGGNPWAAVLYSWGLVQLVLLAGKLNTLAAVVTVFYLVAYAAVDLSCLSLEWASAPNFRPTFSLFSWHTCLLGVASCLLMMFLISPGAAGGSLLLMGLLAALLTARGGPSSWGYVSQALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPR 542          

HSP 2 Score: 90.5077 bits (223), Expect = 5.975e-17
Identity = 65/245 (26.53%), Postives = 109/245 (44.49%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENM--DLIGLKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEH--NVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFH-----------------VSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKV 3244
            +YV  +AD +KM KN+ L R    +  + +   +  +S+  ++DVWP+N  +P G   Y+D   +F+LQ++ IL M   W S  ++R+++CL     G  E     +G    LL+Q RI+AE++ V W +     E     +    N+   + +          +   +  N L++                     P TA+ F YLP  P       + +Y+  L  LT DL P++ V G   V
Sbjct:  682 DYVATVADALKMNKNVVLARASGALPPERLSRGSGGTSQLHHVDVWPLNLLRPRGGPGYVDVCGLFLLQMATILGMVPAWHS-ARLRIFLCL-----GPREAPGAAEGRLRALLSQLRIRAEVQEVVWGEGAGAGEPEAEEEGDFVNSGRGDAEA---------EALARSANALVRAQQGRGTGGGPGGPEGGDAEGPITALTFLYLPRPP--ADPARYPRYLALLETLTRDLGPTLLVHGVTPV 909          

HSP 3 Score: 57.7658 bits (138), Expect = 6.795e-7
Identity = 22/53 (41.51%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
             + D  ++KAF+D+T++P++R G + L  + GLGG+  NT+ +GF DD+ P+D
Sbjct:  587 SLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLGGMKPNTLVLGFYDDAPPQD 639          
BLAST of Solute carrier family 12 member 9 vs. UniProt/SwissProt
Match: sp|A2BFP5|S12A9_DANRE (Solute carrier family 12 member 9 OS=Danio rerio OX=7955 GN=slc12a9 PE=3 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 2.256e-115
Identity = 220/461 (47.72%), Postives = 316/461 (68.55%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDADL--IQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTN--XXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNE-TQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            SICAISTNGA++GGG YFMISR+LGPE GGSIG++F+LA V +  +++   VE ++D FG  P   V   L  + + + +  L+++ V + C+ VCLVG  ++AK +  + + + V +    +    +  + F +      T  Y N++  T   +YTG + TT  NNL   Y++D++T   M+F TVFA++F   TGIM GANMSGEL  P+ SIP+GT+ A  +TF  Y++ + L ++TCDR LL N+Y   Q  N+W PFV IG++   +SAA+ + IGASRIL ALA D +FG+ L PA +T+  GNP  SV+ ++ LVQ  L  G++NVIA +V+VF+LLAYA+V+LAC  L+WA+A NFRPTF++FSW+T LLG+  C+ M F+ + +YS     L  ++++ L++RS   SWG ISQAL+FHQVRKYLLM+D RK+HVK+WRPQ+LL++SNPRS
Sbjct:   95 SICAISTNGAVEGGGAYFMISRSLGPEFGGSIGLMFYLAKVCACGVYVLGLVEAIMDVFGQDPGSSVAQGLRVLPQGYWYTVLYSSVVLLLCMLVCLVGAHIYAKASFLILLVVTVSLISIIISPLIVSPQGFNI------THTYGNNHSVTVSPSYTGFNSTTLKNNLGPRYSLDYSTNTMMSFATVFAVMFTSCTGIMAGANMSGELKNPSESIPKGTIMAVAYTFTVYVLLYLLLSSTCDRSLLLNDYAVFQRVNVWPPFVTIGVYCASLSAAMCSMIGASRILHALALDQLFGLPLAPAAVTSSSGNPWVSVLYTWALVQCTLFAGQLNVIAGIVTVFYLLAYAAVDLACLALEWASAPNFRPTFQFFSWHTCLLGIISCVVMMFVINPVYSSASIVLLLLLLLFLHYRSPTSSWGYISQALIFHQVRKYLLMLDSRKDHVKFWRPQVLLMVSNPRS 549          

HSP 2 Score: 58.5362 bits (140), Expect = 2.256e-115
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 2
Query: 2012 PIHAVRNF-AKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
            P+    NF   + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D+S P+D
Sbjct:  583 PVQPQYNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLVLGFYDNSYPED 645          

HSP 3 Score: 122.479 bits (306), Expect = 6.510e-27
Identity = 81/237 (34.18%), Postives = 119/237 (50.21%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKAS---NSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGL------WNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            EYV II D +KM KNICL R+F  +      A+          IDVWP N   PGS SY D   +F+LQ++C+LNM++ W  + ++R+++C++      +E   QG       + ELL + RI+A IK V WD        N+   +   NT S  +           + +L  VN L+K H S   AV F YLP  P+  + +   +Y+ QL  LT DL P++ + G   V  + L
Sbjct:  691 EYVSIIQDAIKMGKNICLARYFFQLPPESKGATYMWGKDSMDTIDVWPTNLLTPGSASYADVGSLFLLQMACVLNMASGW-RRARLRIFVCVE------SESEDQGWLAKEEQFRELLGKLRIRAAIKIVAWD--------NVARMVRGPNTESQPVS----------EDFLCAVNGLLKEH-SSTAAVRFLYLPDPPS--SCELSQQYLTQLDTLTRDLGPTLLIHGVTPVTCTEL 899          
BLAST of Solute carrier family 12 member 9 vs. TrEMBL
Match: A0A0H3YIX7 (Slc12a-2 OS=Schmidtea mediterranea OX=79327 GN=slc12a-2 PE=2 SV=1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 343/457 (75.05%), Postives = 391/457 (85.56%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSN-ETQFGNYTGLSGTTFINN-LYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            SICAISTNGA++GGGVYFMISRTLGPEVGGSIGILFFLANVFSSAL+M+  VEGL+DDFGP GR+ A +I E   W YLFATCVC+FCL VCLVGGS+FAKTNLFIF+ VFVCF SV+V+FLF  +  V IP  N ++Y + N   QFG +TGL+GTTF  N LY  Y +DF+T   M F +VFAI+F GVTGIMNGANMSGEL +PA+SIP+GTLAA LFTFICY +SF LSAATC+RFLL NNYL+MQA N W+PFV+IG+  TC+SA LGN IGASRIL+ALA+DDIFG  LKPAKL TKGGNPI SVVISFVLVQ+VL IG++N+IAPVVSVFFLLAYASVN ACALLD A+ASNFRPTFKYFSW+TSLLGV CCLGMCFL +Y YS+GIF LF I+IV LNFR LD++WG+I QALLFHQVRKYLL+ID RKEHVKYWRPQ+LLLLSNPRSQ
Sbjct:   95 SICAISTNGAVEGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALYMSGLVEGLMDDFGPEGRIVAGIIPEGRWWTYLFATCVCLFCLAVCLVGGSMFAKTNLFIFLAVFVCFTSVLVTFLFQSSHLVKIPMTNKVIYPHHNMSQQFGQFTGLNGTTFRKNILYDGYRIDFSTGNQMDFLSVFAIMFSGVTGIMNGANMSGELKQPAISIPKGTLAAALFTFICYTLSFLLSAATCERFLLLNNYLYMQAINFWRPFVLIGIIATCLSAGLGNLIGASRILYALAKDDIFGFLLKPAKLATKGGNPIASVVISFVLVQLVLFIGQLNLIAPVVSVFFLLAYASVNFACALLDLASASNFRPTFKYFSWHTSLLGVVCCLGMCFLVNYQYSIGIFILFVILIVALNFRRLDFAWGNIGQALLFHQVRKYLLLIDTRKEHVKYWRPQVLLLLSNPRSQ 551          

HSP 2 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 304/421 (72.21%), Postives = 336/421 (79.81%), Query Frame = 2
Query: 2027 RNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSES--------FDKSKIVQQSASRI-DNENTNLIYKGKNKIFN-LLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            + F  MKDFL IKAFIDVTIAPTIRDGCRQLS LCGLGGL INTVCIGFRDDSEP+DIL+KI  Q N    +   + R+   FA     FT + S S         D S  +  ++S I  +ENT L+ K + K  N +L+  VDP+FID+LPPIR TR   +G IN  S +++  ++    NYI+NDQ+SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMS+QWSSKCKIRVYICLDYYTIGT   NVQ LWNELL QWRIQAEIKTVGWDDI +NLE NLG KIMS N +SDEIKTISLFDCTLPDTY+KEVNNLIK H S NTAVCFFYLPIIPNI  SQ+W KYI+QLTLLTNDLPPSVFVRG H+VITSAL
Sbjct:  590 KKFIIMKDFLDIKAFIDVTIAPTIRDGCRQLSRLCGLGGLMINTVCIGFRDDSEPQDILQKINCQMNNLKSNWPFKPRHIPAFAELSSDFTGEQSTSKRLCHNISVDNS--INSTSSHICVDENTRLVTKDRMKFLNRILRPSVDPKFIDELPPIRSTRQELFGEINELSANRETRED----NYISNDQISEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 1004          

HSP 3 Score: 94.7449 bits (234), Expect = 9.083e-16
Identity = 45/62 (72.58%), Postives = 52/62 (83.87%), Query Frame = 3
Query:   39 LRTFPSINEEYAQNSRYYHDPTIIETLTLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLG 224
            + TFP +++E  QN R+Y+D TI ETLT S DQ+KR LKTFTGVFCPVALAQFSSLLFLRLG
Sbjct:    6 METFPQLHDESEQNKRHYYDLTISETLTASVDQSKRTLKTFTGVFCPVALAQFSSLLFLRLG 67          
BLAST of Solute carrier family 12 member 9 vs. TrEMBL
Match: A0A3Q3W0R3 (Zgc:153039 OS=Mola mola OX=94237 PE=4 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 7.394e-159
Identity = 231/463 (49.89%), Postives = 318/463 (68.68%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLI-------QENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXX--XXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLANV +SAL++   VE +V  FG     D  L+          + W+ L+A+ + + CL VCLVG  ++AK    IF++V     ++ +S   +  +   +P P ++T   +        N+TG    T + NL+A YT D+TT   MTF TVFA++F G TGIM G+NMSGEL  P+ SIPRGT+ A +FTFI Y +   L A +CDR LL  +Y F++  N+W  FV IG++ + +SAA+ N IGASRIL+ALA+DD+FG  L PAK T+  GNP  SV+IS+ LVQ+VL  GK+N IA +V++FFLL YA+V++AC  L+WA+A NFRPTF+YF+WYT +LG+  C  M FL + IY+    +   ++++++++ S   SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQILL++SNPRS
Sbjct:  102 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFLANVCASALYVLGLVEAIVATFGKPEGQDGSLLTFSHQVLPSGYWWSLLYASVIALLCLVVCLVGAHIYAKATFLIFLVVMFVLGTIFISFFAVSPRTILLPSPSLSTSNGTGPVIPSTANFTGFKLATLMGNLWAEYTSDYTTGNMMTFATVFAVMFNGCTGIMAGSNMSGELKNPSYSIPRGTITAVIFTFIIYNLLCVLVACSCDRVLLQRDYGFLRDINIWSHFVTIGVYSSTLSAAMSNLIGASRILYALARDDLFGKALSPAKRTSHTGNPWASVLISWFLVQLVLFSGKLNTIASIVTIFFLLVYAAVDIACLALEWASAPNFRPTFRYFTWYTCVLGIVGCAVMMFLINAIYASASIAFMLLLLLLIHYLSPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQILLMVSNPRS 564          

HSP 2 Score: 160.229 bits (404), Expect = 7.394e-159
Identity = 122/433 (28.18%), Postives = 197/433 (45.50%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQ----YIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMV----------------NLEANLGGKIMSANTLSDEIKTISLF---DCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            ++  + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF D                KC P                            + K++  S S I   +++    G +            + +++ PP+       + ++ A+ D Q   +      + +   +   EYV IIAD MKMQKN+ L R+F   D   + +S SS       Y+DVWP+N  +P S +Y+D   +F+LQL+CILNM   W  K  +R+++C++    G +    +    +LL + RI+A I  V WD  +                 + +A    K +SA+   +E   ++ F      L D YL  VN LI   + P+ AV F YLP  P    ++ +  Y+ QL LLT DL P++ + G   VIT+ L
Sbjct:  605 SWLSLVDHLNIKAFVNLTLADSVRHGIQHLLFISGLGGMRPNTLVLGFYD----------------KCLP----------------------------EDKLIDPSLSTIQCADSS----GPS------------QELEQNPPLFH-----FASLRASRDRQDYGE------FGDGKVLGPQEYVAIIADAMKMQKNVVLARYFNGFDRAKVLSSPSSSAGKGPLYVDVWPVNLLRPDSSNYVDTCSLFLLQLACILNMVRAW-RKATLRLFLCVEE---GRSLRGSEEKLGQLLKELRIKAHIYPVSWDQQVALHWQRQGEWGKKNSSHSPDATTEPKKLSAHEEEEEGDYVNSFPSNTTRLSDNYLSAVNKLILDTIQPSPAVRFLYLPRPP--ADTRRYTTYLHQLELLTQDLGPTLLIHGVTPVITTDL 960          
BLAST of Solute carrier family 12 member 9 vs. TrEMBL
Match: A0A3Q1J9Y3 (Zgc:153039 OS=Anabas testudineus OX=64144 PE=4 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.704e-157
Identity = 239/464 (51.51%), Postives = 325/464 (70.04%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGR---VDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNET-----QFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLANV   ALF+   VE +VD FG  P G      + ++   + W+ L+AT + + CL VCLVG  ++AKT   IF++V     ++ +SF   K   V +P   +   SNSN T        N+TG    T + NL A+YTVD+TT   MTF TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FTFI Y +   L A +CDR LL  +Y F++  N+W PFV IG++ + +SAA+ N IGASRIL+ALA+DD+FG  L PAK T++ GNP  SV+IS+ L+Q+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C  M FL + IY+    +   ++++++++ S   SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQ+LL++SNPRS
Sbjct:   95 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFLANVCGCALFVLGLVEAVVDTFGVPPDGTPAISHSQVLPSGYWWSLLYATVIGLLCLLVCLVGAHIYAKTTFIIFLVVIFVLLTIFISFFAVKPRVVSLP---SAANSNSNGTGPVFPTTANFTGFKLDTLLGNLKADYTVDYTTGTMMTFATVFAVMFNGCTGIMAGSNMSGDLKNPSYSIPRGTITAVIFTFITYNLLCVLVACSCDRVLLQRDYSFLRDINVWNPFVTIGVYSSTLSAAMSNLIGASRILYALARDDLFGKVLSPAKKTSRSGNPWVSVLISWFLMQLVLFSGKLNTIASIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCILGIVGCAIMMFLINAIYASASIAFMLLLLLLIHYLSPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQVLLMVSNPRS 555          

HSP 2 Score: 166.007 bits (419), Expect = 1.704e-157
Identity = 125/435 (28.74%), Postives = 193/435 (44.37%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSE----CQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKI------MSANTLSDEIKTISLF---------------DCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            ++  + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF DD  P+D   K+ +QS                        T+Q +++ D S+ ++Q                                    PP+       +  +  +SD Q   +      + +   +   EYV IIAD MKM KN+ L R+F N D   + +  S+       Y+DVWP+N F+P S SY+D   +F+LQL+CILNM   W  K  +R+++C++    G +    Q    +LL + RI+A++  V WD   V L     G+        S N   ++ K  +                    L D YL  VN LI     P  AV F YLP  P    ++ +  Y+ QL LLT DL P++ + G   VIT+ L
Sbjct:  596 SWLSLVDHLNIKAFVNLTLADSVRHGVQHLLFISGLGGMRPNTLVLGFYDDCLPRD---KLTDQSLS----------------------TSQPTDTLDPSQDIEQQ-----------------------------------PPLFH-----FSPLRGSSDRQDYGE------FGDGKVLGAQEYVAIIADAMKMLKNVVLARYFNNFDRAQVLSPPSTSPGMGAVYVDVWPVNLFRPDSSSYVDTCSLFLLQLACILNMVRAW-RKATLRLFLCVEE---GRSVRGSQEKLGQLLKELRIKAQVYPVPWDQ-QVALHWQRQGEWSKKHPSQSLNATEEKRKPKTDEEEESEDDYANSFPSNATRLSDDYLSAVNKLILDQALPPPAVRFLYLPRPP--ADTRRYASYLSQLELLTEDLGPTLLIHGVTPVITTDL 952          
BLAST of Solute carrier family 12 member 9 vs. TrEMBL
Match: A0A3Q3KE76 (Zgc:153039 OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 3.243e-156
Identity = 236/458 (51.53%), Postives = 319/458 (69.65%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG-PLGRVDADLIQ---ENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLANV  SAL++   VE +V  FG P       L Q     + W+ L+AT + + CL VCLVG  ++AKT   IF++V     ++ +SF       + +P  ++    N   T   N+TG    T   NL ANYTVD+TT K MTF TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FTFI Y +   L A +CDR LL  +Y F++  N+W P V IG++ + +SAA+ N IGASRIL+ALA+DD+FG  L PAK T+  GNP  SV+IS+ LVQ+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C+ M FL + IY+    +   ++++++++ S   SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQ+LL++SNPRS
Sbjct:  102 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFLANVCGSALYVLGLVEAIVATFGVPEDGTPGTLYQVLPSGYWWSLLYATAIALLCLLVCLVGAHIYAKTTFIIFLVVMFVLITIFISFFAVGPHSITLP--SSAALRNGTPTT-ANFTGFKLNTLKGNLEANYTVDYTTGKIMTFATVFAVMFNGCTGIMAGSNMSGDLKHPSYSIPRGTITAVIFTFIIYNVLSVLVACSCDRVLLQRDYSFLRDINVWNPLVTIGVYSSTLSAAMSNLIGASRILYALARDDLFGKVLSPAKKTSYSGNPWVSVLISWFLVQLVLFSGKLNTIASIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCVLGIVGCVIMMFLINAIYASASIAFMLLLLLLIHYLSPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQVLLMVSNPRS 556          

HSP 2 Score: 162.925 bits (411), Expect = 3.243e-156
Identity = 120/423 (28.37%), Postives = 192/423 (45.39%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDE----------IKTISLFDCT---LPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            ++  + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF DD                C P                            + K++  S S   +++T+L+   ++              +++ PP+       + ++  +SD +          + +   +   EYV IIAD +KM KN+ L R+F+  D   + +       YIDVWP+N  +P S SY+D   +F+LQL+CILNM   W  K  +R+++C++    G +   VQ    +LL   RI+A++  V WD  +       GG  M  ++ S +             ++ F C    L D YL  VN LI     P  AV F YLP  P    +Q +  Y+ QL LLT DL P++ + G   VIT+ L
Sbjct:  597 SWLSLVDHLNIKAFVNLTLADSVRHGVQHLLFISGLGGMRPNTLILGFYDD----------------CLP----------------------------RDKLIDPSLS--TSQSTDLLGFSQD--------------LEQPPPLFH-----FASLRGSSDREDYG------KFDDGKVLGSQEYVAIIADAIKMLKNVVLARYFDTFDRAQVLSPPLLGAVYIDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMVRAW-RKTTVRLFLCVE---AGRSVRGVQEKLGQLLKDLRIKAQVYPVPWDQQVALHWQRQGGSSMKPSSQSPDSTNDEENENEDDFVNSFPCNATRLSDDYLSAVNKLILDQTWPLPAVRFLYLPRPP--ADTQSYTTYLHQLELLTQDLGPTLLIHGVTPVITTDL 942          
BLAST of Solute carrier family 12 member 9 vs. TrEMBL
Match: A0A4W6BWW9 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=LOC108888189 PE=4 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 1.742e-155
Identity = 236/463 (50.97%), Postives = 323/463 (69.76%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDA--DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFG-----NYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FF ANV  SAL++   VE +V  FG    G V +   ++   + W+ L+AT + + CL VCLVG  ++AK    IF++V     ++ +SF   +   + +P  +T    N N T  G     N+TG    T + NL A+YTVD+TT   MTF TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FTFI Y +   L A +CDR LL  +Y F++  N+WKPFV IG++ + +SAA+ N IGASRIL+ALA+DD+FG  L PAK T+  GNP  SV+IS+ LVQ+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C  M FL + IY+    +   ++++++++ S   SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQ+LL++SNPRS
Sbjct:  102 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGIMFFFANVCGSALYVLGLVEAIVATFGVAEDGTVGSPHQVLPSGYWWSLLYATAIALLCLLVCLVGAHIYAKATFIIFLLVMFVLCTIFISFFAVRPRTIILPSSST---PNPNGTGPGFPTSANFTGFKLDTLLGNLGADYTVDYTTGTMMTFATVFAVMFNGCTGIMAGSNMSGDLKNPSYSIPRGTITAVIFTFIIYNLLSVLVACSCDRVLLQRDYSFLRDINIWKPFVTIGVYSSTLSAAMSNLIGASRILYALARDDLFGKVLSPAKKTSHSGNPWVSVLISWFLVQLVLFSGKLNTIASIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCVLGIVGCAVMMFLINAIYASASIAFMLLLLLLIHYLSPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQVLLMVSNPRS 561          

HSP 2 Score: 163.696 bits (413), Expect = 1.742e-155
Identity = 122/417 (29.26%), Postives = 187/417 (44.84%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSE----CQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCT---LPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            ++  + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF DD  P D L                          D    T+QS++  D S+                                +PE   + PP+       + ++  +SD Q   +      + +   +   EYV IIAD MKM KN+ L R+F N D   + +  SS       Y+DVWP+N  +P S SY+D   +F+LQL+CILNM   W  K  +R+++C++    G +    +    +LL + RI+A I  V WD            K+ +     ++   ++ F      L D YL  VN LI     P  AV F YLP  P    ++ +  Y+ QL LLT DL P++ + G   VIT+ L
Sbjct:  602 SWLSLVDHLNIKAFVNLTLADSVRHGVQHLLFISGLGGMRPNTLVLGFYDDCLPNDKLV-------------------------DPSLSTSQSTDPSDPSQ--------------------------------EPE---QQPPLFH-----FASLRGSSDRQDYGE------FGDGKVLGPQEYVAIIADAMKMLKNVVLARYFNNFDRAQVLSPPSSSPGKGAVYVDVWPVNLLRPDSCSYVDTCSLFLLQLACILNMVRAW-RKATLRLFLCVEE---GRSVRGSEEKLGQLLKELRIKARIYPVPWDQ---------QKKLRTDEDEENDDDYVNSFPSNTMRLSDDYLSAVNKLILDQARPPPAVRFLYLPRPP--ADTRRYAAYLHQLELLTQDLGPTLLIHGVTPVITTDL 932          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Cavefish
Match: zgc:153039 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:103030875])

HSP 1 Score: 393.275 bits (1009), Expect = 9.633e-121
Identity = 230/459 (50.11%), Postives = 316/459 (68.85%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG-PLGRVDA----DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGS+GI+FF ANV  SAL++   VE ++  FG     VD+     ++   + W+ L+ T + + CL VCLVG  ++AK    IF++V     ++ VSF   K   V +P   T     +N +   N+TG    T   NL A+YTVD+TT   MTF TVFA++F G TGIM G+NMSG+L  P+ +IPRGT+ A +FT I Y++   L A TCDR LL  +Y F++  NLW PFV IG++ + +SA++ N IGASRIL+ALA+DD+FG  L PAK T+  GNP  SV+IS+ LVQ+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C  M FL + IY+        ++++I+++     SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQ+LL++SNPR+
Sbjct:   15 SVCAISTNGALDAGGAYYMISRALGPEFGGSLGIMFFFANVCGSALYVLGLVEAMLATFGVSEAGVDSSSKYQVLPVGYWWSLLYGTALLLVCLVVCLVGARIYAKATFIIFLVVIFVLGTIFVSFFAVKPQVVNLPGPFT-----NNSSATANFTGFKLDTLRRNLEADYTVDYTTNTMMTFATVFAVMFNGCTGIMAGSNMSGDLKNPSYAIPRGTITAVIFTLIIYLLLIILVACTCDRVLLQRDYSFLRDINLWHPFVTIGVYSSTLSASMSNLIGASRILYALARDDLFGKVLSPAKKTSASGNPWASVLISWFLVQLVLFSGKLNTIAAIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCVLGIVGCAVMMFLINPIYASASIIFMLLLLLIIHYLCPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQVLLMVSNPRA 468          

HSP 2 Score: 122.094 bits (305), Expect = 8.959e-28
Identity = 88/313 (28.12%), Postives = 138/313 (44.09%), Query Frame = 2
Query: 2438 FIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQ--------------VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDD------------IMVNLEANLGGKIMSANTLSDEIKTISLF-------------DCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            F D  PP  + +  T+ +++  +  + Q D +     +                  +S  EYV IIAD +KM KN+ L R+F   D    +        ++DVWP+N  +P S SY+D   +F+LQL+CILNM+  W  K K+R+++C++    G +    +    +LL   R++A+I TV WD+            + +  EA  G +          +                      L D YL  VN LI        AV F YLP  P    ++ +  Y+ QL LL+ DL P++ + G   VIT+ L
Sbjct:  556 FYDDAPPQDQLQDRTFRSLDDPALTEDQEDPLYHFPPLRGSTPDNKNRGGACGGKVLSPQEYVCIIADAVKMLKNVALARYFGQFD----RQRALQSPVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMTRSW-QKAKLRLFLCVE---AGRSLKGAEQKLKQLLKDLRMKADIHTVPWDEQVALHWQRQQVGVAIEAEAEKGEREAGEKEEEQVMIEEEEPEEEEEYANSFPSNTVRLSDDYLHAVNRLILDQPFSPPAVRFLYLPRPP--ADTRRYNNYLHQLELLSRDLGPTMLIHGVTPVITTDL 858          

HSP 3 Score: 57.3806 bits (137), Expect = 9.308e-8
Identity = 24/59 (40.68%), Postives = 41/59 (69.49%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILK 2206
            ++  + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF DD+ P+D L+
Sbjct:  509 SWLSLVDHLNIKAFVNLTLADSVRHGVQHLLFISGLGGMRPNTLVLGFYDDAPPQDQLQ 567          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Cavefish
Match: zgc:153039 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:103030875])

HSP 1 Score: 392.889 bits (1008), Expect = 9.712e-120
Identity = 230/459 (50.11%), Postives = 316/459 (68.85%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG-PLGRVDA----DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGS+GI+FF ANV  SAL++   VE ++  FG     VD+     ++   + W+ L+ T + + CL VCLVG  ++AK    IF++V     ++ VSF   K   V +P   T     +N +   N+TG    T   NL A+YTVD+TT   MTF TVFA++F G TGIM G+NMSG+L  P+ +IPRGT+ A +FT I Y++   L A TCDR LL  +Y F++  NLW PFV IG++ + +SA++ N IGASRIL+ALA+DD+FG  L PAK T+  GNP  SV+IS+ LVQ+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C  M FL + IY+        ++++I+++     SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQ+LL++SNPR+
Sbjct:  102 SVCAISTNGALDAGGAYYMISRALGPEFGGSLGIMFFFANVCGSALYVLGLVEAMLATFGVSEAGVDSSSKYQVLPVGYWWSLLYGTALLLVCLVVCLVGARIYAKATFIIFLVVIFVLGTIFVSFFAVKPQVVNLPGPFT-----NNSSATANFTGFKLDTLRRNLEADYTVDYTTNTMMTFATVFAVMFNGCTGIMAGSNMSGDLKNPSYAIPRGTITAVIFTLIIYLLLIILVACTCDRVLLQRDYSFLRDINLWHPFVTIGVYSSTLSASMSNLIGASRILYALARDDLFGKVLSPAKKTSASGNPWASVLISWFLVQLVLFSGKLNTIAAIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCVLGIVGCAVMMFLINPIYASASIIFMLLLLLIIHYLCPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQVLLMVSNPRA 555          

HSP 2 Score: 122.479 bits (306), Expect = 7.894e-28
Identity = 88/313 (28.12%), Postives = 138/313 (44.09%), Query Frame = 2
Query: 2438 FIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQ--------------VSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDD------------IMVNLEANLGGKIMSANTLSDEIKTISLF-------------DCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            F D  PP  + +  T+ +++  +  + Q D +     +                  +S  EYV IIAD +KM KN+ L R+F   D    +        ++DVWP+N  +P S SY+D   +F+LQL+CILNM+  W  K K+R+++C++    G +    +    +LL   R++A+I TV WD+            + +  EA  G +          +                      L D YL  VN LI        AV F YLP  P    ++ +  Y+ QL LL+ DL P++ + G   VIT+ L
Sbjct:  643 FYDDAPPQDQLQDRTFRSLDDPALTEDQEDPLYHFPPLRGSTPDNKNRGGACGGKVLSPQEYVCIIADAVKMLKNVALARYFGQFD----RQRALQSPVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMTRSW-QKAKLRLFLCVE---AGRSLKGAEQKLKQLLKDLRMKADIHTVPWDEQVALHWQRQQVGVAIEAEAEKGEREAGEKEEEQVMIEEEEPEEEEEYANSFPSNTVRLSDDYLHAVNRLILDQPFSPPAVRFLYLPRPP--ADTRRYNNYLHQLELLSRDLGPTMLIHGVTPVITTDL 945          

HSP 3 Score: 57.3806 bits (137), Expect = 9.296e-8
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 2039 KMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILK 2206
             + D L IKAF+++T+A ++R G + L  + GLGG+  NT+ +GF DD+ P+D L+
Sbjct:  599 SLVDHLNIKAFVNLTLADSVRHGVQHLLFISGLGGMRPNTLVLGFYDDAPPQDQLQ 654          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Cavefish
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 387.111 bits (993), Expect = 1.210e-117
Identity = 217/462 (46.97%), Postives = 317/462 (68.61%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRV----DADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAK----TNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            SICAISTNGA++ GG Y+MISR+LGPE GGSIG++FFLA V +  +++   VE ++D FG    V       ++ + + ++ L+++ + + CL VCLVG  ++AK    T L + + +     S ++    H +F          +  N + T  G YTG + +T  NNL   Y++D++T + M+F TVFA++F   TGIM GANMSGEL  P+V+IP+GT+ A L+TF  Y++ F L+++TCDR LL N+Y   Q  N+W PFVI+G++   +SAA+ + IGASRIL ALA D +FG+ L PA +T++ GNP  +V+ ++ LVQ  +  G++NVIA +V+VF+LLAYA+V+LAC  L+WA+A NFRPTF+ FSW+T LLG+  CL M F+ + +YS     L  ++++ L++RS   SWG ISQAL+FHQVRKYLLM+D RK+HVK+WR Q+LL+++NPRS
Sbjct:  122 SICAISTNGAVEAGGAYYMISRSLGPEFGGSIGLMFFLAKVCACGVYVLGLVEAILDIFGQDPAVGMAQGVRVLPQGYWFSVLYSSVLLLLCLVVCLVGAHIYAKASFITLLVVTVAILSILISPLLVGPRHFSF-------THTLEHNRSITHNGTYTGFNSSTLANNLAPGYSLDYSTNRVMSFSTVFAVMFTSCTGIMAGANMSGELKNPSVAIPKGTIIAVLYTFTVYVLLFLLTSSTCDRLLLINDYGVFQRINVWSPFVIVGVYCASLSAAMCSLIGASRILHALAIDQLFGLPLAPAAITSQSGNPWVAVIFTWALVQCTVFAGQLNVIAGLVTVFYLLAYAAVDLACLALEWASAPNFRPTFQLFSWHTCLLGMLSCLVMMFVINPVYSSASIVLLLLLLLFLHYRSPTSSWGYISQALIFHQVRKYLLMLDSRKDHVKFWRLQVLLMVANPRS 576          

HSP 2 Score: 122.094 bits (305), Expect = 1.131e-27
Identity = 84/239 (35.15%), Postives = 125/239 (52.30%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIG----LKASNSSECQYIDVWPINFFQP-GSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGL------WNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            EYVGII+D +KM KN+CL R+F  +   G    LK+ +S +   IDVWP N     GSGS+ D   +F+LQ++C+LNM+A W  K ++R+++C++       E   QG       + +LL + RI+A IK V WD +M  L    G    +  ++S+E              +L +VN L+K H S   AV F YLP  P    S    +Y+ QL  +T  L P++ + G   V  + L
Sbjct:  723 EYVGIISDAIKMGKNVCLARYFHQLPPEGKGMTLKSRDSMDT--IDVWPFNLLSAQGSGSFADVCSLFLLQMACVLNMAAGW-RKARVRIFLCVE------AESGDQGWLAKEERFRDLLGKLRIRATIKIVAWDSVMRMLR---GTDPTAPPSVSEE--------------FLNKVNLLLKEH-SSTGAVRFLYLPGPP--ADSSQSQQYLAQLDAITQGLGPTLLIHGLTPVTCTEL 932          

HSP 3 Score: 53.9138 bits (128), Expect = 1.077e-6
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query: 2012 PIHAVRNF-AKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
            P+    NF   + D L +KAF+D+T++ ++R G + L  + GLGG+  NT+ +GF D+S P+D
Sbjct:  610 PVQQQYNFWLSLVDKLGVKAFVDLTLSLSVRQGTQHLLRITGLGGMKPNTLVLGFYDNSYPED 672          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Cavefish
Match: slc12a1 (solute carrier family 12 member 1 [Source:ZFIN;Acc:ZDB-GENE-080130-3])

HSP 1 Score: 198.364 bits (503), Expect = 1.749e-51
Identity = 160/544 (29.41%), Postives = 264/544 (48.53%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFG--NYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYI-ISFFLSA-----------------------ATCD-------------RFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQK--LRKNERFPKNQGIY*CNNCSNYQG----WLSPVVTFMW--SWWFNHQ 2154
            S+ AI TNG ++GGG Y++ISR+LGPE GGSIG++F  AN  + A+++  F E +VD    L +V+  ++ +      +      +  LG+   G    AK  + + +I+ V   +V                + T + +  ++   G  NY         + +  N+T DF   +  TFF+VFAI FP  TGI+ GAN+SG+L  P  +IP GTL A   T I Y+ I+  +SA                       + CD             ++ L NN+  M   + + P +  G F   IS+AL + + A ++  AL +D+I+   +  AK   K   PI   V++F++    +LI ++NVIAP++S FFL +YA +N +C    +A +  +RP +KY++ + SL G   C  + F+ ++  +L  +++   + V +  +  D +WGS +QA+ F       L +    +HVK +RPQ ++L   P+++   L  +  F KN G+  C  C  + G    W   +   M     W N Q
Sbjct:  174 SMSAICTNGVVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFSETVVD----LLKVNNAIMVDEVNDIRIVGCITVVLLLGIVGAGMEWEAKAQIVLLVILLVAIANVF---------------VGTAIPATEDKKSKGFFNYQA-------SIMAENFTPDFRDGE--TFFSVFAIFFPAATGILAGANISGDLRDPQEAIPIGTLLAIFITGITYLGIALCVSATVVRDATGNVNNTITYGANCNFSSACDFGYDFSPCETTKCKYGLMNNFQVMTMVSGFGPLITAGTFSATISSALASLVSAPKVFQALCKDNIYKALIFFAKGHGKNNEPIRGYVLTFIIAVAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYKYYNMWLSLFGAVLCCAVMFVINWWAALLTYAIEIFLYVYVTVKKPDVNWGSSTQAVTFVNAVNNTLTLSGVDDHVKNFRPQCIVLTGGPKTRPALLDLSHAFTKNYGL--CITCEVFVGPRLEWQQEISNSMEQNQEWLNGQ 687          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Cavefish
Match: slc12a1 (solute carrier family 12 member 1 [Source:ZFIN;Acc:ZDB-GENE-080130-3])

HSP 1 Score: 197.978 bits (502), Expect = 2.346e-51
Identity = 160/544 (29.41%), Postives = 264/544 (48.53%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFG--NYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYI-ISFFLSA-----------------------ATCD-------------RFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQK--LRKNERFPKNQGIY*CNNCSNYQG----WLSPVVTFMW--SWWFNHQ 2154
            S+ AI TNG ++GGG Y++ISR+LGPE GGSIG++F  AN  + A+++  F E +VD    L +V+  ++ +      +      +  LG+   G    AK  + + +I+ V   +V                + T + +  ++   G  NY         + +  N+T DF   +  TFF+VFAI FP  TGI+ GAN+SG+L  P  +IP GTL A   T I Y+ I+  +SA                       + CD             ++ L NN+  M   + + P +  G F   IS+AL + + A ++  AL +D+I+   +  AK   K   PI   V++F++    +LI ++NVIAP++S FFL +YA +N +C    +A +  +RP +KY++ + SL G   C  + F+ ++  +L  +++   + V +  +  D +WGS +QA+ F       L +    +HVK +RPQ ++L   P+++   L  +  F KN G+  C  C  + G    W   +   M     W N Q
Sbjct:  166 SMSAICTNGVVRGGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFSETVVD----LLKVNNAIMVDEVNDIRIVGCITVVLLLGIVGAGMEWEAKAQIVLLVILLVAIANVF---------------VGTAIPATEDKKSKGFFNYQA-------SIMAENFTPDFRDGE--TFFSVFAIFFPAATGILAGANISGDLRDPQEAIPIGTLLAIFITGITYLGIALCVSATVVRDATGNVNNTITYGANCNFSSACDFGYDFSPCETTKCKYGLMNNFQVMTMVSGFGPLITAGTFSATISSALASLVSAPKVFQALCKDNIYKALIFFAKGHGKNNEPIRGYVLTFIIAVAFILIAELNVIAPIISNFFLASYALINFSCFHASYAKSPGWRPAYKYYNMWLSLFGAVLCCAVMFVINWWAALLTYAIEIFLYVYVTVKKPDVNWGSSTQAVTFVNAVNNTLTLSGVDDHVKNFRPQCIVLTGGPKTRPALLDLSHAFTKNYGL--CITCEVFVGPRLEWQQEISNSMEQNQEWLNGQ 679          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Sea Lamprey
Match: slc12a9 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:793341])

HSP 1 Score: 407.527 bits (1046), Expect = 1.686e-126
Identity = 234/460 (50.87%), Postives = 323/460 (70.22%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG-----PLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            S+CAISTNGA++GGGVYFMISR LGPE GGSIG++FFLANV SSA+F+    E ++D F      P G  DA      + W  L+A+C+ + CL V LVG  +++K    IF+ V +   +V +SF     F V   +   IV  + N T   NY+G S  T  +NL  +YT D+TT   MTF +VFAI+F G TGIM G+NMSG+L  P+ +IPRGT+AA +FTF  Y++  F+ + +C R LL  NY+FM+  N+W PFV IG++   +SAA+   IGASR+L A+A DDIFG+ LK  K T++ GNP  +V++S+ LVQ+VL  G++N IA +V+VFFL+AYA+V+LAC  ++WA+A NFRPTF++FSW+T LLG+  CL M F+ S IY+    ++  +++V +++RS   SWG ISQAL+FHQVRKYLL++DIRK+HVK+WRPQILL+++NPRS 
Sbjct:   81 SVCAISTNGAVQGGGVYFMISRALGPEFGGSIGVMFFLANVCSSAVFLLGLTEAIMDSFRKRPDFPHGLPDA------YIWVVLYASCLLLICLVVVLVGADIYSKAAFIIFLCVILVLLTVFISF-----FAV---RNRHIVIKHGNITMNLNYSGPSLGTLHDNLKEHYTQDYTTGVTMTFASVFAIMFNGCTGIMAGSNMSGDLKDPSYAIPRGTIAAVVFTFCVYVLLCFMVSCSCPRDLLLYNYVFMRDINVWGPFVTIGIYAASLSAAMSCLIGASRVLHAVALDDIFGVLLKVVKRTSRSGNPWVAVLVSWFLVQLVLFAGQLNTIAGIVTVFFLIAYATVDLACLAMEWASAPNFRPTFQFFSWHTCLLGMVGCLIMMFIISPIYASASIAVMLLLLVFIHYRSPSSSWGYISQALIFHQVRKYLLLLDIRKDHVKFWRPQILLMVANPRSS 526          

HSP 2 Score: 122.479 bits (306), Expect = 1.570e-28
Identity = 74/235 (31.49%), Postives = 123/235 (52.34%), Query Frame = 2
Query: 2576 EYVGIIADCMKMQKNICLCRHFENMDLIGLKASN-SSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHV---------SPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVIT 3250
            EYV +++D +KM+KN+CL R+F  +D+  ++     +    IDVWP+N  +P S  Y+D   +F+LQ++CILNM + W    K+R+++C++    G  E  ++    ELL+Q RI+A I TV WD      + + GG     ++ S    T++     + D YL+ VN L+                 AV F YLP  P       + +Y+ QL  +T+ L P++ + G  +V +
Sbjct:  665 EYVAVVSDAIKMKKNVCLSRYFHELDMALVRGKRRGAPSVSIDVWPLNLLRPDSAYYVDVCSLFLLQMACILNMVSSW-RHAKLRIFLCVESSLSGDKEEKLR----ELLSQLRIKASIHTVHWD------QGSGGGSSEEDHSRSSLKATLNWM--AMSDEYLRAVNRLVLGQELVEQTGTADGRQCAVRFLYLPRPP--ADPAGYERYLHQLETITDGLGPTLLIHGVSQVTS 884          

HSP 3 Score: 57.3806 bits (137), Expect = 1.725e-8
Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 2006 YYPIHAVRNF-AKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPH 2242
            Y P+ +  N+   + D L +KAF+D+T++PT+R G + L  + GLGG+  NT+ +GF DD  P D      ++     PH
Sbjct:  557 YDPLESQVNYWLSLVDKLNVKAFVDITLSPTVRQGVQNLLRIAGLGGMKPNTLFLGFYDDCVPDD---YFLSEPAFAAPH 633          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Sea Lamprey
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 121.324 bits (303), Expect = 2.546e-36
Identity = 82/290 (28.28%), Postives = 143/290 (49.31%), Query Frame = 1
Query: 1192 TFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNY--LFMQATNLWKPFVIIGMFLTCISAALGNF------IGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQKLR 2037
            +F  +  I FP VTGIM G+N SG+L     SIP GT+ A   T    + S  L  A  +  +L + +   F   + +   F  +  FL  +      F      +   R+  ++    +F   ++        G P  +++++  + ++ +LI  ++++AP++S+FFL+ Y  VNLACA+       N+RP FKY+ W  S LG++ CL + F++S+ Y++    +  +I   + +R  +  WG   + L     R  LL ++    H K WRPQ+L+LL      ++R
Sbjct:  305 SFTALVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTIMAIATTSRINLTSVILFGACVEGVVLRDKFSCRFCLHSKI-NDFTWVSNFLAVVFTHFDAFQFGTLELSEPRVSCSIPNVILFPFPIQVFGHGKANGEPTWALLLTAGIAELGILIASLDMVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQVLVLLKLGEGMEVR 593          

HSP 2 Score: 50.0618 bits (118), Expect = 2.546e-36
Identity = 29/102 (28.43%), Postives = 48/102 (47.06%), Query Frame = 2
Query: 2018 HAVRNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCI----GFRDDSEPKDILKKIFNQSNKCNPHQ-FIRARNNSLFAGDVQSFTNQS 2308
             A  +  ++ +  K+K F  V ++P +RDG   L   CGLGG+  NTV +    G+R   +P+     I         H+  + A+N SLF  + + F   +
Sbjct:  629 QAAESIKRLVETEKVKGFYQVVVSPRVRDGISHLIQSCGLGGMKPNTVVMGWPYGWRQSEDPRSWKTFIDTVRATTAAHRALLVAKNVSLFPANSERFAEGT 730          

HSP 3 Score: 61.6178 bits (148), Expect = 8.160e-10
Identity = 25/53 (47.17%), Postives = 40/53 (75.47%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVE 822
            S+ AI+TNG +  GG YFMISR+LGPE GG++G+ F+L   F++++++   +E
Sbjct:   56 SMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAASMYILGAIE 108          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003053.1 (pep scaffold:Pmarinus_7.0:GL478333:5880:33924:-1 gene:ENSPMAG00000002656.1 transcript:ENSPMAT00000003053.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 3.717e-30
Identity = 138/533 (25.89%), Postives = 225/533 (42.21%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFG--NYTGLSGTTFINNLYA-NYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYII------SFFLSAAT---CDRF-------------LLWN---------------------NYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCL-GMCFLASYXXXXXXXXXXXXXXX----XXNFRSL------DYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNP--RSQKLRKNERFPKNQGIY*CNN 2085
            SI AIS NG +  GG YFM+SRTLG E+G   GIL+  A     A+    F E L D       +  D + +      +       F LG+ + G +   K  L  F+++ +   + +               + T++ +   +   G  NY           ++A N+T  F   +   FF +F + FP VTGI+ GAN+ G+L  PA +IP+GTL A L T + Y+I      +  L  A+    D F             L WN                     NY  M   + W P +  G+F   +S+AL N I A +    +A+D+I+       K   +   P+   ++++++    ++I ++N+IAP++S FF+++Y  +N +C          F  +F      T L+ +   + GM   A  +      S+  + +        ++ L      D +WGS  QA+ F+      L +D    HVK +RP  L+L   P  R   +     F K+ G+  C N
Sbjct:  153 SISAISNNGKVARGGTYFMVSRTLGYELGAPFGILYSFAAAVGIAMHTVGFAETLRDILHASNLIMVDKVNDI----RIIGVITVTFLLGIAMAGLAWENKAQLIFFVLIIISLLNYL---------------LGTVIPATPEKMSKGFFNYNA--------KIFAENFTPVFRNTE---FFRLFGVFFPAVTGILAGANICGDLKDPASAIPKGTLLAILTTALSYLIINTTIGAVMLRDASGLLSDSFAWVCNGSSKLACELGWNFTACSLFRPDTTSPCTFGFVNNYQVMAMVSAWAPLIYAGIFGAALSSALANLISAPKCFQGVARDNIYPGISIFGKGFGRNQEPLFGYLLAYLISICFIIIAELNIIAPIISCFFIISYTILNFSC----------FHASFIKTPGETELMQMPIDVEGMQLAAQRLPHSMSLSMSSVELQCVVITGEYQQLLWSLFADVNWGSSMQAMSFNTALYTNLTLDRELYHVKNYRPNCLVLTGPPNLRPALVDFVGTFTKDIGLMVCGN 645          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Sea Lamprey
Match: slc12a4 (solute carrier family 12 member 4 [Source:ZFIN;Acc:ZDB-GENE-090218-27])

HSP 1 Score: 125.561 bits (314), Expect = 1.511e-29
Identity = 83/289 (28.72%), Postives = 142/289 (49.13%), Query Frame = 1
Query: 1192 TFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLW-KPFVIIGMFLTCISAALGNF------IGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQKLR 2037
            +F  +  I FP VTGIM G+N SG+L     SIP GT+ A   T   Y+ S  L  A  +  +L + +       L    F  +  FL  +      F      +   R+  ++    +F   ++        G P  +++++  + ++ +LI  ++++AP++S+FFL+ Y  VNLACA+       N+RP FKY+ W  S LG++ CL + F++S+ Y++    +  +I   + +R  +  WG   + L     R  LL ++    H K WRPQ+L+LL      ++R
Sbjct:  304 SFTALVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTIMAIATTSTVYLTSVILFGACVEGVVLRDKHSNPNRNLLLINDFTWVSNFLAVVFTHFDAFQFGTLELSEPRVSCSIPNVILFPFPIQVFGHGKANGEPTWALLLTAGIAELGILIASLDMVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQVLVLLKLGEGMEVR 592          

HSP 2 Score: 62.003 bits (149), Expect = 7.251e-10
Identity = 25/53 (47.17%), Postives = 40/53 (75.47%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVE 822
            S+ AI+TNG +  GG YFMISR+LGPE GG++G+ F+L   F++++++   +E
Sbjct:   55 SMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAASMYILGAIE 107          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Sea Lamprey
Match: slc12a8 (solute carrier family 12 member 8 [Source:ZFIN;Acc:ZDB-GENE-030131-5654])

HSP 1 Score: 117.472 bits (293), Expect = 3.301e-27
Identity = 93/339 (27.43%), Postives = 160/339 (47.20%), Query Frame = 1
Query:  694 IKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFAT-----CVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVN 1695
            I  GG+YFMIS  LG +VGG+IG+L+        AL++  F E + D                FG + ++A       V +  LG+ L G     +  L +  ++ V  F   V    H   +                     + G +     NN + +YT         +FFTVF + FP  TG+M G NMSG+L  P+ +IP G+LAA   T+  Y++   L  ATC R  L  +++  +  +L     ++G++++ +++ +    GA RIL  +AQ+ +  I     +       P+ ++ +  V+    + +G+VN++AP+V++ FLL YA+++
Sbjct:  101 IGSGGIYFMISTVLGGKVGGTIGLLYVFGQCVVGALYVTGFAESVAD---------------TFGLSNIWAVRGIAIGVVLGLLGINLAGVKWVIRLQLVLLALLAVSIFFYTVRVHAHMNAE-------------------NGFVGYTEELLKNNTFPDYTPG------ESFFTVFGVFFPTATGVMAGFNMSGDLKTPSKNIPVGSLAAIGITWFLYLVFVLLLGATCTREALRVDFMIAEKVSLVGFLFLVGLYISSLASCMTGLYGAPRILQCIAQERVIPIIEVLGRGHGPNKTPVYAIGVVGVITTAFIFVGQVNILAPIVTINFLLTYATID 399          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Yeast
Match: VHC1 (Vacuolar membrane cation-chloride cotransporter (CCC); likely mediates K+ and Cl- cotransport into the vacuole; has a role in potassium homeostasis and salt tolerance; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); similar to mammalian electroneutral Na(+)-(K+)-C1- cotransporter family [Source:SGD;Acc:S000000439])

HSP 1 Score: 239.195 bits (609), Expect = 2.190e-65
Identity = 156/462 (33.77%), Postives = 252/462 (54.55%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVD-----ADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFT---TKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            SI AISTNG ++GGG Y+MISR+LGPE GGSIG++FFL  VF++ +     +E L+ + G   + +      +L+       + +AT +   C  V  VG    ++    +F+++                F +P+   + ++ S   E    +YTG S  TF +NL  + T        K   TF  +F + FP   GI  GA MS EL KP+ SIP+GTL   LFTFICY +  F    +  R  L++    +Q  +  +  + +G   T + + +   +GA+ +L A+A+D+I         L     +P+ S++ +++L Q+ L    VN IA  +++ FL+ +  +NLAC LL  ++A NFRP+FKYF+ YT+ +G    +    +   I +  +F    ++ + +++ S   SWG +SQ+L++HQVRKYLL   +R++++KYWRPQILL + NPR+
Sbjct:  115 SISAISTNGTVRGGGAYYMISRSLGPEFGGSIGLVFFLGQVFNAGMNAVGIIEPLLYNLGYSAQGEPPAALGELLPRGHWHEFTYATVILFLCFSVAFVGSQTVSRAGNILFLVLAASI------------FSIPL---SALIRSPFTEGGI-SYTGPSWQTFHDNLLPHLTKGAAGSLLKGKETFNDLFGVFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLLFTFICYAVVVFSMGCSIPRRSLYDEVQIIQTISSVQWVIFMGEMATSLFSIIVGMLGAAYVLEAIAKDNII------PGLEIFAHSPLYSLIFTWILTQLCLF-SDVNKIATFITMTFLMTFVVMNLACFLLGISSAPNFRPSFKYFNRYTTAIGALLSVVAMLIVDGISASVLFLAMILLFLFIHYFSPPKSWGDVSQSLIYHQVRKYLLR--LRQDNIKYWRPQILLFVDNPRT 551          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Nematostella
Match: EDO41917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S304])

HSP 1 Score: 377.867 bits (969), Expect = 1.209e-118
Identity = 212/459 (46.19%), Postives = 303/459 (66.01%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRV-DADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKY--MTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKP-AKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            SI AI+TNG +KGGG Y+MISRTLGPE GG+IGI+FF ANVF+SAL++  FVE L+++FGP G +   +   + + + +L+ + + + CL VC++G  +FAKT+  IF+ V V   + +VS          I    T++Y      +F +YT  S  T  +NL+  +T D+T  ++   T+  VFAILF GVTGIM GANMSG+L  P  +IP GTL A L TF+ Y+I    +  TC R LL  NY ++Q  +  +  + IG+F + +SAAL   IGASRIL A+A+D + G+ LKP A    +   P+ +V++S+  V+I+L IG +N +AP+VS+FFLL Y   N+AC +L  A+A NFRPTFKYFSW T+ LG   C  + F  + +Y+    ++ FI+ +I++ R+    WG +SQAL++HQVRKYLL +D+RKEHVK+WRPQ+LLL+SNPRS 
Sbjct:   54 SISAIATNGVVKGGGAYYMISRTLGPEFGGAIGIIFFFANVFASALYVLGFVEALLNNFGPRGSLAHIESFHQGYWYQFLYGSAILMLCLAVCMIGAGMFAKTSFVIFLAVMVSVSAALVSLFVDCPSTHLIKYNYTLLYLLQKSIRF-SYTSWSFKTAKSNLWPKFTKDYTKDEHSEQTWLQVFAILFNGVTGIMAGANMSGDLKSPGKAIPYGTLTACLGTFVVYVILVICTGFTCSRELLVENYNYLQVIDNVRVLITIGVFASTLSAALSCLIGASRILHAIAKDQLLGVILKPFAAGFGRNNEPLNAVLLSWFFVEIILFIGNLNTVAPLVSMFFLLCYGVTNMACFVLKVASAPNFRPTFKYFSWQTAFLGTVFCFVIMFAINPLYATISIAVMFILFIIISLRAPPTPWGDVSQALIYHQVRKYLLRLDVRKEHVKFWRPQVLLLVSNPRSS 511          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Nematostella
Match: EDO41391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G9])

HSP 1 Score: 205.682 bits (522), Expect = 2.559e-54
Identity = 146/491 (29.74%), Postives = 243/491 (49.49%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDR------------------------------FLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIF------GIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            S+ A+ TNG +KGGG Y++ISR+LGPE GGSIG++F LAN  + AL++  F E + D    + R +  LI +      +      +  L V L+G     +T + +  I+ +     IV      +F  P  K++                GL+  TF  NL  +Y      +    FF+VFA+ FP  TGI+ G N+SG+L     +IP+GTL A L + + YI   +L+ A   R                              + L N+Y  M+  + W P V  G+F   +S+AL + +GA +   AL +D+IF      GI + P      G  P    +++F++    + +G +NVIAPV+S FFL++YA +N A        +  +RP+F+Y++ + SL+G   C+ + FL ++  +L   ++   +   ++ +  + +WGS +QA  + Q  ++   ++  ++HVK +RPQ L+L   P S+
Sbjct:  126 SMSAVCTNGEVKGGGAYYLISRSLGPEFGGSIGLIFSLANAVAVALYVVGFAETVRD----ILRENGSLIIDEVNDIRVIGVISVLALLAVTLIGLEWVVRTQMVLLGILLISIVDAIVG-----SFIGPQDKLSVA----------QGIVGLNAKTFTTNLLPDY------RPGEHFFSVFAVFFPAATGILAGVNISGDLKDAQKAIPKGTLWAILLSTLVYIALAWLAGACILRDASGFVETVVNATANVTMATPPSCPGSGCLYGLINDYQAMEKMSAWGPLVTCGIFAATLSSALASLVGAPKTFQALCKDNIFPYIGYFGIGVGP------GEEPRRGYILTFIIAVGFVAVGNLNVIAPVISNFFLMSYALINYAVFAASLGRSPGWRPSFRYYNMWVSLVGALLCVAIMFLINWWAALVTIAIIASLHKYVDIKKPEVNWGSSAQAFTYIQALRFAYRLNNTEDHVKNFRPQCLVLTGAPSSR 585          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Nematostella
Match: EDO49361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG55])

HSP 1 Score: 204.527 bits (519), Expect = 4.045e-54
Identity = 147/509 (28.88%), Postives = 245/509 (48.13%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFL----------------------------SAATCDR----FLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQD------DIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNP--RSQKLRKNERFPKNQGI 2070
            S+ AI TNG +KGGG Y++ISR+LGPE GGSIGI+F +A+  + A+++  F E + D    L + +  LI +      +      +F L V LVG     +T + +  ++ +    VI               I T +   +  ++   + G     F      N+  DF  +    FF+VFAI FP  TGI+ G N+SG+L  P  ++P+GTL A L + + YI+  +L                            S  TCD     F L+ +   MQ  + W P V  G+F + +S+A+ + +GA +   A+ +D      D FG+   P      G  P    V++F++      IG +N IAP++S FFL+ YA +N A  +     +  +RP+F++++ + SL+G   C+ + FL ++  +L    +   +   +++R  + +WGS  QA  +    ++  ++D  +EHVK +RPQ L+L   P  R   +    +  KN G+
Sbjct:  124 SMSAICTNGEVKGGGAYYLISRSLGPEFGGSIGIIFSIASAVAVAMYVVGFAETVRD----LLKENGALIVDEVNDVRIIGLITIVFILAVALVGLKWVVRTQVILLAVLIISILDVI---------------IGTFIGPQNASSKAQGFLGYQDGVF----QTNFMPDFRGEG---FFSVFAIFFPAATGILAGVNISGDLKNPHTAVPKGTLLAILVSSLVYIVLAWLIGATYARDATGLVMSVAVVNGSSQSNVTSIPTCDTMKCLFGLYFDNQAMQKASGWGPIVTAGIFASTLSSAIASIVGAPKTFQAVCKDKLFPKIDYFGVGYGP------GNEPKRGYVLAFLIACAFTAIGDLNAIAPIISNFFLIVYALINYATFVASLGRSPGWRPSFRFYNMWVSLIGALLCVAIMFLINWWAALVTIMIVVGLYKFVDYRKPNVNWGSSGQANTYMSALRFTTLLDTHEEHVKNFRPQCLVLSGRPAERPDLMYIASQLTKNSGL 600          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Nematostella
Match: EDO35443 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLI2])

HSP 1 Score: 179.489 bits (454), Expect = 4.039e-46
Identity = 145/489 (29.65%), Postives = 235/489 (48.06%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVD----ADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXX-----XXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNY------LFMQATNLW--KPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPA-----KLTTKGGNPIGSVVISFVLVQIVLLIG--KVNVIAPVVSV---FFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLS-----NPRSQKL 2034
            S+ A++TNG +  GG YFMISR LGPE GG++G+LF+L   F+S++++   +E LV  F  L          LI      ++ +     +    VC++G ++ AK++            +   S           +   +P I + V++ + ++ +     +       +       D TT    +FF + AI FP VTGIM G+N SG+L     SIP+GT+AA   T   Y+ S  L  AT    LL + +      + + A   W  K  ++IG  L+ I A + +  GA  +L A+A+D+I   FL  +     +L T+    +  + +  +    V+++G   ++   P  S+   FFL+ Y  VNLACA+       N+RP FKY+ W+TS LGV  CL + F++S+ Y+L    +   +   + F+     WG   + L     R  LL ++    H K WRPQIL+L        P+S++L
Sbjct:   53 SMSAVATNGVVPAGGSYFMISRALGPEFGGAVGLLFYLGTTFASSMYILGAIEILVILFEELELFSFFSLPYLISRPVASSFSYFLVFTVKFSEVCILGDAILAKSSYETCSYNDSMLRTAYGSDPVFWNSTRLRYVKGVPGITSGVFTENAKSHYLKKNEIKMGVAAGSNEGEIRSDTTT----SFFILLAIFFPSVTGIMAGSNRSGDLKDAQNSIPKGTIAAIATTSFVYLTSVLLFGATIQGELLRDKFGRSIGGVLVVANIAWPTKWVILIGSLLSTIGAGMQSLTGAPCLLQAIAKDNIIP-FLDLSTGTLSQLFTQKSAALAKINL-LLKTCFVMVLGYLPLDFCVPGFSLCYGFFLMCYGFVNLACAVQSLLRTPNWRPRFKYYHWFTSFLGVCLCLALMFISSWYYALVAMIIAAAVYKYIEFQGAKKEWGDGIRGLALSAARFSLLRLEEGPPHTKNWRPQILILCKLDESLQPQSRRL 535          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Nematostella
Match: EDO46430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ45])

HSP 1 Score: 110.923 bits (276), Expect = 7.231e-25
Identity = 64/189 (33.86%), Postives = 104/189 (55.03%), Query Frame = 1
Query: 1141 NNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFI--CYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLA 1701
             N+  N    F  K+   FFTVF + FP  TG+++G NMSG+L  P+ +IP GTLAA  F ++   YI+   L  A C R  L  +Y+     +L     + G++++ +S+ LG   GA R+L  ++QD++  I     K       P  + +   V+  + +LIG +N +AP+V++ FL+ YAS++ A
Sbjct:  194 ENMEKNAAPQFGAKQ--NFFTVFGVFFPSATGVLSGINMSGDLKDPSSNIPAGTLAALGFRWVGLLYILFAVLLGAVCTREALLTDYMIASKVSLVGVLFLFGLYVSSLSSCLGAQYGAPRVLQVISQDNVVPIIKPLGKERGANKEPYVASIFVAVIAMLFILIGNLNALAPIVTMPFLVTYASIDYA 380          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Medaka
Match: slc12a9 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:101175259])

HSP 1 Score: 390.578 bits (1002), Expect = 3.607e-144
Identity = 226/463 (48.81%), Postives = 318/463 (68.68%), Query Frame = 1
Query:  670 CAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDAD--------LIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSN-SNETQFGN--YTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            CAISTNGAI+GGG Y+MISR+LGPE GGSIG++FFLA VF+   ++   VE L+D FG    +D +        ++ + + +  L+++ V + CL +CLVG  ++++T   I ++V V   S+ +S +  K      P+   I +    N+T   N  +TG S  T  +NL   Y++D++T   M+F TVFA++F   TGIM GANMSGEL  P+VSIPRGT+ A ++TF  YI+ F L++ATCDR LL  +Y F Q  NLW PFV IG+F   +SAA+   IGASRIL ALA D +FG+ L PA +T+  GNP  +V+ ++ L Q V+  G +N +A +V+VF+LLA+A+V+LAC  L+WA+A NFRPTF++FSW+T LLG+  CL M F+ + +YS G   L  ++++ L++RS   SWG ISQAL+FHQVRKYLLM+D+RKEHVK+WRPQ+LL++SNPRS
Sbjct:   99 CAISTNGAIQGGGAYYMISRSLGPEFGGSIGLMFFLAKVFACGEYVLGLVEALLDVFG----MDTESSVSAGVRVLPQGYWYTILYSSVVLLLCLIICLVGAHIYSRTAFVILLVVTVSLLSIFISSVAVK------PQNFVITHQGLGNQTLRYNASFTGFSAATLRSNLGPRYSLDYSTNTVMSFATVFAVMFTSCTGIMAGANMSGELKTPSVSIPRGTIIAVIYTFTVYILLFILASATCDRTLLIQDYGFFQRINLWPPFVTIGIFCASLSAAMCAMIGASRILHALALDQLFGLPLAPAAVTSSSGNPWVAVLYTWGLAQCVVFAGHLNAVAGLVTVFYLLAFAAVDLACLALEWASAPNFRPTFQFFSWHTCLLGILSCLVMMFVINPVYSSGSIVLLLLLLLFLHYRSPTSSWGYISQALIFHQVRKYLLMLDVRKEHVKFWRPQVLLMVSNPRS 551          

HSP 2 Score: 143.28 bits (360), Expect = 3.607e-144
Identity = 112/412 (27.18%), Postives = 178/412 (43.20%), Query Frame = 2
Query: 2012 PIHAVRNF-AKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKV 3244
            P+    NF   + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D   P D                                F  Q S  +D S  V Q++    N   +L                 P      PP+R      +                          +S  EYVGII+D +KM KN+CL R+F  +   G  +      + IDVWP+N  QPG   Y D   +F+LQ++C+LNMS++W    ++R+++ ++  +        +  + +LL + RI+A IK V WD  + +            +T+S+E +       TL + +L  VN ++  H S   AV F YLP  P  G+     +Y+ QL  +T  L P++ + G   V
Sbjct:  585 PVQQQYNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLILGFYDSCTPDD--------------------------------FFLQDSAFYDTS--VGQNSEGEYNFGVDL-----------------PSLQAHFPPVRHVESPRW--------------------------LSPEEYVGIISDALKMNKNVCLGRYFFQLQGEGKDSKTDGSERTIDVWPLNLLQPGCRDYQDVCSLFLLQMACVLNMSSKW-RNARMRIFLNVETASCDQGWVINEETFRDLLKKLRIRASIKIVSWDPAVQH------------HTISEEERPSESLP-TLSEDFLSAVNCMLTEH-SSQAAVRFLYLPRPPAQGSQAQ--QYLAQLEAITYGLGPTLLIHGVTPV 902          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Medaka
Match: slc12a9 (solute carrier family 12 member 9-like [Source:NCBI gene;Acc:101175259])

HSP 1 Score: 383.645 bits (984), Expect = 3.682e-142
Identity = 228/485 (47.01%), Postives = 318/485 (65.57%), Query Frame = 1
Query:  670 CAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG----------------------------PLGRVDA--DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSN-SNETQFGN--YTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            CAISTNGAI+GGG Y+MISR+LGPE GGSIG++FFLA VF+   ++   VE L+D FG                            P   V A   ++ + + +  L+++ V + CL +CLVG  ++++T   I ++V V   S+ +S +  K      P+   I +    N+T   N  +TG S  T  +NL   Y++D++T   M+F TVFA++F   TGIM GANMSGEL  P+VSIPRGT+ A ++TF  YI+ F L++ATCDR LL  +Y F Q  NLW PFV IG+F   +SAA+   IGASRIL ALA D +FG+ L PA +T+  GNP  +V+ ++ L Q V+  G +N +A +V+VF+LLA+A+V+LAC  L+WA+A NFRPTF++FSW+T LLG+  CL M F+ + +YS G   L  ++++ L++RS   SWG ISQAL+FHQVRKYLLM+D+RKEHVK+WRPQ+LL++SNPRS
Sbjct:   99 CAISTNGAIQGGGAYYMISRSLGPEFGGSIGLMFFLAKVFACGEYVLGLVEALLDVFGMDTGNCLHILSFLNLWLGAFDPPGLFFLPESSVSAGVRVLPQGYWYTILYSSVVLLLCLIICLVGAHIYSRTAFVILLVVTVSLLSIFISSVAVK------PQNFVITHQGLGNQTLRYNASFTGFSAATLRSNLGPRYSLDYSTNTVMSFATVFAVMFTSCTGIMAGANMSGELKTPSVSIPRGTIIAVIYTFTVYILLFILASATCDRTLLIQDYGFFQRINLWPPFVTIGIFCASLSAAMCAMIGASRILHALALDQLFGLPLAPAAVTSSSGNPWVAVLYTWGLAQCVVFAGHLNAVAGLVTVFYLLAFAAVDLACLALEWASAPNFRPTFQFFSWHTCLLGILSCLVMMFVINPVYSSGSIVLLLLLLLFLHYRSPTSSWGYISQALIFHQVRKYLLMLDVRKEHVKFWRPQVLLMVSNPRS 577          

HSP 2 Score: 143.28 bits (360), Expect = 3.682e-142
Identity = 112/412 (27.18%), Postives = 178/412 (43.20%), Query Frame = 2
Query: 2012 PIHAVRNF-AKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKV 3244
            P+    NF   + D L +KAF+D+T++P++R G + L  + GLGG+  NT+ +GF D   P D                                F  Q S  +D S  V Q++    N   +L                 P      PP+R      +                          +S  EYVGII+D +KM KN+CL R+F  +   G  +      + IDVWP+N  QPG   Y D   +F+LQ++C+LNMS++W    ++R+++ ++  +        +  + +LL + RI+A IK V WD  + +            +T+S+E +       TL + +L  VN ++  H S   AV F YLP  P  G+     +Y+ QL  +T  L P++ + G   V
Sbjct:  611 PVQQQYNFWLSLVDKLGVKAFVDLTLSPSVRQGTQHLLRITGLGGMKPNTLILGFYDSCTPDD--------------------------------FFLQDSAFYDTS--VGQNSEGEYNFGVDL-----------------PSLQAHFPPVRHVESPRW--------------------------LSPEEYVGIISDALKMNKNVCLGRYFFQLQGEGKDSKTDGSERTIDVWPLNLLQPGCRDYQDVCSLFLLQMACVLNMSSKW-RNARMRIFLNVETASCDQGWVINEETFRDLLKKLRIRASIKIVSWDPAVQH------------HTISEEERPSESLP-TLSEDFLSAVNCMLTEH-SSQAAVRFLYLPRPPAQGSQAQ--QYLAQLEAITYGLGPTLLIHGVTPV 928          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Medaka
Match: zgc:153039 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:101160334])

HSP 1 Score: 421.009 bits (1081), Expect = 1.522e-130
Identity = 237/464 (51.08%), Postives = 327/464 (70.47%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDA---DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFG-----NYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIG++FFLANV  SALF+   VE ++D FG    G V A    ++   + W+ L+ T + + CL VCLVG  ++AK    IF+IV V   ++++SF       + +P  +    S++N T  G     N+TG    T + NL A+Y +D+TTKK MTF TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FTFI Y +   L+A TCDR LL  +Y FM+  N+W PFVI+G++ + +SAA+ N IGASR+L+ALA+DD+FG    PAK T+  GNP  SV+IS+  VQ+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C+ M FL + IY+    +   ++++++++ S   SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQILL++SNPRS
Sbjct:  103 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGLMFFLANVCGSALFVLGLVEAVMDTFGVPEDGTVAATSYQVLPSGYWWSLLYGTGILLLCLLVCLVGAHIYAKATFLIFLIVMVVLGTILISFFAVSPKTILLPSSS----SSANGTGPGFPTTANFTGFKLDTLVGNLEADYVIDYTTKKMMTFATVFAVMFNGCTGIMAGSNMSGDLKNPSYSIPRGTITAVIFTFIIYNLLSVLAACTCDRVLLQRDYSFMRDINIWHPFVIVGVYSSTLSAAMSNLIGASRVLYALARDDLFGKVFSPAKKTSHSGNPWVSVLISWFCVQLVLFSGKLNTIASIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCVLGIIGCVVMMFLINAIYASASIAFMLLLLLLIHYLSPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQILLMVSNPRS 562          

HSP 2 Score: 132.109 bits (331), Expect = 6.985e-31
Identity = 88/280 (31.43%), Postives = 134/280 (47.86%), Query Frame = 2
Query: 2483 YGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMD----LIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGG---KIMSANTLSDEIKTISLFD--------------CTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            + ++  + D Q   +      + +   +   EYV +IAD MKM KN+ L R+F N D    L+   +S      ++DVWP+N  +P S SY+D   +F+LQL+CILNM   W  K  +R+++C++    G +    +    +LL   RI+A++  V WD ++       GG   K  S +  +DE    +  D                L D YL  VN LI        AV F YLP  P    ++ +  Y+ QL LLT DL P++ + G   VIT+ L
Sbjct:  638 FASLRGSGDKQDSGE------FEDGKVLGPEEYVAVIADAMKMLKNVVLARYFNNFDRSQALLPSSSSPGKGGVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMVRAW-RKATLRLFLCVEE---GRSVKGSEEKLGQLLKDLRIKAQVYPVPWDQVVALHWQRQGGWSRKQQSTDPSTDESAARAEEDENQDDYVNSFPSNATRLSDDYLSAVNKLILDQTRQPPAVRFLYLPRPP--ADTRGYTAYLQQLDLLTQDLGPTLLIHGVTPVITTDL 905          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Medaka
Match: zgc:153039 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:101160334])

HSP 1 Score: 421.394 bits (1082), Expect = 3.711e-130
Identity = 237/464 (51.08%), Postives = 327/464 (70.47%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFG--PLGRVDA---DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFG-----NYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIG++FFLANV  SALF+   VE ++D FG    G V A    ++   + W+ L+ T + + CL VCLVG  ++AK    IF+IV V   ++++SF       + +P  +    S++N T  G     N+TG    T + NL A+Y +D+TTKK MTF TVFA++F G TGIM G+NMSG+L  P+ SIPRGT+ A +FTFI Y +   L+A TCDR LL  +Y FM+  N+W PFVI+G++ + +SAA+ N IGASR+L+ALA+DD+FG    PAK T+  GNP  SV+IS+  VQ+VL  GK+N IA +V++FFLL YA+V+LAC  L+WA+A NFRPTF+YF+W+T +LG+  C+ M FL + IY+    +   ++++++++ S   SWG ISQAL+FHQVRKYLLM+D+RK+HVK+WRPQILL++SNPRS
Sbjct:  103 SVCAISTNGALDAGGAYYMISRALGPEFGGSIGLMFFLANVCGSALFVLGLVEAVMDTFGVPEDGTVAATSYQVLPSGYWWSLLYGTGILLLCLLVCLVGAHIYAKATFLIFLIVMVVLGTILISFFAVSPKTILLPSSS----SSANGTGPGFPTTANFTGFKLDTLVGNLEADYVIDYTTKKMMTFATVFAVMFNGCTGIMAGSNMSGDLKNPSYSIPRGTITAVIFTFIIYNLLSVLAACTCDRVLLQRDYSFMRDINIWHPFVIVGVYSSTLSAAMSNLIGASRVLYALARDDLFGKVFSPAKKTSHSGNPWVSVLISWFCVQLVLFSGKLNTIASIVTIFFLLVYAAVDLACLALEWASAPNFRPTFRYFTWHTCVLGIIGCVVMMFLINAIYASASIAFMLLLLLLIHYLSPTSSWGYISQALIFHQVRKYLLMLDVRKDHVKFWRPQILLMVSNPRS 562          

HSP 2 Score: 132.109 bits (331), Expect = 8.966e-31
Identity = 88/280 (31.43%), Postives = 134/280 (47.86%), Query Frame = 2
Query: 2483 YGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMD----LIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGG---KIMSANTLSDEIKTISLFD--------------CTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            + ++  + D Q   +      + +   +   EYV +IAD MKM KN+ L R+F N D    L+   +S      ++DVWP+N  +P S SY+D   +F+LQL+CILNM   W  K  +R+++C++    G +    +    +LL   RI+A++  V WD ++       GG   K  S +  +DE    +  D                L D YL  VN LI        AV F YLP  P    ++ +  Y+ QL LLT DL P++ + G   VIT+ L
Sbjct:  687 FASLRGSGDKQDSGE------FEDGKVLGPEEYVAVIADAMKMLKNVVLARYFNNFDRSQALLPSSSSPGKGGVFVDVWPVNLLRPDSSSYVDTCSLFLLQLACILNMVRAW-RKATLRLFLCVEE---GRSVKGSEEKLGQLLKDLRIKAQVYPVPWDQVVALHWQRQGGWSRKQQSTDPSTDESAARAEEDENQDDYVNSFPSNATRLSDDYLSAVNKLILDQTRQPPAVRFLYLPRPP--ADTRGYTAYLQQLDLLTQDLGPTLLIHGVTPVITTDL 954          

HSP 3 Score: 51.2174 bits (121), Expect = 7.088e-6
Identity = 23/58 (39.66%), Postives = 37/58 (63.79%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDIL 2203
            ++  + D L IKAF+++T+A +I  G + L  + GLGG+  NT+ +GF D+  P D L
Sbjct:  603 SWLSLVDHLNIKAFVNLTLADSIHHGVQHLLFISGLGGMRPNTLVLGFYDNCSPNDRL 660          
BLAST of Solute carrier family 12 member 9 vs. Ensembl Medaka
Match: ENSORLT00000043132.1 (solute carrier family 12 member 9 [Source:NCBI gene;Acc:101161090])

HSP 1 Score: 399.823 bits (1026), Expect = 9.468e-123
Identity = 227/460 (49.35%), Postives = 314/460 (68.26%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDA------DLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRS 2025
            S+CAISTNGA+  GG Y+MISR LGPE GGSIGI+FFLA+V + AL++   VE ++  FG +   DA       ++   + W  L+ T +   C  VCLVG  ++AK    IFIIV     SV +SF   +   V +P      + N+      NYTG+   T   NL+++YTVD+TT   M+F TVFA+LF G TGIM G+NMSG+L  P+ SIPRGTLAA L TFI Y +   LSA TCDR+LL  +Y F+   N+W P V +G++ + +SAA+ + IGASRIL+AL++D++FG+FL  AK T + GNP  SV+IS++ VQ+VL  GK+N IA +V++FFLL YA+VNLAC  L+WA+A NFRP+F++F+W+T  LG+  CL M FL S IY+        ++++++++     +WG ISQAL+FHQVRKYLLM+D RK+HVK+WR Q+LL+++NPRS
Sbjct:   94 SVCAISTNGALHAGGAYYMISRALGPEFGGSIGIMFFLASVCACALYILGLVEAIMTTFG-VPEEDAAVAAGHQVLPSGYWWCLLYGTILLFLCFIVCLVGAHIYAKATFLIFIIVMAVLASVFISFFVLEPTVVILPDT---FHVNNTSPATANYTGVRLRTLEGNLFSHYTVDYTTGDLMSFATVFAVLFNGCTGIMAGSNMSGDLKNPSYSIPRGTLAAVLATFIIYNLISLLSALTCDRYLLQRDYSFLGDINVWPPMVTVGIYSSAMSAAMSSLIGASRILYALSKDNLFGVFLALAKKTARSGNPWVSVLISWLFVQVVLFAGKLNTIAGIVTIFFLLVYAAVNLACLALEWASAPNFRPSFRFFTWHTCTLGILGCLVMMFLISPIYAFASIVFMLLLLMLIHYLGPCSNWGYISQALIFHQVRKYLLMLDARKDHVKFWRLQVLLMVANPRS 549          

HSP 2 Score: 76.6406 bits (187), Expect = 1.071e-13
Identity = 66/244 (27.05%), Postives = 114/244 (46.72%), Query Frame = 2
Query: 2579 YVGIIADCMKMQKNICLCRHFENMD---LIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGG-------------KIMSANTLSDEIKTISLFDCT-LPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            YV IIAD +KM KN+ L R+F   D   ++GL                     G G + D+      +L+ +L     W  +  +R+++C++    G  +   +     +L + RI A+++ V WD+++       GG             ++   +   D ++T  L D +  PD Y+  VN+LI  H SP TAV F +LP  P+   ++ +  Y+ Q+ LL+ DL P++ + G   V+T+ L
Sbjct:  692 YVSIIADALKMGKNVILARYFNQFDRQEVLGL---------------------GKG-FRDHQ-----KLASVLQEVRAWK-QASLRLFLCVE--AGGRLQEEEELRLRSMLKELRISAQVQKVAWDNVVRLHWQRRGGEEDLVEYPQTDEERLRRQSDKDDSVQT-RLSDASPTPDEYICAVNSLIFRHSSPQTAVRFLHLPHPPS--DARRYRVYLHQVDLLSRDLGPTLLIHGITPVVTTDL 902          

HSP 3 Score: 55.4546 bits (132), Expect = 3.424e-7
Identity = 24/56 (42.86%), Postives = 37/56 (66.07%), Query Frame = 2
Query: 2030 NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKD 2197
            ++  + D LKIKAF++ T+A ++R G R L  + G GG+  NT+ +GF DD  P+D
Sbjct:  590 SWLSLVDHLKIKAFVNFTLADSVRHGVRNLLFISGFGGMRPNTLILGFYDDCIPQD 645          
BLAST of Solute carrier family 12 member 9 vs. Planmine SMEST
Match: SMESG000033021.1 (SMESG000033021.1)

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 412/417 (98.80%), Postives = 414/417 (99.28%), Query Frame = 2
Query: 2012 PIHAVR-NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            P+H +  NFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL
Sbjct:  583 PVHEIEGNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQQSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 999          

HSP 2 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 455/455 (100.00%), Postives = 455/455 (100.00%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNLFIFIIVFVCFFSVIVSFLFHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYIYSLGIFSLFFIIIVILNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ
Sbjct:   96 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNLFIFIIVFVCFFSVIVSFLFHKAFQVPIPKINTIVYSNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYIYSLGIFSLFFIIIVILNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 550          

HSP 3 Score: 144.821 bits (364), Expect = 6.884e-35
Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 3
Query:   21 MKNPEVLRTFPSINEEYAQNSRYYHDPTIIETLTLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLGY 227
            MKNPEVLRTFPSINEEYAQNSRYYHDPTIIETLTLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLG+
Sbjct:    1 MKNPEVLRTFPSINEEYAQNSRYYHDPTIIETLTLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLGF 69          
BLAST of Solute carrier family 12 member 9 vs. Planmine SMEST
Match: SMESG000060496.1 (SMESG000060496.1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 343/457 (75.05%), Postives = 391/457 (85.56%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSN-ETQFGNYTGLSGTTFINN-LYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            SICAISTNGA++GGGVYFMISRTLGPEVGGSIGILFFLANVFSSAL+M+  VEGL+DDFGP GR+ A +I E   W YLFATCVC+FCL VCLVGGS+FAKTNLFIF+ VFVCF SV+V+FLF  +  V IP  N ++Y + N   QFG +TGL+GTTF  N LY  Y +DF+T   M F +VFAI+F GVTGIMNGANMSGEL +PA+SIP+GTLAA LFTFICY +SF LSAATC+RFLL NNYL+MQA N W+PFV+IG+  TC+SA LGN IGASRIL+ALA+DDIFG  LKPAKL TKGGNPI SVVISFVLVQ+VL IG++N+IAPVVSVFFLLAYASVN ACALLD A+ASNFRPTFKYFSW+TSLLGV CCLGMCFL +Y YS+GIF LF I+IV LNFR LD++WG+I QALLFHQVRKYLL+ID RKEHVKYWRPQ+LLLLSNPRSQ
Sbjct:   95 SICAISTNGAVEGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALYMSGLVEGLMDDFGPEGRIVAGIIPEGRWWTYLFATCVCLFCLAVCLVGGSMFAKTNLFIFLAVFVCFTSVLVTFLFQSSHLVKIPMTNKVIYPHHNMSQQFGQFTGLNGTTFRKNILYDGYRIDFSTGNQMDFLSVFAIMFSGVTGIMNGANMSGELKQPAISIPKGTLAAALFTFICYTLSFLLSAATCERFLLLNNYLYMQAINFWRPFVLIGIIATCLSAGLGNLIGASRILYALAKDDIFGFLLKPAKLATKGGNPIASVVISFVLVQLVLFIGQLNLIAPVVSVFFLLAYASVNFACALLDLASASNFRPTFKYFSWHTSLLGVVCCLGMCFLVNYQYSIGIFILFVILIVALNFRRLDFAWGNIGQALLFHQVRKYLLLIDTRKEHVKYWRPQVLLLLSNPRSQ 551          

HSP 2 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 305/421 (72.45%), Postives = 336/421 (79.81%), Query Frame = 2
Query: 2027 RNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSES--------FDKSKIVQQSASRI-DNENTNLIYKGKNKIFN-LLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            + F  MKDFL IKAFIDVTIAPTIRDGCRQLS LCGLGGL INTVCIGFRDDSEP+DIL+KI  Q N    +   + R+   FA     FT + S S         D S  +  ++S I  +ENT L+ K + K  N +L+  VDP+FID+LPPIR TR   +G IN  S +++  ++    NYINNDQ+SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMS+QWSSKCKIRVYICLDYYTIGT   NVQ LWNELL QWRIQAEIKTVGWDDI +NLE NLG KIMS N +SDEIKTISLFDCTLPDTY+KEVNNLIK H S NTAVCFFYLPIIPNI  SQ+W KYI+QLTLLTNDLPPSVFVRG H+VITSAL
Sbjct:  590 KKFIIMKDFLDIKAFIDVTIAPTIRDGCRQLSRLCGLGGLMINTVCIGFRDDSEPQDILQKINCQMNNLKSNWPFKPRHIPAFAELSSDFTGEQSTSKRLCHNISVDNS--INSTSSHICVDENTRLVTKDRMKFLNRILRPSVDPKFIDELPPIRSTRQELFGEINELSANRETRED----NYINNDQISEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 1004          

HSP 3 Score: 94.7449 bits (234), Expect = 2.504e-19
Identity = 45/62 (72.58%), Postives = 52/62 (83.87%), Query Frame = 3
Query:   39 LRTFPSINEEYAQNSRYYHDPTIIETLTLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLG 224
            + TFP +++E  QN R+Y+D TI ETLT S DQ+KR LKTFTGVFCPVALAQFSSLLFLRLG
Sbjct:    6 METFPQLHDESEQNKRHYYDLTISETLTASVDQSKRTLKTFTGVFCPVALAQFSSLLFLRLG 67          
BLAST of Solute carrier family 12 member 9 vs. Planmine SMEST
Match: SMESG000060496.1 (SMESG000060496.1)

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 343/457 (75.05%), Postives = 391/457 (85.56%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCLGVCLVGGSLFAKTNXXXXXXXXXXXXXXXXXXXXHKAFQVPIPKINTIVYSNSN-ETQFGNYTGLSGTTFINN-LYANYTVDFTTKKYMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLSNPRSQ 2028
            SICAISTNGA++GGGVYFMISRTLGPEVGGSIGILFFLANVFSSAL+M+  VEGL+DDFGP GR+ A +I E   W YLFATCVC+FCL VCLVGGS+FAKTNLFIF+ VFVCF SV+V+FLF  +  V IP  N ++Y + N   QFG +TGL+GTTF  N LY  Y +DF+T   M F +VFAI+F GVTGIMNGANMSGEL +PA+SIP+GTLAA LFTFICY +SF LSAATC+RFLL NNYL+MQA N W+PFV+IG+  TC+SA LGN IGASRIL+ALA+DDIFG  LKPAKL TKGGNPI SVVISFVLVQ+VL IG++N+IAPVVSVFFLLAYASVN ACALLD A+ASNFRPTFKYFSW+TSLLGV CCLGMCFL +Y YS+GIF LF I+IV LNFR LD++WG+I QALLFHQVRKYLL+ID RKEHVKYWRPQ+LLLLSNPRSQ
Sbjct:   90 SICAISTNGAVEGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALYMSGLVEGLMDDFGPEGRIVAGIIPEGRWWTYLFATCVCLFCLAVCLVGGSMFAKTNLFIFLAVFVCFTSVLVTFLFQSSHLVKIPMTNKVIYPHHNMSQQFGQFTGLNGTTFRKNILYDGYRIDFSTGNQMDFLSVFAIMFSGVTGIMNGANMSGELKQPAISIPKGTLAAALFTFICYTLSFLLSAATCERFLLLNNYLYMQAINFWRPFVLIGIIATCLSAGLGNLIGASRILYALAKDDIFGFLLKPAKLATKGGNPIASVVISFVLVQLVLFIGQLNLIAPVVSVFFLLAYASVNFACALLDLASASNFRPTFKYFSWHTSLLGVVCCLGMCFLVNYQYSIGIFILFVILIVALNFRRLDFAWGNIGQALLFHQVRKYLLLIDTRKEHVKYWRPQVLLLLSNPRSQ 546          

HSP 2 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 305/421 (72.45%), Postives = 336/421 (79.81%), Query Frame = 2
Query: 2027 RNFAKMKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEPKDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSES--------FDKSKIVQQSASRI-DNENTNLIYKGKNKIFN-LLKSPVDPEFIDKLPPIRRTRHATYGTINANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVGWDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKFHVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHKVITSAL 3259
            + F  MKDFL IKAFIDVTIAPTIRDGCRQLS LCGLGGL INTVCIGFRDDSEP+DIL+KI  Q N    +   + R+   FA     FT + S S         D S  +  ++S I  +ENT L+ K + K  N +L+  VDP+FID+LPPIR TR   +G IN  S +++  ++    NYINNDQ+SEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMS+QWSSKCKIRVYICLDYYTIGT   NVQ LWNELL QWRIQAEIKTVGWDDI +NLE NLG KIMS N +SDEIKTISLFDCTLPDTY+KEVNNLIK H S NTAVCFFYLPIIPNI  SQ+W KYI+QLTLLTNDLPPSVFVRG H+VITSAL
Sbjct:  585 KKFIIMKDFLDIKAFIDVTIAPTIRDGCRQLSRLCGLGGLMINTVCIGFRDDSEPQDILQKINCQMNNLKSNWPFKPRHIPAFAELSSDFTGEQSTSKRLCHNISVDNS--INSTSSHICVDENTRLVTKDRMKFLNRILRPSVDPKFIDELPPIRSTRQELFGEINELSANRETRED----NYINNDQISEVEYVGIIADCMKMQKNICLCRHFENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILNMSSQWSSKCKIRVYICLDYYTIGTNRKNVQELWNELLIQWRIQAEIKTVGWDDITMNLETNLGRKIMSNNAMSDEIKTISLFDCTLPDTYVKEVNNLIKLHTSLNTAVCFFYLPIIPNITKSQFWRKYINQLTLLTNDLPPSVFVRGLHEVITSAL 999          

HSP 3 Score: 94.7449 bits (234), Expect = 2.517e-19
Identity = 45/62 (72.58%), Postives = 52/62 (83.87%), Query Frame = 3
Query:   39 LRTFPSINEEYAQNSRYYHDPTIIETLTLSSDQTKRNLKTFTGVFCPVALAQFSSLLFLRLG 224
            + TFP +++E  QN R+Y+D TI ETLT S DQ+KR LKTFTGVFCPVALAQFSSLLFLRLG
Sbjct:    1 METFPQLHDESEQNKRHYYDLTISETLTASVDQSKRTLKTFTGVFCPVALAQFSSLLFLRLG 62          
BLAST of Solute carrier family 12 member 9 vs. Planmine SMEST
Match: SMESG000019076.1 (SMESG000019076.1)

HSP 1 Score: 167.548 bits (423), Expect = 8.486e-42
Identity = 99/286 (34.62%), Postives = 162/286 (56.64%), Query Frame = 1
Query: 1186 YMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNY----------LFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLS 2013
            Y++F  +  I FP VTGIM G+N SG+L  P  SIP G++AA   T   Y+ +    +AT +  +L + +            +   N W   ++IG FL+ + A L +  GA R+L A+AQD++   FL+  K+TTK G P+ +  ++F +  + +LI  ++ IAP++++FFL+ Y  VNLA AL  +    ++RP FKY+ W TSLLG+  C+ + F++S+ Y+L   +L   I   + +R     WG  ++       +K +L +  +  H K WRPQIL+L++
Sbjct:  401 YISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEW--VILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIP-FLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILIN 683          

HSP 2 Score: 63.1586 bits (152), Expect = 1.109e-9
Identity = 34/93 (36.56%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP----LGRVDADLIQENFGWNYLFATCVCIFCL 930
            S+ AI+TNG +  GG YFMISR+LGPE GG++GILF+     ++A+++   +E ++    P     G ++ D   EN  +N      V + C+
Sbjct:  159 SMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELD---ENIMFNNTRVYGVILLCI 248          
BLAST of Solute carrier family 12 member 9 vs. Planmine SMEST
Match: SMESG000019076.1 (SMESG000019076.1)

HSP 1 Score: 167.548 bits (423), Expect = 9.119e-42
Identity = 99/286 (34.62%), Postives = 162/286 (56.64%), Query Frame = 1
Query: 1186 YMTFFTVFAILFPGVTGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFLLWNNY----------LFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIFGIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLAYASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYXXXXXXXXXXXXXXXXXNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVKYWRPQILLLLS 2013
            Y++F  +  I FP VTGIM G+N SG+L  P  SIP G++AA   T   Y+ +    +AT +  +L + +            +   N W   ++IG FL+ + A L +  GA R+L A+AQD++   FL+  K+TTK G P+ +  ++F +  + +LI  ++ IAP++++FFL+ Y  VNLA AL  +    ++RP FKY+ W TSLLG+  C+ + F++S+ Y+L   +L   I   + +R     WG  ++       +K +L +  +  H K WRPQIL+L++
Sbjct:  409 YISFTILIGIFFPSVTGIMAGSNRSGDLANPQFSIPLGSIAACATTSFVYLSAVIFFSATVEHTVLRDKFGGSVGEGLIVAKLAWPNEW--VILIGSFLSTVGAGLQSLTGAPRLLQAIAQDNVIP-FLEVFKVTTKRGEPLRAQALTFFISFLGVLIASIDSIAPLITMFFLMCYGFVNLATALNGFLQEPSWRPRFKYYHWTTSLLGLILCIALMFVSSWYYALVAIALAGGIYKYIEYRGATKEWGDATRGFQMSAAKKAILQLGDKPVHTKNWRPQILILIN 691          

HSP 2 Score: 63.1586 bits (152), Expect = 1.147e-9
Identity = 34/93 (36.56%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  664 SICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLANVFSSALFMAAFVEGLVDDFGP----LGRVDADLIQENFGWNYLFATCVCIFCL 930
            S+ AI+TNG +  GG YFMISR+LGPE GG++GILF+     ++A+++   +E ++    P     G ++ D   EN  +N      V + C+
Sbjct:  167 SMSAIATNGKVPAGGSYFMISRSLGPEFGGTVGILFYFGTTVAAAMYIIGAIEVMLKYIVPKASLFGPIELD---ENIMFNNTRVYGVILLCI 256          
The following BLAST results are available for this feature:
BLAST of Solute carrier family 12 member 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC12A97.728e-13249.16solute carrier family 12 member 9 [Source:HGNC Sym... [more]
SLC12A91.045e-12850.22solute carrier family 12 member 9 [Source:HGNC Sym... [more]
SLC12A93.819e-10647.74solute carrier family 12 member 9 [Source:HGNC Sym... [more]
SLC12A96.746e-6054.89solute carrier family 12 member 9 [Source:HGNC Sym... [more]
SLC12A91.047e-4955.13solute carrier family 12 member 9 [Source:HGNC Sym... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T04B8.56.293e-11846.58pep chromosome:WBcel235:II:614767:620909:-1 gene:W... [more]
T04B8.53.323e-11746.37pep chromosome:WBcel235:II:614770:621330:-1 gene:W... [more]
T04B8.53.423e-11746.37pep chromosome:WBcel235:II:614770:624543:-1 gene:W... [more]
nkcc-11.981e-5731.76Na-K-Cl Cotransporter homolog [Source:UniProtKB/T... [more]
nkcc-15.978e-5731.76Na-K-Cl Cotransporter homolog [Source:UniProtKB/T... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG104131.548e-11750.54gene:FBgn0032689 transcript:FBtr0343829[more]
CG104131.548e-11750.54gene:FBgn0032689 transcript:FBtr0081080[more]
NKCC3.669e-5329.13gene:FBgn0051547 transcript:FBtr0078765[more]
NKCC5.830e-5329.13gene:FBgn0051547 transcript:FBtr0078764[more]
Ncc691.460e-4130.84gene:FBgn0036279 transcript:FBtr0333842[more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1530395.405e-15451.40zgc:153039 [Source:ZFIN;Acc:ZDB-GENE-060929-736][more]
slc12a93.656e-11647.72solute carrier family 12 member 9 [Source:NCBI gen... [more]
slc12a93.656e-11647.72solute carrier family 12 member 9 [Source:NCBI gen... [more]
zgc:1530395.376e-7648.51zgc:153039 [Source:ZFIN;Acc:ZDB-GENE-060929-736][more]
slc12a21.812e-5028.76solute carrier family 12 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045638.11.418e-13351.31solute carrier family 12 member 9-like [Source:NCB... [more]
ENSXETT00000045625.12.189e-13351.31solute carrier family 12 member 9-like [Source:NCB... [more]
SLC12A95.045e-11249.14solute carrier family 12, member 9 [Source:NCBI ge... [more]
SLC12A92.756e-11149.75solute carrier family 12, member 9 [Source:NCBI ge... [more]
tinagl11.569e-5529.75tubulointerstitial nephritis antigen-like 1 [Sourc... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc12a91.293e-13351.54solute carrier family 12 (potassium/chloride trans... [more]
Slc12a13.361e-4928.77solute carrier family 12, member 1 [Source:MGI Sym... [more]
Slc12a15.726e-4928.77solute carrier family 12, member 1 [Source:MGI Sym... [more]
Slc12a18.120e-4928.77solute carrier family 12, member 1 [Source:MGI Sym... [more]
Slc12a24.916e-4828.60solute carrier family 12, member 2 [Source:MGI Sym... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0VGW6|S12A9_XENLA1.602e-13850.42Solute carrier family 12 member 9 OS=Xenopus laevi... [more]
sp|Q99MR3|S12A9_MOUSE9.047e-13351.54Solute carrier family 12 member 9 OS=Mus musculus ... [more]
sp|Q66HR0|S12A9_RAT1.684e-13151.31Solute carrier family 12 member 9 OS=Rattus norveg... [more]
sp|Q9BXP2|S12A9_HUMAN5.017e-12850.22Solute carrier family 12 member 9 OS=Homo sapiens ... [more]
sp|A2BFP5|S12A9_DANRE2.256e-11547.72Solute carrier family 12 member 9 OS=Danio rerio O... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIX79.083e-1675.05Slc12a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A3Q3W0R37.394e-15949.89Zgc:153039 OS=Mola mola OX=94237 PE=4 SV=1[more]
A0A3Q1J9Y31.704e-15751.51Zgc:153039 OS=Anabas testudineus OX=64144 PE=4 SV=... [more]
A0A3Q3KE763.243e-15651.53Zgc:153039 OS=Monopterus albus OX=43700 PE=4 SV=1[more]
A0A4W6BWW91.742e-15550.97Uncharacterized protein OS=Lates calcarifer OX=818... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1530399.633e-12150.11solute carrier family 12 member 9-like [Source:NCB... [more]
zgc:1530399.712e-12050.11solute carrier family 12 member 9-like [Source:NCB... [more]
slc12a91.210e-11746.97solute carrier family 12 member 9 [Source:NCBI gen... [more]
slc12a11.749e-5129.41solute carrier family 12 member 1 [Source:ZFIN;Acc... [more]
slc12a12.346e-5129.41solute carrier family 12 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a91.686e-12650.87solute carrier family 12 member 9 [Source:NCBI gen... [more]
slc12a42.546e-3628.28solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
ENSPMAT00000003053.13.717e-3025.89pep scaffold:Pmarinus_7.0:GL478333:5880:33924:-1 g... [more]
slc12a41.511e-2928.72solute carrier family 12 member 4 [Source:ZFIN;Acc... [more]
slc12a83.301e-2727.43solute carrier family 12 member 8 [Source:ZFIN;Acc... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VHC12.190e-6533.77Vacuolar membrane cation-chloride cotransporter (C... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO419171.209e-11846.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413912.559e-5429.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493614.045e-5428.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354434.039e-4629.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464307.231e-2533.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a93.607e-14448.81solute carrier family 12 member 9-like [Source:NCB... [more]
slc12a93.682e-14247.01solute carrier family 12 member 9-like [Source:NCB... [more]
zgc:1530391.522e-13051.08solute carrier family 12 member 9 [Source:NCBI gen... [more]
zgc:1530393.711e-13051.08solute carrier family 12 member 9 [Source:NCBI gen... [more]
ENSORLT00000043132.19.468e-12349.35solute carrier family 12 member 9 [Source:NCBI gen... [more]
back to top
BLAST of Solute carrier family 12 member 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033021.16.884e-3598.80SMESG000033021.1[more]
SMESG000060496.12.504e-1975.05SMESG000060496.1[more]
SMESG000060496.12.517e-1975.05SMESG000060496.1[more]
SMESG000019076.18.486e-4234.62SMESG000019076.1[more]
SMESG000019076.19.119e-4234.62SMESG000019076.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009255 ID=SMED30009255|Name=Solute carrier family 12 member 9|organism=Schmidtea mediterranea sexual|type=transcript|length=3344bp
TAAAATTGAATGATTAATTGATGAAAAATCCAGAGGTTCTCAGAACATTC
CCTAGTATAAATGAGGAATATGCACAGAATAGTCGATATTATCATGATCC
GACAATTATAGAAACTCTGACGTTGTCATCTGATCAAACTAAGAGAAATT
TGAAAACTTTTACTGGAGTATTTTGTCCAGTAGCTTTAGCTCAGTTTTCA
TCTTTATTATTTTTACGATTAGGTTATGATTTTTATTTAATTTATCTTAC
ATATTATCGTGAAATCCAGAGAAAAATAATAAAATTAAATTAATTAGAAA
GAATTATGAAGAATATCTTCATAATAATTCGTAGGGTCTTCTATTATATC
ACTATGCACTATTATATCATTTTCATGAGTTTTGCATTTTATTTAATTAA
ACTATAATTTGAACATTTTATCAATCTCAGGCATAATTATTTGTCATTTA
TAAAATATTTTATCGAACACCGTATTAGCTTGAATAAGACGAAGTTTTTG
CAAGTTCTATTTGGGACTCGTCTTCTAGTCGGGCTAATGCGGTAATTATG
AAGGAATTCAGAAAGTTAATATTCGTTTAGGTTTTGTATTGGGTCAAACA
GGTTTGCTGCTGGCTATCTTACAGTTGATTATGGCTTACCTAATTCTCCT
TTTAACGGTGTTATCGATATGTGCCATCAGCACCAATGGTGCAATTAAAG
GAGGAGGAGTTTACTTCATGATTAGTCGGACACTTGGACCTGAGGTTGGC
GGAAGCATAGGGATTTTGTTCTTTCTGGCGAATGTATTTTCATCTGCACT
ATTTATGGCTGCCTTTGTCGAAGGGCTAGTTGATGATTTTGGGCCTCTGG
GTCGCGTTGATGCTGATCTCATTCAAGAGAACTTTGGATGGAATTATTTA
TTCGCGACTTGCGTTTGCATATTCTGCCTTGGGGTCTGTCTAGTAGGAGG
ATCGCTGTTTGCTAAGACAAATCTATTTATATTTATTATAGTTTTTGTGT
GCTTCTTCTCAGTGATCGTGTCGTTCCTATTCCATAAAGCATTTCAAGTT
CCGATTCCGAAAATAAACACAATAGTTTATAGTAACTCCAATGAAACGCA
ATTTGGAAATTATACCGGACTTAGTGGAACGACATTCATTAACAATCTCT
ACGCAAACTATACAGTGGATTTCACCACTAAGAAATATATGACTTTCTTT
ACAGTGTTTGCAATTCTTTTTCCTGGAGTTACTGGAATCATGAATGGAGC
AAACATGTCAGGAGAGCTTATAAAACCAGCAGTATCGATACCAAGAGGAA
CACTGGCAGCAACTCTGTTTACATTTATTTGTTATATTATTTCATTCTTT
TTATCTGCTGCTACATGCGACAGGTTCTTGCTGTGGAATAACTACCTTTT
TATGCAAGCAACAAATCTCTGGAAGCCTTTTGTTATAATTGGAATGTTTT
TAACATGTATATCGGCTGCTCTTGGAAATTTTATTGGTGCTTCTCGTATT
CTTTTCGCACTCGCTCAAGACGATATATTCGGTATATTTTTGAAGCCGGC
GAAACTCACAACAAAAGGAGGAAACCCTATTGGATCGGTTGTAATATCAT
TTGTACTCGTTCAAATCGTTTTGCTTATTGGTAAAGTAAATGTCATAGCA
CCAGTGGTATCAGTGTTTTTCCTTCTCGCATACGCATCTGTGAATCTCGC
ATGTGCTCTGCTTGACTGGGCAGCTGCGTCGAATTTCAGACCAACTTTCA
AGTATTTCTCATGGTATACTTCATTATTAGGGGTTGCATGTTGCTTGGGA
ATGTGTTTCCTGGCCAGTTACATATATTCCTTGGGAATATTTTCGTTATT
CTTTATTATAATTGTGATTCTGAATTTCCGGAGTCTCGATTATTCATGGG
GTAGCATCAGTCAAGCATTGCTTTTTCATCAAGTAAGAAAATACCTCTTA
ATGATTGATATTCGAAAAGAGCACGTGAAATATTGGCGCCCCCAGATATT
GCTGCTATTATCCAATCCACGCAGTCAGAAACTTCGCAAAAATGAAAGAT
TTCCTAAAAATCAAGGCATTTATTGATGTAACAATTGCTCCAACTATCAG
GGATGGTTGTCGCCAGTTGTCACTTTTATGTGGTCTTGGTGGTTTAACCA
TCAATACAGTTTGCATAGGATTTAGGGATGATAGTGAACCTAAAGACATT
CTGAAAAAAATTTTTAATCAATCTAACAAATGTAATCCACACCAGTTTAT
TAGGGCTAGAAATAATTCATTATTCGCTGGTGATGTTCAATCTTTTACCA
ATCAATCTTCTGAATCGTTTGATAAAAGTAAAATAGTTCAACAGAGCGCA
TCACGAATCGATAATGAAAATACAAATTTGATATACAAAGGGAAAAACAA
GATCTTTAACCTTCTAAAATCTCCCGTTGATCCAGAATTCATTGATAAAT
TGCCACCAATCAGAAGAACTAGACACGCAACATACGGCACAATAAATGCT
AATTCTGACCATCAACAACAGGCAGACGAAGTCGTGGAATGTAATTATAT
AAACAATGATCAGGTATCGGAGGTAGAATACGTGGGAATAATTGCCGATT
GCATGAAGATGCAGAAAAATATTTGTTTGTGCCGACATTTTGAGAATATG
GATTTGATTGGGCTGAAGGCAAGCAATTCTTCAGAGTGTCAATACATTGA
TGTGTGGCCAATAAACTTTTTCCAGCCTGGCAGTGGCAGCTATCTGGACA
ATACATGCATGTTCATGCTTCAGTTGAGTTGCATCTTGAATATGAGCGCA
CAGTGGAGCTCAAAATGCAAGATTAGAGTGTATATATGTTTGGATTACTA
CACAATTGGAACCACCGAACATAATGTTCAGGGACTTTGGAATGAACTTC
TGAATCAGTGGAGAATACAGGCGGAAATTAAAACAGTTGGATGGGATGAC
ATAATGGTAAATTTGGAGGCGAATTTGGGTGGGAAAATCATGTCAGCTAA
CACACTATCAGATGAAATCAAAACAATATCACTGTTCGATTGTACATTGC
CGGATACTTACCTGAAAGAAGTGAATAATTTGATAAAATTCCACGTTTCT
CCAAATACGGCCGTTTGTTTCTTTTACTTGCCAATAATACCAAATATTGG
TACATCTCAGTATTGGGGAAAGTATATTGATCAACTAACCTTGCTTACAA
ATGATCTTCCACCTTCCGTTTTCGTGAGAGGACAACACAAAGTTATTACG
TCAGCATTATGATTTCACTATTTTATTGCATATAACTGATTATTATTATT
ATTGATTTATTTCATAATAATAATATTTTCTATTTTTATCAACA
back to top

protein sequence of SMED30009255-orf-1

>SMED30009255-orf-1 ID=SMED30009255-orf-1|Name=SMED30009255-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=482bp
MAYLILLLTVLSICAISTNGAIKGGGVYFMISRTLGPEVGGSIGILFFLA
NVFSSALFMAAFVEGLVDDFGPLGRVDADLIQENFGWNYLFATCVCIFCL
GVCLVGGSLFAKTNLFIFIIVFVCFFSVIVSFLFHKAFQVPIPKINTIVY
SNSNETQFGNYTGLSGTTFINNLYANYTVDFTTKKYMTFFTVFAILFPGV
TGIMNGANMSGELIKPAVSIPRGTLAATLFTFICYIISFFLSAATCDRFL
LWNNYLFMQATNLWKPFVIIGMFLTCISAALGNFIGASRILFALAQDDIF
GIFLKPAKLTTKGGNPIGSVVISFVLVQIVLLIGKVNVIAPVVSVFFLLA
YASVNLACALLDWAAASNFRPTFKYFSWYTSLLGVACCLGMCFLASYIYS
LGIFSLFFIIIVILNFRSLDYSWGSISQALLFHQVRKYLLMIDIRKEHVK
YWRPQILLLLSNPRSQKLRKNERFPKNQGIY*
back to top

protein sequence of SMED30009255-orf-2

>SMED30009255-orf-2 ID=SMED30009255-orf-2|Name=SMED30009255-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=407bp
MKDFLKIKAFIDVTIAPTIRDGCRQLSLLCGLGGLTINTVCIGFRDDSEP
KDILKKIFNQSNKCNPHQFIRARNNSLFAGDVQSFTNQSSESFDKSKIVQ
QSASRIDNENTNLIYKGKNKIFNLLKSPVDPEFIDKLPPIRRTRHATYGT
INANSDHQQQADEVVECNYINNDQVSEVEYVGIIADCMKMQKNICLCRHF
ENMDLIGLKASNSSECQYIDVWPINFFQPGSGSYLDNTCMFMLQLSCILN
MSAQWSSKCKIRVYICLDYYTIGTTEHNVQGLWNELLNQWRIQAEIKTVG
WDDIMVNLEANLGGKIMSANTLSDEIKTISLFDCTLPDTYLKEVNNLIKF
HVSPNTAVCFFYLPIIPNIGTSQYWGKYIDQLTLLTNDLPPSVFVRGQHK
VITSAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030345SLC12A9
IPR004841AA-permease/SLC12A_dom
IPR002293AA/rel_permease1
IPR018491SLC12_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0003333amino acid transmembrane transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 1..429
e-value: 7.0E-18
score: 61.6
IPR004841Amino acid permease/ SLC12A domainPFAMPF00324AA_permeasecoord: 2..457
e-value: 7.0E-65
score: 219.5
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 1..427
e-value: 5.4E-24
score: 86.7
NoneNo IPR availablePANTHERPTHR11827SOLUTE CARRIER FAMILY 12, CATION COTRANSPORTERScoord: 1..466
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..20
score: 0.679
NoneNo IPR availableTMHMMTMhelixcoord: 266..288
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 223..245
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 317..339
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
NoneNo IPR availableTMHMMTMhelixcoord: 381..414
NoneNo IPR availableTMHMMTMhelixcoord: 113..135
IPR030345Solute carrier family 12 member 9PANTHERPTHR11827:SF98SOLUTE CARRIER FAMILY 12 MEMBER 9coord: 1..466