coiled-coil domain-containing protein 146

Overview
Namecoiled-coil domain-containing protein 146
Smed IDSMED30009251
Length (bp)2928
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein 146 (SMED30009251) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 146 (SMED30009251) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein 146 (SMED30009251) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 146 (SMED30009251) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009251

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009251SMESG000006416.1 SmedASXL_009622SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009251SMESG000006416.1 dd_Smed_v4_6858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009251SMESG000006416.1 dd_Smed_v4_6858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009251SMESG000006416.1 dd_Smed_v4_6858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009251SMESG000006416.1 dd_Smed_v4_6858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30009251SMESG000006416.1 dd_Smed_v4_6858_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009251SMESG000006416.1 dd_Smed_v6_6858_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009251SMESG000006416.1 dd_Smed_v6_6858_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009251SMESG000006416.1 dd_Smed_v4_6858_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Human
Match: CCDC146 (coiled-coil domain containing 146 [Source:HGNC Symbol;Acc:HGNC:29296])

HSP 1 Score: 355.14 bits (910), Expect = 1.272e-106
Identity = 296/905 (32.71%), Postives = 503/905 (55.58%), Query Frame = 3
Query:  300 SRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHR--SPGLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSD------EFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQ---------------DEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQ---SELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGN---QAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIENDSEFG---------------ITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            ++E+E  LLQ +K++T +++++ F L QA++FP   +TEVSKMR+ LLK+ N+  A+++R     Y+++SL+ EK ++  E  +   PG  EK++K  L +S  EL+KEI   KL      EI  L E++   +        E   +  +    K  +  + +   Q  K IEKI ++  E                D +K+  N+ SA +            EKE +I        +++G+   ++    E +++ K LE+ RE E     ++  LDL++++   +KQ   D+++ K + K++  + L++  L LK + ++L     LH +   ++   PK +    E   +  KE+E  K+    Q   SE+E   + Q + EE +LL +  + +  V+ L R+ QIK DE+EQK+K++++  +++  ++ E+K K L    ++KKK EI  +L +FAKLY+ I+ ERNK  NL++    + +E++E+ ++  NE+EILR + V +++ +Q    K    +  R+S+Q++V K   ++SK +E + + + ++N +++L N     EE MV LRK+ + A+Q+RN+  +QLIER EE+CI  EK N +E++   GE EI +  ++I F+K  I E +RQI + +K    K   + ++   +IQ   C DR+ +LE +   PD E R + L G+D +  E+  K ++L ++L  KEE  +EK+ + E VSRL + L +K    + DT+ LAK +N Y+ ++    +K+ A  AEL+M  +  ++LQ+EV+ KE  +   + +IE                     + +  +  K QE +  E    QL NG  TTA+ RPNAY+PE +  LP+P+PYGA APF+PSEPG+NMRHIRK  +KP+EI
Sbjct:   81 TQESEVQLLQNAKRFTEQIQQQQFHLQQADNFPEAFSTEVSKMREQLLKYQNEYNAVKEREFHNQYRLNSLKEEKIIIVKEFEKITKPGEMEKKMKI-LRESTEELRKEIMQKKL------EIKNLREDLASKQKQLLKEQKELEELLGHQVVLKDEVAHHQTIPVQIGKEIEKITRKKVEMEKKKIVLEQEVKTLNDSLKKVENKVSAIVD-----------EKENVIK-------EVEGKRALLEIKEREHNQLVKLLELARENEATSLTERGILDLNLRNSLIDKQNYHDELSRKQREKERDFRNLRKMELLLKVSWDALRQTQALHQRLLLEMEAIPKDDSTLSERRRELHKEVEVAKRNLAQQKIISEMESKLVEQQLAEENKLLKEQENMKELVVNLLRMTQIKIDEKEQKSKDFLKAQQKYTNIVKEMKAKDLEIRIHKKKKCEIYRRLREFAKLYDTIRNERNKFVNLLHKAHQKVNEIKERHKMSLNELEILRNSAVSQERKLQNSMLKHANNVTIRESMQNDVRK---IVSKLQEMKEKKEAQLNNIDRLANTITMIEEEMVQLRKRYEKAVQHRNESGVQLIEREEEICIFYEKINIQEKMKLNGEIEIHLLEEKIQFLKMKIAEKQRQICVTQKLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRARFLPGKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRLTDRLCSKTQGCKQDTLLLAKKMNGYQRRIKNATEKMMALVAELSMKQALTIELQKEVREKEDFIFTCNSRIEKGLPLNKEIEKEWLKVLRDEEMHALAIAEKSQEFL--EADNRQLPNGVYTTAEQRPNAYIPEADATLPLPKPYGALAPFKPSEPGANMRHIRKPVIKPVEI 955          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Human
Match: CFAP58 (cilia and flagella associated protein 58 [Source:HGNC Symbol;Acc:HGNC:26676])

HSP 1 Score: 78.5666 bits (192), Expect = 4.096e-14
Identity = 82/313 (26.20%), Postives = 165/313 (52.72%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTM 2543
            LY  ++ +RN  +  +       ++M+ K++I+ ++++ L+ ++  K+  + K   +   I   +++L++E+ K      + K    + + E  +L ++  +A+   +  +K+ D  +  R+    QL+ RN+E+ +L EK   ++ +++ GE +   R++++  ++  IK+L+R+  IL ++  N  +  +E  + + +L   R R   LE E ENP    R +KL   DP+  EL  K   L  +LI K E  +EKELLL+   +L  EL++ VL+ R    + A+ L  Y+  +    ++LK  ++EL M
Sbjct:  490 LYEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVDELKEDISAKESALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEAEERKLLRIIAEADGERLRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKGILARSMANVEELRQEFFHMQRELLKERTRCRALEEELENPLNVHRWRKLEASDPNAYELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKH-VLA-RQPGPEAAEQLKLYRRTLHDKKQQLKVLSSELNM 800          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Fly
Match: ORY (gene:FBgn0046323 transcript:FBtr0346720)

HSP 1 Score: 50.8322 bits (120), Expect = 7.157e-6
Identity = 50/204 (24.51%), Postives = 90/204 (44.12%), Query Frame = 3
Query: 1689 KIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDP 2300
            KI  LNN I+ L+++L  K+  V   R  + E+ A  + L   +S   +   K                 +G++ EE    +RK+ +L         LQ++ RN+E+ +++EK    +  +  G  +   R+++I  +K+ I  L  + E L+    +     +E+V  +  L     R+  L  +A  P    R + L GEDP
Sbjct:  570 KIEHLNNYIKELQSDLKNKENLVAALRKDMREMKAKNEMLAKTISNDELKFMK-----------------MGHELEE----MRKERNLV-------GLQMVRRNDEIVVIKEKLQIAQNALDNGTTQYNQRVEDIRLLKKEISNLHTESECLKHAIKSTADMRKEIVRLQRALNQEHIRIRALTEDARTPTGVHRWRILKGEDP 745          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Zebrafish
Match: ccdc146 (coiled-coil domain containing 146 [Source:ZFIN;Acc:ZDB-GENE-041210-217])

HSP 1 Score: 197.978 bits (502), Expect = 5.322e-52
Identity = 148/391 (37.85%), Postives = 218/391 (55.75%), Query Frame = 3
Query: 1749 KYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLK--ELHYK--------IENDSEFGITSYKLPMKIQE---LISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            + +Q+ R + +     RD L+ EVS+    L + ++ R E +L++ +L    N  E+  + + K+ +  LQ RN  ++QL ER +E  I  EK     ++      E+    DEI  +K   KE +RQ ++ +K   NK   E E V  +IQL    DR++ELE EA   D   R + LNGEDPSP EL  K E+L I L  KE   +E EL+ E V RL+  +Q K  ++  DT+ LAK +N  + Q+    +K+ A  AEL+M  +EC+ LQQE+K KE  L   + H +        IEN+    +      +   E   +++ E    QL NG  TTA+ RPNAY+P ++  LP+P+ YGA APF+P+EPG+N+RHIRK K+KPIEI
Sbjct:  474 RLLQRSRLQHSHSYKLRDDLKKEVSQTLQALQEMQQNREEQKLKLRKLTDTVNMLEQKKLHICKRYEAELQKRNQESVQLAEREKEWRIFNEKLGVLVKMTENSNLEMYDMEDEIRNLKMEQKEEERQNDLHKKQLSNKLALEEERVLLQIQLSEINDRVSELE-EACVDD--NRARNLNGEDPSPEELIEKIEQLEIHLADKEAQLLEMELVCEQVGRLSKRIQIKADNSNEDTLHLAKKVNELQAQIRKRSRKMMAVVAELSMRKAECMGLQQEMKEKELQLDLCQKHVEQGLPPSDSIENEWLRHLQDQHRRLADAERKAMLAEEDEWNQLPNGVYTTAELRPNAYIPIDDP-LPVPKHYGALAPFKPTEPGANIRHIRKPKIKPIEI 860          

HSP 2 Score: 50.8322 bits (120), Expect = 1.000e-5
Identity = 88/360 (24.44%), Postives = 165/360 (45.83%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIK-TKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQL-EIYREKE-----------------TELQLDKVK-----------------------------LDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEA 1226
            L  S+++E  LL  +K   + +E++   L+ A  FP   +TEVS+++Q+LL+++N     E+R   + +++  L+ EK  LE E    P   E E +   L +S  E++KE+  LKL+Q    E+  L E + +T+          L   K R+  N +++ Q      ++RK      E+ R A+++S              +EK ++  I +   + ++ Q  S++++ +++K+ + E+ RE+E                 T+LQ+ K K                             L++ ++ + +E    RD +   T+ KDK+M ALK   LQLK   ++L +    H + +A
Sbjct:   81 LRSSQDSEMQLLLEAKTLRMTLEQQRQELENAELFPEGPDTEVSRLKQTLLQYYNQLKEDEERDYQMQFQLECLKEEKLYLEKEYQDQPKQAELESRYATLKNSCEEVRKEV--LKLRQ----EVRTLTESM-ETQQKHIKKEQLELEDLKNRVESNEAELAQVLLIPVQLRK------EVDRVAHKKS-------------ELEK-QVAKIEQHRLDNVEHQK-SLEAKCEKVKEAIKEVVREQEGHKAQLVTAENKQDRLLTDLQMAKAKEAAFMDQRSLFQHFCNINAKHIQIHLVGLLEISMEQIVAEFISLRDKLARDTRLKDKLMLALKRNELQLKQARDALTNTQQQHERIQA 412          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Zebrafish
Match: cfap58 (cilia and flagella associated protein 58 [Source:ZFIN;Acc:ZDB-GENE-060929-128])

HSP 1 Score: 105.531 bits (262), Expect = 1.164e-22
Identity = 98/325 (30.15%), Postives = 169/325 (52.00%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNM-------LLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSEC 2558
            LY  ++ ERN  +  +     +++EMR K++I+N+  E L+  +  K+  + K+R +   +   R++L++E+ K  +       LL+KQ+ +  E       L ++  +A+   +  +K+ D  +  R+    QL++RN+ + +L EK   ++ I++ GE     R+++I  +K  IK+ +R+  IL KT +N +   +EV +   +L   R R   LE E  NP    R +KL   DPS  EL  K   L  +LI K +  +EKELLL+   +L  EL  K +  R    + A+ L  Y+  +    K+LKA TAEL M+ S+ 
Sbjct:  492 LYEDVRTERNLFSKNLIEAKDQNAEMRRKVKIVNHMFEQLKDEITAKEVALDKERQEFQRVERERENLKAELQKMKLQAQETKQLLAKQQAQEQE-------LLKIIAEADAERIRQKKELDQVISERDLLGTQLVKRNDSLALLYEKVKIQQSILNKGEVHYNERLEDIRVLKIEIKKQRREKSILSKTVINVDDLRQEVFHMHRELMKERTRCRALEDELNNPLNVHRWRKLEASDPSSFELIQKIHSLQRRLISKTQEVVEKELLLQEKEKLYVEL--KHILARQPGPEAAEKLQVYQRTLREKTKQLKALTAELNMHESQA 807          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Zebrafish
Match: cfap58 (cilia and flagella associated protein 58 [Source:ZFIN;Acc:ZDB-GENE-060929-128])

HSP 1 Score: 104.76 bits (260), Expect = 2.337e-22
Identity = 98/325 (30.15%), Postives = 169/325 (52.00%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNM-------LLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSEC 2558
            LY  ++ ERN  +  +     +++EMR K++I+N+  E L+  +  K+  + K+R +   +   R++L++E+ K  +       LL+KQ+ +  E       L ++  +A+   +  +K+ D  +  R+    QL++RN+ + +L EK   ++ I++ GE     R+++I  +K  IK+ +R+  IL KT +N +   +EV +   +L   R R   LE E  NP    R +KL   DPS  EL  K   L  +LI K +  +EKELLL+   +L  EL  K +  R    + A+ L  Y+  +    K+LKA TAEL M+ S+ 
Sbjct:  492 LYEDVRTERNLFSKNLIEAKDQNAEMRRKVKIVNHMFEQLKDEITAKEVALDKERQEFQRVERERENLKAELQKMKLQAQETKQLLAKQQAQEQE-------LLKIIAEADAERIRQKKELDQVISERDLLGTQLVKRNDSLALLYEKVKIQQSILNKGEVHYNERLEDIRVLKIEIKKQRREKSILSKTVINVDDLRQEVFHMHRELMKERTRCRALEDELNNPLNVHRWRKLEASDPSSFELIQKIHSLQRRLISKTQEVVEKELLLQEKEKLYVEL--KHILARQPGPEAAEKLQVYQRTLREKTKQLKALTAELNMHESQA 807          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Zebrafish
Match: ccdc146 (coiled-coil domain containing 146 [Source:ZFIN;Acc:ZDB-GENE-041210-217])

HSP 1 Score: 50.8322 bits (120), Expect = 6.493e-6
Identity = 39/121 (32.23%), Postives = 72/121 (59.50%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTK---LTDSINELKKEISDLKLKQ 644
            L  S+++E  LL  +K   + +E++   L+ A  FP   +TEVS+++Q+LL+++N     E+R   + +++  L+ EK  LE E    P  K+ E++++   L +S  E++KE+  LKL+Q
Sbjct:   81 LRSSQDSEMQLLLEAKTLRMTLEQQRQELENAELFPEGPDTEVSRLKQTLLQYYNQLKEDEERDYQMQFQLECLKEEKLYLEKEYQDQP--KQAELESRYATLKNSCEEVRKEV--LKLRQ 197          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Xenopus
Match: CCDC146 (coiled-coil domain containing 146 [Source:NCBI gene;Acc:100496606])

HSP 1 Score: 438.343 bits (1126), Expect = 1.720e-138
Identity = 326/882 (36.96%), Postives = 526/882 (59.64%), Query Frame = 3
Query:  306 ENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSP--GLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEF----SAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSE----QDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQS---ELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXX-XXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDE-IDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND---SEFGITSYKLPMKIQELIS-----YEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            E+E  LLQ +K +T ++E++ +  ++++    D NTE+S +R+ LLK++ND    E+R  +L YK+  L+ EKK+L+ E  R P  G  EK+IK  L ++I EL+KE +  ++      EI  L E++ +TK  E       +   L   ++  V     + Q  K  EKI +   E    ++ + +   E + NL+++         EKEE++        +++G+   +++   E + + K LE+ +E E     ++  +DL ++H   EKQ   D +  KT+ K++ ++  K+  LQLKS  ++L     ++ K +A+++ FPK +   ++  E +++    R++ F  Q T +E E   L Q I EEE+L+ + S+ R +++ L RL QIKA+EREQK+++ I+  +R+ +V+ E+K + L   +++KK +++   +L++FAK+Y++I+ ERNKC +LI T   R+SE+REK++I  NE+EILR N V KD+ +QK + K       RDSLQ ++S+  + L + KEKR + +++I RL  + NQAE  M+ LRK+   A+QNRN+R +QLIER EE+CI  EK N +E I+  G+ E+ + MDE I F+K    E KRQ+E L+K   NK   E ++V  +IQL  C DR+AELE + E+P  E R + L G+DPS  EL  K EEL + L  KEE  +EK+LL E VS L  ++  K  + + DT+ L+K +N    ++    +K+ +  AEL+M  +  ++LQ+E++NKE  ++  H ++E     SE     +K  ++ +  +       E  Q+ L NG  TTA+ RPNAY+P++E+ LP+PRPYG  APF+PSE GSNMRHIRK  +KPIEI
Sbjct:   32 ESEVKLLQDAKCFTNQLEQQEW--EKSDQLYEDYNTEISTLREQLLKYNNDINEAEEREYSLQYKLECLQEEKKLLQREYDRMPKAGDYEKKIKI-LQENIKELQKENTQRRM------EIKALKEDL-ETKQRETEREQKELGQKLEQQEVVKVAYYVPL-QIGKETEKINRRIMEAQKKENMLGKEFQELNDNLKQMEHKAKLMLEEKEEVMK-------ELEGKQTWLETKEQECNRLTKLLELAKENEAVALGERAAMDLSLRHAMVEKQTQHDALTRKTREKERDLRNTKKMELQLKSALDALAHTQNVYEKIKAEVDCFPKADALLEKRKELRKEVEVIRRQ-FAQQQTLTEAEAHTLEQCIAEEEQLVKEQSERREDLVNLTRLVQIKAEEREQKSRDLIKAKQRYQQVLQEVKGRQLIIGEHKKKNQDVPFYRLKEFAKMYDIIRNERNKCVSLIQTAMQRASELREKLKIFANEMEILRNNAVNKDRQLQKIKLKENNSQMVRDSLQKDLSRVRVYLEEMKEKREQQKMQIGRLTNMINQAEVDMIQLRKKYQTAVQNRNERGVQLIEREEEICIFLEKINIQEMILRNGDLEM-VSMDEKIRFLKIEAAEQKRQVEQLQKNLPNKRMLESDLVTLQIQLSQCNDRVAELETQTEDPGKEYRTRLLEGKDPSLQELMKKTEELELHLAQKEEQLLEKDLLYEQVSHLTKKIHTKAENGKQDTLLLSKKMNELHKKIKNTTQKMMSLIAELSMQQANSIKLQEELRNKEKMVEACHTRMEQGLPPSEGTENEWKKMIRDKHRLQKEKEDKEEEQHWLPNGAYTTAEQRPNAYIPDDESALPLPRPYGILAPFKPSETGSNMRHIRKPIIKPIEI 893          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Xenopus
Match: CCDC146 (coiled-coil domain containing 146 [Source:NCBI gene;Acc:100496606])

HSP 1 Score: 439.113 bits (1128), Expect = 2.775e-138
Identity = 325/892 (36.43%), Postives = 533/892 (59.75%), Query Frame = 3
Query:  270 YLIKVQLLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSP--GLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEI------FQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSE----QDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQS---ELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXX-XXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDE-IDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND---SEFGITSYKLPMKIQELISYEGH-QYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            Y +  Q L++ +E+E  LLQ +K +T ++E++ +  ++++    D NTE+S +R+ LLK++ND    E+R  +L YK+  L+ EKK+L+ E  R P  G  EK+IK  L ++I EL+KE +  ++      EI  L E++       + +  E     +     K  LV+ +    Q  K  EKI +   E    ++ + +   E + NL+++         EKEE++        +++G+   +++   E + + K LE+ +E E     ++  +DL ++H   EKQ   D +  KT+ K++ ++  K+  LQLKS  ++L     ++ K +A+++ FPK +   ++  E +++    R++ F  Q T +E E   L Q I EEE+L+ + S+ R +++ L RL QIKA+EREQK+++ I+  +R+ +V+ E+K + L   +++KK +++   +L++FAK+Y++I+ ERNKC +LI T   R+SE+REK++I  NE+EILR N +QK K +++  S++      RDSLQ ++S+  + L + KEKR + +++I RL  + NQAE  M+ LRK+   A+QNRN+R +QLIER EE+CI  EK N +E I+  G+ E+ + MDE I F+K    E KRQ+E L+K   NK   E ++V  +IQL  C DR+AELE + E+P  E R + L G+DPS  EL  K EEL + L  KEE  +EK+LL E VS L  ++  K  + + DT+ L+K +N    ++    +K+ +  AEL+M  +  ++LQ+E++NKE  ++  H ++E     SE     +K  ++ +  +  E   ++ L NG  TTA+ RPNAY+P++E+ LP+PRPYG  APF+PSE GSNMRHIRK  +KPIEI
Sbjct:   73 YTLLYQTLKRVQESEVKLLQDAKCFTNQLEQQEW--EKSDQLYEDYNTEISTLREQLLKYNNDINEAEEREYSLQYKLECLQEEKKLLQREYDRMPKAGDYEKKIKI-LQENIKELQKENTQRRM------EIKALKEDLETKQRETEREQKELGQKLEQQEVVKHELVQLSYVPLQIGKETEKINRRIMEAQKKENMLGKEFQELNDNLKQMEHKAKLMLEEKEEVMK-------ELEGKQTWLETKEQECNRLTKLLELAKENEAVALGERAAMDLSLRHAMVEKQTQHDALTRKTREKERDLRNTKKMELQLKSALDALAHTQNVYEKIKAEVDCFPKADALLEKRKELRKEVEVIRRQ-FAQQQTLTEAEAHTLEQCIAEEEQLVKEQSERREDLVNLTRLVQIKAEEREQKSRDLIKAKQRYQQVLQEVKGRQLIIGEHKKKNQDVPFYRLKEFAKMYDIIRNERNKCVSLIQTAMQRASELREKLKIFANEMEILRNNALQKIK-LKENNSQMV-----RDSLQKDLSRVRVYLEEMKEKREQQKMQIGRLTNMINQAEVDMIQLRKKYQTAVQNRNERGVQLIEREEEICIFLEKINIQEMILRNGDLEM-VSMDEKIRFLKIEAAEQKRQVEQLQKNLPNKRMLESDLVTLQIQLSQCNDRVAELETQTEDPGKEYRTRLLEGKDPSLQELMKKTEELELHLAQKEEQLLEKDLLYEQVSHLTKKIHTKAENGKQDTLLLSKKMNELHKKIKNTTQKMMSLIAELSMQQANSIKLQEELRNKEKMVEACHTRMEQGLPPSEGTENEWKKMIRDKHRLQKEKEDKHWLPNGAYTTAEQRPNAYIPDDESALPLPRPYGILAPFKPSETGSNMRHIRKPIIKPIEI 940          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Xenopus
Match: CCDC146 (coiled-coil domain containing 146 [Source:NCBI gene;Acc:100496606])

HSP 1 Score: 431.795 bits (1109), Expect = 1.499e-135
Identity = 323/903 (35.77%), Postives = 525/903 (58.14%), Query Frame = 3
Query:  270 YLIKVQLLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSP--GLKEKEIKTKLTDSINELKKEIS-----------DLKLKQKEN-IEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQS---ELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXX-XXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDE-IDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND---SEFGITSYKLPMKIQELI----------SYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            Y +  Q L++ +E+E  LLQ +K +T ++E++ +  ++++    D NTE+S +R+ LLK++ND    E+R  +L YK+  L+ EKK+L+ E  R P  G  EK+IK  L ++I EL+KE +           DL+ KQ+E   E  +L +++ Q +      +   L+   L++ +   ++N+      +I +   +++ + +   E + NL+++         EKEE++        +++G+   +++   E + + K LE+ +E E     ++  +DL ++H   EKQ   D +  KT+ K++ ++  K+  LQLKS   +L++L   H +    L+L                         F  Q T +E E   L Q I EEE+L+ + S+ R +++ L RL QIKA+EREQK+++ I+  +R+ +V+ E+K + L   +++KK +++   +L++FAK+Y++I+ ERNKC +LI T   R+SE+REK++I  NE+EILR N V KD+ +QK + K       RDSLQ ++S+  + L + KEKR + +++I RL  + NQAE  M+ LRK+   A+QNRN+R +QLIER EE+CI  EK N +E I+  G+ E+ + MDE I F+K    E KRQ+E L+K   NK   E ++V  +IQL  C DR+AELE + E+P  E R + L G+DPS  EL  K EEL + L  KEE  +EK+LL E VS L  ++  K  + + DT+ L+K +N    ++    +K+ +  AEL+M  +  ++LQ+E++NKE  ++  H ++E     SE     +K  ++ +  +          + E  Q+ L NG  TTA+ RPNAY+P++E+ LP+PRPYG  APF+PSE GSNMRHIRK  +KPIEI
Sbjct:   73 YTLLYQTLKRVQESEVKLLQDAKCFTNQLEQQEW--EKSDQLYEDYNTEISTLREQLLKYNNDINEAEEREYSLQYKLECLQEEKKLLQREYDRMPKAGDYEKKIKI-LQENIKELQKENTQRRMEIKALKEDLETKQRETEREQKELGQKLEQQE------VVKVLSYVPLQIGKETEKINR------RIMEAQKKENMLGKEFQELNDNLKQMEHKAKLMLEEKEEVMK-------ELEGKQTWLETKEQECNRLTKLLELAKENEAVALGERAAMDLSLRHAMVEKQTQHDALTRKTREKERDLRNTKKMELQLKS---ALDALA--HTQNVCLLSLI--------------------ILIYFTTQQTLTEAEAHTLEQCIAEEEQLVKEQSERREDLVNLTRLVQIKAEEREQKSRDLIKAKQRYQQVLQEVKGRQLIIGEHKKKNQDVPFYRLKEFAKMYDIIRNERNKCVSLIQTAMQRASELREKLKIFANEMEILRNNAVNKDRQLQKIKLKENNSQMVRDSLQKDLSRVRVYLEEMKEKREQQKMQIGRLTNMINQAEVDMIQLRKKYQTAVQNRNERGVQLIEREEEICIFLEKINIQEMILRNGDLEM-VSMDEKIRFLKIEAAEQKRQVEQLQKNLPNKRMLESDLVTLQIQLSQCNDRVAELETQTEDPGKEYRTRLLEGKDPSLQELMKKTEELELHLAQKEEQLLEKDLLYEQVSHLTKKIHTKAENGKQDTLLLSKKMNELHKKIKNTTQKMMSLIAELSMQQANSIKLQEELRNKEKMVEACHTRMEQGLPPSEGTENEWKKMIRDKHRLQKEKEDKARMAEEEEQHWLPNGAYTTAEQRPNAYIPDDESALPLPRPYGILAPFKPSETGSNMRHIRKPIIKPIEI 927          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Mouse
Match: Ccdc146 (coiled-coil domain containing 146 [Source:MGI Symbol;Acc:MGI:1922422])

HSP 1 Score: 320.857 bits (821), Expect = 4.886e-94
Identity = 221/631 (35.02%), Postives = 372/631 (58.95%), Query Frame = 3
Query: 1050 LDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKE-----CSLK-----ELHYKIENDSEFGITSYKLPMKIQELISY----------EGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            LD+++++   +KQ   D+++ K + K++  + LK+  L LK + ++L     ++ +   ++   PK  L   E  ++  KE++  ++    Q + SE E   + Q I +E +LL +    R  V  L R+ QIK DE+EQKAK++++  +R++ ++ E+K K L    Y+K+K EI  +L +FA LY+ I+ ERNK  NL++    + +E++E++++  NE+EILR + V +++ +Q    K +  +  ++S+Q++V K    L + KEK+      ++RL  +    EE MV LRK+ + A+Q RN+  +QLIER EEVCI  EK N +E+I    + EI I  ++I F+K  I E +RQI + RK    K   + ++   +IQ   C DR+ +LE    NPD + R++ + G+D +  E+  K + L +++  KEE  +EK+ + E VS+L N L+ K  + + DT+ LAK +N+Y+ ++ ++ +++ A  AEL+M  +  ++LQ+EV+ KE     CS +      L+ +IE D       +   ++ +E+ ++          E    QL NG  TTA+ RPNAYMPE +T+LP+P+PYGA APF+PSEPG+N RHIRK  +KPIEI
Sbjct:  354 LDINLRNCLIDKQNYHDELSRKQREKERDFRNLKKTELLLKVSLDALTQAQAMNQRLLLEMEAIPKEYLTLPERRKELHKEVDLARRNLAQQKSLSEAEAKLVEQQIAQENKLLKEQESLRELVFNLGRMTQIKIDEKEQKAKDFLKAQRRYSEIVKEIKSKDLEIRLYKKRKHEIHRRLREFASLYDTIRNERNKFVNLLHKAHQKVNEIKERLKMSLNELEILRNSAVSQERKLQNAMLKHSNNVTIKESIQNDVCKITAKLQEMKEKKEAQLTSMDRLASMITVIEEEMVQLRKKYEKAVQRRNESGVQLIEREEEVCIFYEKVNVQEKIKLHQDVEIHILEEKIRFLKLRIAEKQRQISVTRKLVPIKKSLDADLAVIQIQFSQCTDRIKDLEKLFVNPDSKGRVRFIKGKDLTEEEMIKKLDMLELQIAKKEEKLLEKDFIYEQVSQLTNRLKGKTQACKKDTLLLAKKMNSYQQKIKVVTQEMMALVAELSMKQALTIELQKEVREKEEFIFSCSARIEKGLPLNREIEKD-------WLKVLRDEEMYAFATAEMSREYMETDYRQLPNGVYTTAEQRPNAYMPEADTELPLPKPYGAMAPFKPSEPGANRRHIRKPVVKPIEI 977          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Mouse
Match: Cfap58 (cilia and flagella associated protein 58 [Source:MGI Symbol;Acc:MGI:2685815])

HSP 1 Score: 90.1225 bits (222), Expect = 8.726e-18
Identity = 91/329 (27.66%), Postives = 173/329 (52.58%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSK--KNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEIC--RDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEV 2579
            LY  ++ +RN  +  +       +EM+ K++I+ ++++ L+  +  K+  + K   +   I   +++L++E+ K  +  L +K   ++ E+  E  +L ++  +A+   V  +K+ D  +  R+    QL+ RN+E+ +L EK   ++ +++ GE +   R++++  +K  IK+L+R+  IL ++  N  +  +E+  Y +Q E    R R   LE E ENP    R +KL   DPS  EL  K   L  +LI K E  +EKELLL+   +L  EL++  +  R    + A+ L  Y+  +    K+LK  ++EL M  S+  + + E+
Sbjct:  490 LYEAVRSDRNLYSKNLVEAQDEITEMKRKLKIMTHQVDQLKEEISAKEAALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEV--EERKLLRIIAEADGERVRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGETQYNQRVEDMRILKLEIKKLRREKGILARSVANVEELRQEL--YHMQREFLKERTRCRALEEELENPMNVHRWRKLEASDPSTFELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYVELKH--ILARQPGPEAAEQLQIYRHTLREKTKQLKVLSSELNMYESQSQEYKYEI 812          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Mouse
Match: Ccdc146 (coiled-coil domain containing 146 [Source:MGI Symbol;Acc:MGI:1922422])

HSP 1 Score: 60.077 bits (144), Expect = 1.529e-9
Identity = 45/129 (34.88%), Postives = 77/129 (59.69%), Query Frame = 3
Query:  300 SRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKLT-DSINELKKEISDLKLKQKENIEISKLNEEI 683
            ++E+E  LL+ +K++T +++++   L QA DFP    TEV K+R+ LLK+ N+  A ++R   + Y+++SL  EK ++  E  + P   E E KT+L  +S  EL+KE+   +L      EI  L E++
Sbjct:  103 TQESEVQLLENAKRFTEQIQQQQVCLQQAEDFPNVFTTEVCKLREQLLKYQNEYTAAQEREYNIQYRLTSLTEEKSIILKEFEKIPKPGEIEKKTRLLKESTEELRKEVIQRRL------EIKNLREDV 225          

HSP 2 Score: 23.483 bits (49), Expect = 1.529e-9
Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = 2
Query:  227 ITASESLAFQCLEELFNKGSI 289
            I  +E+ AF CL EL +KG +
Sbjct:   61 INLAETPAFLCLHELHSKGKL 81          
BLAST of coiled-coil domain-containing protein 146 vs. UniProt/SwissProt
Match: sp|Q8IYE0|CC146_HUMAN (Coiled-coil domain-containing protein 146 OS=Homo sapiens OX=9606 GN=CCDC146 PE=1 SV=2)

HSP 1 Score: 355.14 bits (910), Expect = 6.106e-106
Identity = 296/905 (32.71%), Postives = 503/905 (55.58%), Query Frame = 3
Query:  300 SRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHR--SPGLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSD------EFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQ---------------DEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQ---SELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGN---QAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIENDSEFG---------------ITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            ++E+E  LLQ +K++T +++++ F L QA++FP   +TEVSKMR+ LLK+ N+  A+++R     Y+++SL+ EK ++  E  +   PG  EK++K  L +S  EL+KEI   KL      EI  L E++   +        E   +  +    K  +  + +   Q  K IEKI ++  E                D +K+  N+ SA +            EKE +I        +++G+   ++    E +++ K LE+ RE E     ++  LDL++++   +KQ   D+++ K + K++  + L++  L LK + ++L     LH +   ++   PK +    E   +  KE+E  K+    Q   SE+E   + Q + EE +LL +  + +  V+ L R+ QIK DE+EQK+K++++  +++  ++ E+K K L    ++KKK EI  +L +FAKLY+ I+ ERNK  NL++    + +E++E+ ++  NE+EILR + V +++ +Q    K    +  R+S+Q++V K   ++SK +E + + + ++N +++L N     EE MV LRK+ + A+Q+RN+  +QLIER EE+CI  EK N +E++   GE EI +  ++I F+K  I E +RQI + +K    K   + ++   +IQ   C DR+ +LE +   PD E R + L G+D +  E+  K ++L ++L  KEE  +EK+ + E VSRL + L +K    + DT+ LAK +N Y+ ++    +K+ A  AEL+M  +  ++LQ+EV+ KE  +   + +IE                     + +  +  K QE +  E    QL NG  TTA+ RPNAY+PE +  LP+P+PYGA APF+PSEPG+NMRHIRK  +KP+EI
Sbjct:   81 TQESEVQLLQNAKRFTEQIQQQQFHLQQADNFPEAFSTEVSKMREQLLKYQNEYNAVKEREFHNQYRLNSLKEEKIIIVKEFEKITKPGEMEKKMKI-LRESTEELRKEIMQKKL------EIKNLREDLASKQKQLLKEQKELEELLGHQVVLKDEVAHHQTIPVQIGKEIEKITRKKVEMEKKKIVLEQEVKTLNDSLKKVENKVSAIVD-----------EKENVIK-------EVEGKRALLEIKEREHNQLVKLLELARENEATSLTERGILDLNLRNSLIDKQNYHDELSRKQREKERDFRNLRKMELLLKVSWDALRQTQALHQRLLLEMEAIPKDDSTLSERRRELHKEVEVAKRNLAQQKIISEMESKLVEQQLAEENKLLKEQENMKELVVNLLRMTQIKIDEKEQKSKDFLKAQQKYTNIVKEMKAKDLEIRIHKKKKCEIYRRLREFAKLYDTIRNERNKFVNLLHKAHQKVNEIKERHKMSLNELEILRNSAVSQERKLQNSMLKHANNVTIRESMQNDVRK---IVSKLQEMKEKKEAQLNNIDRLANTITMIEEEMVQLRKRYEKAVQHRNESGVQLIEREEEICIFYEKINIQEKMKLNGEIEIHLLEEKIQFLKMKIAEKQRQICVTQKLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRARFLPGKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRLTDRLCSKTQGCKQDTLLLAKKMNGYQRRIKNATEKMMALVAELSMKQALTIELQKEVREKEDFIFTCNSRIEKGLPLNKEIEKEWLKVLRDEEMHALAIAEKSQEFL--EADNRQLPNGVYTTAEQRPNAYIPEADATLPLPKPYGALAPFKPSEPGANMRHIRKPVIKPVEI 955          
BLAST of coiled-coil domain-containing protein 146 vs. UniProt/SwissProt
Match: sp|Q66H60|CC146_RAT (Coiled-coil domain-containing protein 146 OS=Rattus norvegicus OX=10116 GN=Ccdc146 PE=1 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 2.518e-105
Identity = 293/901 (32.52%), Postives = 501/901 (55.60%), Query Frame = 3
Query:  300 SRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKL-TDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSD------EFSAICDNLNATKLRLVENNSQMNQYAKAIEKI--RKETSEQ-------------DEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQ---SELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKE-----CSLK-----ELHYKIEND-----SEFGITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            ++E+E  LL+ +K++T +++++   L +A+DFP    TEVSK+R+ LLK+ N+  A+++R     Y+++SL  EK ++  E  + P   E E KTKL  +S  EL+KE+   +L      EI  L E++   +        E   + D     K  +V + S   Q  K IEK+  RK  +E+             D +K+  N+ SA              E+++ I        +++G+   ++    E  ++ K LE+ +E E     ++  LD+++++   +KQ   D+++ K + K++  + LK+  L LK + ++L     L+ +   ++   PK +L   E  ++  KE++  K+    Q + SE E   + Q I EE +LL +    R  +  L R+ QIK +E+EQKAK++++  +R+  +I E+K K L    Y K+K+EI  +L++FA LY+ I+ ERNK  NL++    + +E++E++++  NE+EILR++ V +++ +Q    K +  +  R+S+Q++V K    L + KEK+      ++RL  +    EE MV LRK+ + A+Q RN+  +QLIER EEVCI  EK N ++++    + EI I  ++I F+K  + E +RQI + +K    K   +  +   +IQ   C DR+  LE    NPD + R++ + G+D +  E+  K + L ++L  KEE  +EK+ + E VS+L N L+ K  + ++DT+ LAK +N+Y+ ++  + +++ A  AEL+M  +  ++LQ+EV+ KE     CS +      L+ +IE D      +  + ++    K +E I  +    QL NG  TTA+ RPNAY+PE +  LP+P+PYGA APF+PSEPG+N RHIRK  +KPIEI
Sbjct:  100 TQESEVQLLENAKRFTEQIQQQQVRLQEADDFPNVFTTEVSKLREQLLKYQNEYTAVQEREYHTQYRLNSLTEEKSLVLKEFEKIPKPGEIEKKTKLLKESTEELRKEVIQKRL------EIKNLREDVVSKQKQLMKEQKELEELMDYQVGLKDDVVHHQSVPVQITKEIEKLTRRKIETEKKNVVLEFELKELSDSLKKLENKVSALAE-----------ERDDTIK-------EVEGKRTLLEVKEREYGQLLKLLELTKENEASSLAERGILDINLRNCLMDKQNYHDELSRKQREKERDFRNLKKTELLLKVSLDALSQAQALNQRLLLEMEAIPKEDLLLPEQRKELHKEVDLAKRNLAQQRSLSEAEAKLVEQQIAEENKLLKEQETMREVLFNLGRMTQIKMEEKEQKAKDFLKSQRRYCDIIKEIKSKKLEIRLYRKRKREIHRRLKEFAGLYDAIRNERNKFVNLLHKAYQKVNEIKERLKMSLNELEILRSSAVSQERKLQNAMLKHSNNVTIRESMQNDVCKITAKLQEMKEKKEAQLTSMDRLASMITVIEEEMVQLRKKYEKAVQRRNESGVQLIEREEEVCIFYEKMNIQDKVKLHQDIEIHILEEKIRFLKLKVAEKQRQICVTQKLVPIKKSLDANLAVVQIQFSQCADRIKALEKCFVNPDCQGRVRFIPGKDLTEEEMIKKLDMLELQLAKKEEKLLEKDFIYEQVSQLTNRLKTKTQACKMDTLLLAKKMNSYQKKIKDVTQEMMALVAELSMKQALTIELQKEVREKEEFIFSCSSRIEKGLPLNREIEKDWLKVLRDEEMYAFATAEKTREYIDTDYR--QLPNGVYTTAEQRPNAYIPETDATLPLPKPYGALAPFKPSEPGANRRHIRKPIIKPIEI 974          
BLAST of coiled-coil domain-containing protein 146 vs. UniProt/SwissProt
Match: sp|A8HUA1|CFA58_CHLRE (Cilia- and flagella-associated protein 58 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP58 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.702e-23
Identity = 87/318 (27.36%), Postives = 170/318 (53.46%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSEC 2558
            LY  ++ +RN  +  +        EM+ K +I+ ++IE L+  +  KD Y+ K+  +  ++I  ++ L++E+ +    + +     N  ++EI++LN + N+A++     +K+ D+ +  R+    QL+ RN+E+  L E+   ++  +  G+ + + R+ EI  +K  + +LKRQ+ +L+ +  N +  +REV     +L   R ++  L  E ENP    R +KL G DP   E+  K + L  +LI K E  +EK+LL++   +L  EL+N  +  R    ++A+ L+ Y+  +    K++KA  +EL M  ++ 
Sbjct:  479 LYEAVRADRNLYSKNLIEAQDEIQEMKRKFKIMQHQIEQLKEEITGKDLYLLKEHFEHQKVINEKEQLRNELDRSKSNIKEADSAINAQKVEIDKLNHIINEADQERRRQKKEYDIVVNERDILGTQLVRRNDELAALYERIKIQQATLQMGQSQYRDRLAEIRQLKVRLADLKRQLHLLKSSVSNIDVLKREVHQLGRELLQERTKVKALSEELENPLNVHRWRKLEGSDPGTYEMIQKIQTLQKRLISKTEEVVEKDLLIQEKEKLYMELKN--ILARQPGPEVAEQLSIYQANLREKTKQMKAMASELNMYQAQV 794          
BLAST of coiled-coil domain-containing protein 146 vs. UniProt/SwissProt
Match: sp|B2RW38|CFA58_MOUSE (Cilia- and flagella-associated protein 58 OS=Mus musculus OX=10090 GN=Cfap58 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.104e-17
Identity = 91/329 (27.66%), Postives = 173/329 (52.58%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSK--KNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEIC--RDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEV 2579
            LY  ++ +RN  +  +       +EM+ K++I+ ++++ L+  +  K+  + K   +   I   +++L++E+ K  +  L +K   ++ E+  E  +L ++  +A+   V  +K+ D  +  R+    QL+ RN+E+ +L EK   ++ +++ GE +   R++++  +K  IK+L+R+  IL ++  N  +  +E+  Y +Q E    R R   LE E ENP    R +KL   DPS  EL  K   L  +LI K E  +EKELLL+   +L  EL++  +  R    + A+ L  Y+  +    K+LK  ++EL M  S+  + + E+
Sbjct:  490 LYEAVRSDRNLYSKNLVEAQDEITEMKRKLKIMTHQVDQLKEEISAKEAALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEV--EERKLLRIIAEADGERVRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGETQYNQRVEDMRILKLEIKKLRREKGILARSVANVEELRQEL--YHMQREFLKERTRCRALEEELENPMNVHRWRKLEASDPSTFELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYVELKH--ILARQPGPEAAEQLQIYRHTLREKTKQLKVLSSELNMYESQSQEYKYEI 812          
BLAST of coiled-coil domain-containing protein 146 vs. UniProt/SwissProt
Match: sp|Q5T655|CFA58_HUMAN (Cilia- and flagella-associated protein 58 OS=Homo sapiens OX=9606 GN=CFAP58 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.967e-13
Identity = 82/313 (26.20%), Postives = 165/313 (52.72%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTM 2543
            LY  ++ +RN  +  +       ++M+ K++I+ ++++ L+ ++  K+  + K   +   I   +++L++E+ K      + K    + + E  +L ++  +A+   +  +K+ D  +  R+    QL+ RN+E+ +L EK   ++ +++ GE +   R++++  ++  IK+L+R+  IL ++  N  +  +E  + + +L   R R   LE E ENP    R +KL   DP+  EL  K   L  +LI K E  +EKELLL+   +L  EL++ VL+ R    + A+ L  Y+  +    ++LK  ++EL M
Sbjct:  490 LYEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVDELKEDISAKESALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEAEERKLLRIIAEADGERLRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKGILARSMANVEELRQEFFHMQRELLKERTRCRALEEELENPLNVHRWRKLEASDPNAYELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKH-VLA-RQPGPEAAEQLKLYRRTLHDKKQQLKVLSSELNM 800          
BLAST of coiled-coil domain-containing protein 146 vs. TrEMBL
Match: A0A1S3HBW2 (coiled-coil domain-containing protein 146 OS=Lingula unguis OX=7574 GN=LOC106153914 PE=4 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 358/886 (40.41%), Postives = 566/886 (63.88%), Query Frame = 3
Query:  288 LLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTK-LTDSINELKKEISDLKLKQK---ENIEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYN----KIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEN--------DSEFGIT----SYKLPMK-IQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
             L+K+R++E  LLQ +K +T+++E +   L++A++FP   NTEVS+MR  LLK++N+    EDR   L YK+ +LE EKK+L+ E  R P  +E E K K L ++ +EL+KEI+  +++ K   E++E  K     +Q    +F A    +   K  LV  NS  +Q  K  +K +++   +DE+ +   E  +  ++L     +  M++++L +  KFD +    K +      Q E D++ K+ +  + +   L  D  +LD  ++H N EK+   + V+ K + KDK ++ LK+A LQ K  E++L     +H KA+  +++FPK +   ++  +  +KE+++ K+    +N+ + VE+ K+ QSI EEE+LLY+ SD RIEV+EL RLA IKADEREQKA+++++   R++R I++LK K L   D+ KK +E+Q+KL++FAKLY+VI+ ERNKC NLI   T +++EMREKI+IL+NEIEILRT  + K++ +QK R K    I  RDSL++EV+K+  +  + +EKR + +++I +LN + NQAE+ MV LRKQ + ++Q+RNDR + L++ +EEVCI  EK N +E +I  G+ E+  R +EI F+   + E KR IE+LRK   NK   ++E+V  +IQL  C+DR+ ELE + ENP  ETR++ L G DPSP +LQ+K EEL ++L  KEE  +EK+L+ E  +RL   ++ +  + + DT+ LAK +N+ + ++  + +K+ A+ +EL+M+ +  ++LQQEVK KE  L++ + ++E         + E+  T      +L  K +Q ++  E  QY L  G  T A+PRPNAY+P+++++LPIPRPYGAHAPF+P EPGS MRHIRK   KPIEI
Sbjct:   87 FLKKTRDSETKLLQQAKDFTMQLEGQKVELEKADNFPESYNTEVSQMRAKLLKYNNELAQAEDRDYQLAYKLENLEEEKKILQREYERLPKQEEIEKKIKELQNAADELRKEIAQRQIEAKNLREDLETRKRQ---YQVDYKDFEAEVFKMETLKGDLVAVNSLPSQIGKEADKKQRK---KDELDKQKKELDSEYKELLAATQQLEMKRQKLED-EKFDMDTQLDKERAMLEDKQREYDQLHKECDYAKNRIQVLMEDSAQLDFSLRHSNLEKKSQHEVVSKKQRDKDKELRNLKKAELQFKVAEDALSHTKAVHEKAKGSVDVFPKDDGSMQQKRQDLQKEVDNAKRALAQENSLTAVEQVKVEQSIAEEEQLLYEQSDLRIEVVELTRLAAIKADEREQKARDFMRAEMRYHRAIEDLKTKQLQIQDHAKKYQEMQVKLKEFAKLYDVIKNERNKCVNLIQVSTQKAAEMREKIKILSNEIEILRTAAMMKERSLQKSRLKHINSIVIRDSLRNEVAKQERIDDELREKREQQKMDIAKLNMMINQAEQQMVELRKQYETSVQHRNDRGIVLVQTDEEVCIFYEKVNIQETMIRNGDVELSAREEEIRFLNMQMNEEKRAIELLRKQLPNKRMLDQELVTLQIQLSQCQDRMLELEKQLENPYDETRVRYLEGSDPSPAQLQTKLEELEVRLAEKEEQLLEKDLIFEQDTRLTERVKRRAGAGKDDTLALAKKVNDLQGKIKEMTRKMMAQVSELSMHQAAAMKLQQEVKEKEAELEQCYIRMEKGEPPSDEIEREWQRTLRDEERRLRDKEMQSMVEAEAEQYTLPGGITTAAEPRPNAYIPDDDSELPIPRPYGAHAPFKPQEPGSTMRHIRKPVPKPIEI 965          
BLAST of coiled-coil domain-containing protein 146 vs. TrEMBL
Match: A0A2C9KBR0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106054036 PE=4 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 7.463e-176
Identity = 361/895 (40.34%), Postives = 568/895 (63.46%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSP--GLKEKEIKTKLTDSINELKKEISDLKLKQKENIE-ISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKI-RKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYI-------SIQSELDE-------IKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIENDS--------EFGITSYKLPMKIQEL-----ISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            L+++RENE  LLQ +KK+   ++K+   L++ ++FP +SNTEVSKMR+ LLK++ND +  ED+   L YKI  L+ EKK+++ E  R P  G  EK+IK +L +   E++KE+   + + K  +E + + N +I   K  EF  + +++   K  LV+ N    Q AK  +KI R++ S Q +++    E                MEK E+IN  +     ++ +Y        S++S L E       ++K+ E  +E+ET L  DK  LD++++H+  E++   D    K K K++ ++ LK+A LQLK  EE+L     +H K ++ +   PK +    + +E+ +KE+E  K+    QN+ + VE  KL  S  EE+ LLY+ SD RIEV+EL RLA IKADEREQKA+++++   +++R +++LK K L   D++KK +E+Q+KL +FAKLY+VI+ ERNKC NLI T + +++EM+EKI+ILNNEIEILRT ++ KDK +QK + K    I  RDSL++E++K+  L  + K KR++ ++E+ +LN L NQ EE M  L+++ +  +++RN+R ++LIERNEEVC+  E+ N +++++  GE E++ + +EI F++   +E+KR +E+LRK   +K   E+E+V  +IQLE C+DR+  +E   ENP  ETR+++L G+DPSP E+ SK EEL ++L  KEE  +EK+L+ + V RL + + NK  + + DT++LAK++NN + ++    +K+ A  +EL+MN ++ ++LQQEVK KE  L++ + ++E           E+      L  KI+E+     +  E  QY+L  G  TTA PRPNAY+PE+E++LPIPRPYG  APF+PSE GS+MRHIRK   KPIEI
Sbjct:  127 LKRTRENESRLLQEAKKFANDLDKQCEELEKGDNFPENSNTEVSKMREQLLKYNNDLIEAEDKQYQLEYKIECLDEEKKIIQREYSRLPKQGEIEKKIK-ELQNGNEEMRKEVLQRQNEVKTLVEDLDRTNHQIAHDKK-EFEKLTEDMEKLKAELVQINFVPGQTAKEADKILRQKNSIQSQLEALDAE---------------YMEKLEIINNMEVQQKALKDEYFEAETKLKSLRSLLSEKERAFATVEKEYEHAKERETMLNGDKANLDMNLRHIQMERKNLHDIYTRKLKEKERDIRNLKKAELQLKVAEENLNHTKSIHEKVKSQVACLPKDDGSTVKKLEELQKEVEQAKRALAQQNSLTAVEHVKLEASALEEQNLLYEQSDLRIEVVELTRLAAIKADEREQKARDFMRAEMKYHRAVEDLKTKQLQIQDHQKKFQEMQIKLNEFAKLYDVIKNERNKCVNLIQTSSQKAAEMKEKIKILNNEIEILRTAVMLKDKELQKNKLKHMNAIVMRDSLRNELTKQQHLAEEMKAKRDQQKVELGKLNLLINQGEEQMNKLKERFENNVKHRNERGVKLIERNEEVCVFYERVNIQDQMVRNGEVELKTKEEEIRFLQLQKQEMKRSLELLRKNVPDKLNQEKELVTLQIQLEQCQDRMLAMEKSLENPYDETRVRQLTGKDPSPGEIHSKVEELELRLAEKEERLLEKDLIFDQVERLVSRISNKAQAGKDDTLNLAKSVNNIQARLKETTRKMMALVSELSMNQAQAMKLQQEVKEKEAELEQCYIRMEKGDAPSQEIELEWEKMMRDLERKIEEVELRRQLEAEEEQYKLAGGVYTTAVPRPNAYIPEDESELPIPRPYGTQAPFKPSETGSSMRHIRKPVPKPIEI 1004          
BLAST of coiled-coil domain-containing protein 146 vs. TrEMBL
Match: A0A267EK69 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027331g1 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 4.014e-173
Identity = 351/886 (39.62%), Postives = 558/886 (62.98%), Query Frame = 3
Query:  270 YLIKVQLLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTK-LTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSE-QDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND-------------SEFGITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            Y+   + L++SR++EF LLQ +K+ T+++E +   L + ++FP + ++E  K R++LLK++N+ L  E+R+    YKI  L+ E+ +L+ E  R P   + E + K L     EL+ +IS    +QK+  E  +  E+      +E   + + L+  K  L++ +   NQ  K  E++RK+ ++ + E +   NE     ++L      +    ++L  + K D  +        Q  LD+I   LE  R+KE  +  D+  +D++++H+N E++   +  + K + K++ +K+LK+A LQ K++E++L  +  +H K + + +  P+ +    +      KE+E  ++    + T +  E+ K+TQSI++EERL Y L D RIEVIEL RLA IKADEREQKA+++++   R  RVI++LK + L   D++KK +E+++KL+DFAKLY+VI+ ERNKC +L+     +++EMREKIRIL NE+EILRTN+  ++K++QK R +    I  RD L+++VSK+     +Q E R +++L+IN+LN L N +EE MV LRKQ+D A+Q  NDRA+QLIERNEEV +LQEK   +E +I  GE E++ R +E+DF++  +KE +RQ+++ +K    K Q E E+   +IQL IC+DRL ++E   E+P    R++ L G DP PIEL +K E++ I+L  KEE  +E++LLLEAVSRLA +L+ +  + + DT+ LAK +N YKF+MG + K++KA TAELTM MS  +QLQQ+V++K+  L+  + ++E               S       +   +  +  + +  Q+ L +G +TTA+PRPNAY+P +E +LPIPRPYG HAPF+P+EPGSNMRHIRK + KPIEI
Sbjct:  110 YMQLFEFLKRSRDSEFQLLQQAKQHTLELEHQRAELGKQDNFPDNVSSEAEKFRETLLKYNNELLLTEERVYDFEYKIQCLKEERDILKREYDRIPKADDIEKRCKQLEQDTVELQDDISKRIREQKKTTEAKRELEQQTAELREELEKVKEYLDQKKSDLIKVSGLPNQLNKETERVRKQKTDIEKETRERQNEIDGMQKQLESLEEASRRLAKDLETV-KHDATQQVASNTKSQETLDKINGDLEELRQKEMTVVTDRATIDMNLRHLNLERRNLMETHSRKAREKERELKSLKKAQLQQKASEDALALVTQVHEKTKQNYDSVPRDDGSMVKRKTVLDKEVEDFRRNVAQETTLTSAEQVKVTQSIEDEERLQYKLQDLRIEVIELTRLAAIKADEREQKARDFMKAEMRHKRVIEDLKSRQLQIQDHQKKHRELEVKLKDFAKLYDVIKNERNKCVSLVQVAAQKAAEMREKIRILENEVEILRTNIGTREKHLQKLRLRHANSIVMRDQLRNDVSKQRHSDDEQNEVREQLKLDINQLNGLVNASEEAMVQLRKQSDRAVQLLNDRAVQLIERNEEVYVLQEKVRVQEAVIQRGELELRQREEELDFLRLQLKEEERQVQLAKKKVPKKRQVEDELTVLQIQLSICQDRLLQMESRTEDPTHAGRLRYLEGADPGPIELHNKCEDMEIRLAAKEEQLLERQLLLEAVSRLAEQLERRSKAGQHDTLALAKEVNGYKFRMGTVTKRMKAGTAELTMLMSTAMQLQQQVRDKQQYLQSCYQRMERGEPPSEDIEAEWLKSRMVDDRRRTERQEAQAQAAQQEQFVLGHGGVTTAEPRPNAYIPNDEVELPIPRPYGGHAPFKPTEPGSNMRHIRKPRPKPIEI 994          
BLAST of coiled-coil domain-containing protein 146 vs. TrEMBL
Match: A0A1I8FZ87 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027331g3 PE=4 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 7.851e-173
Identity = 351/886 (39.62%), Postives = 558/886 (62.98%), Query Frame = 3
Query:  270 YLIKVQLLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTK-LTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSE-QDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND-------------SEFGITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            Y+   + L++SR++EF LLQ +K+ T+++E +   L + ++FP + ++E  K R++LLK++N+ L  E+R+    YKI  L+ E+ +L+ E  R P   + E + K L     EL+ +IS    +QK+  E  +  E+      +E   + + L+  K  L++ +   NQ  K  E++RK+ ++ + E +   NE     ++L      +    ++L  + K D  +        Q  LD+I   LE  R+KE  +  D+  +D++++H+N E++   +  + K + K++ +K+LK+A LQ K++E++L  +  +H K + + +  P+ +    +      KE+E  ++    + T +  E+ K+TQSI++EERL Y L D RIEVIEL RLA IKADEREQKA+++++   R  RVI++LK + L   D++KK +E+++KL+DFAKLY+VI+ ERNKC +L+     +++EMREKIRIL NE+EILRTN+  ++K++QK R +    I  RD L+++VSK+     +Q E R +++L+IN+LN L N +EE MV LRKQ+D A+Q  NDRA+QLIERNEEV +LQEK   +E +I  GE E++ R +E+DF++  +KE +RQ+++ +K    K Q E E+   +IQL IC+DRL ++E   E+P    R++ L G DP PIEL +K E++ I+L  KEE  +E++LLLEAVSRLA +L+ +  + + DT+ LAK +N YKF+MG + K++KA TAELTM MS  +QLQQ+V++K+  L+  + ++E               S       +   +  +  + +  Q+ L +G +TTA+PRPNAY+P +E +LPIPRPYG HAPF+P+EPGSNMRHIRK + KPIEI
Sbjct:  110 YMQLFEFLKRSRDSEFQLLQQAKQHTLELEHQRAELGKQDNFPDNVSSEAEKFRETLLKYNNELLLTEERVYDFEYKIQCLKEERDILKREYDRIPKADDIEKRRKQLEQDTVELQDDISKRIREQKKTTEAKRELEQQTAELREELEKVKEYLDQKKSDLIKVSGLPNQLNKETERVRKQKTDIEKETRERQNEIDGMQKQLESLEEASRRLAKDLETV-KHDATQQVASNTKSQETLDKINGDLEELRQKEMTVVTDRATIDMNLRHLNLERRNLMETHSRKAREKERELKSLKKAQLQQKASEDALALVTQVHEKTKQNYDSVPRDDGSMVKRKTVLDKEVEDFRRNVAQETTLTSAEQVKVTQSIEDEERLQYKLQDLRIEVIELTRLAAIKADEREQKARDFMKAEMRHKRVIEDLKSRQLQIQDHQKKHRELEVKLKDFAKLYDVIKNERNKCVSLVQVAAQKAAEMREKIRILENEVEILRTNIGTREKHLQKLRLRHANSIVMRDQLRNDVSKQRHSDDEQNEVREQLKLDINQLNGLVNASEEAMVQLRKQSDRAVQLLNDRAVQLIERNEEVYVLQEKVRVQEAVIQRGELELRQREEELDFLRLQLKEEERQVQLAKKKVPKKRQVEDELTVLQIQLSICQDRLLQMESRTEDPTHAGRLRYLEGADPGPIELHNKCEDMEIRLAAKEEQLLERQLLLEAVSRLAEQLERRSKAGQHDTLALAKEVNGYKFRMGTVTKRMKAGTAELTMLMSTAMQLQQQVRDKQQYLQSCYQRMERGEPPSEDIEAEWLKSRMVDDRRRTERQEAQAQAAQQEQFVLGHGGVTTAEPRPNAYIPNDEVELPIPRPYGGHAPFKPTEPGSNMRHIRKPRPKPIEI 994          
BLAST of coiled-coil domain-containing protein 146 vs. TrEMBL
Match: A0A433SM35 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_022013 PE=4 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 3.565e-171
Identity = 360/895 (40.22%), Postives = 567/895 (63.35%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSP--GLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEI----FQTKSD--EFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKE---TSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEI-------YREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIE-NDSEFGITSYKLPMKIQELISY--EG----------HQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            L+++R NE  LLQ +K +T +++ +   L++ ++FP  SNTEVSK+R+ LLK+HND    E++   L YKI +LE EKK++E E +R P  G  EK+IK +L     E+KKEI       +  IE   L E++     QT +D  E+  + D L   K  LV+ N+   Q AK  +KI+++    + Q E+  A  +Q + + K  +       E+ +++   K+D +K   +   ++S+L E + QLE+        +E+E  L  D+  +D+ ++HM  EK+   D  + K + KD+  ++LK+A L LK  EESL     ++ K ++ +   PK +    +  +  +KE+E  K+    QN+ + VE  KL  S  EE+ LLY+ SD RIEV+EL RLA IKADEREQKA+++++   +++R +++LK K L   D++KK +E+QLKL++FAKLY+VI+ ERNKC NLI T T +S+EM+EKI+IL+NEIEILRT ++QKDK +QK R K    I  RDS+++E++K+  L  + +EKR + ++++++LN + NQ EE MV LRK+ +  +Q+RNDR ++LIERNEEVC+  EK N ++++I  GE E++ + +EI F++   +E KR +++L K   NK   E+E+V  +IQL+ C+DR+ ELE + E+P  E+R++ L G+DP+P E+Q+K EEL  +L  KEE  +EK+L+ E V RL   + +K    + DT++LAK++NN + ++    +K+ A  +EL+MN ++ L+LQQE + KE  L++ + ++E  +       Y+    + ++  +  EG           QY++  G  TTA+PRPNAY+P++E++LPIPRPYG+HAPF+PSE GS MRHIRK   KPIEI
Sbjct:  116 LKRTRTNEGILLQQAKNYTNELDVQRVELEKGDNFPESSNTEVSKLREQLLKYHNDLSQAEEKQYQLEYKIETLEEEKKIIEREYNRLPKQGEVEKKIK-ELQAGTEEMKKEIV------QRQIEAKTLREDLESTQRQTAADKKEYEKLTDELEKLKADLVQINTLPGQTAKEADKIQRQKNGITNQLEVLNAEYQQFSEVVKDLE-------EQRKVLEEEKYDADK---ELEKLKSDLKEKEIQLEVRMKDFETVKEREVHLLGDRATVDMSLRHMLLEKKNQHDVHSRKLREKDRDSRSLKKAELHLKVAEESLNHTKSIYDKVKSQVGSLPKDDGSTVKKRDDLQKEVEQTKRALAQQNSLTAVEHVKLEASAAEEQNLLYEQSDLRIEVVELTRLAAIKADEREQKARDFMRAEMKYHRAVEDLKTKQLQIQDHQKKFQEMQLKLKEFAKLYDVIKNERNKCVNLIQTSTQKSAEMKEKIKILHNEIEILRTAVMQKDKDLQKYRLKRMNAIVMRDSMRNELAKQQRLEEEMREKREQQKMDMSKLNLMINQGEEQMVKLRKRYEKNVQHRNDRGVKLIERNEEVCVFCEKVNIQDQMIRNGEVELKSKEEEIRFLELQAQEEKRSVQLLHKAMPNKVNMEKELVTLQIQLQQCQDRMLELEKDLEDPYDESRVRYLTGKDPTPGEIQNKVEELETRLAEKEEQLLEKDLIFEQVERLVGRISHKAQVGKDDTLNLAKSVNNVQARIKETTRKMMALVSELSMNQAQALKLQQEARQKEALLEQCYLRMEKGEPPTDEMEYEWDKMLADMRRHVEEGEARRMMEEEEEQYKIAGGVYTTAEPRPNAYIPDDESELPIPRPYGSHAPFKPSETGSTMRHIRKPVPKPIEI 993          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Cavefish
Match: ccdc146 (coiled-coil domain containing 146 [Source:ZFIN;Acc:ZDB-GENE-041210-217])

HSP 1 Score: 335.109 bits (858), Expect = 1.610e-99
Identity = 290/887 (32.69%), Postives = 493/887 (55.58%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIK-TKLTDSINELKKEISDLKLKQKENIEISKLNEEI---------FQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND---SEFGITSYKLPMKIQE----------LISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            L+ S+E+E NLLQ  + + ++++++   L++A  F    NTEVS++RQ LL+ HN     E+R   ++ +I  L  EK  LE      P   E+E +   L +S  E++KEI+  +       E+S L E I          Q K +E   + ++  A    L+E  S+  Q     E+I  +  + ++ K     Q     +L         + EE     K +      +  + Q + +    ++E+ +EK+  L      LD+ I+   +E+Q   ++V  + + KDK++  LK+  LQL+ ++ +LE    L+ K ++  ++ PK +   ++    + + I  + K+ + Q + +++E  ++ Q +++E+ L+ + +  + E+  L  L  IKADER QK++E ++   R+NR+ ++++ K L   D++K+ ++IQ +L   AK+Y+VI+ ERNKC NL    T ++SEM EK++IL +E EI RT  V +++ +QK R K  +    RDSL++++SK+  +L + + KR+E ++ I++L  L N  E  ++ + K ++ A++NRN++ +QL+ER EE+CI  EK N +E +I     EI+   +EI  ++  I E +RQI++ +K    K   E E+   +IQL  CRDR+  L+   E+   E + ++L+GEDPS  EL    E+L ++L  KE   +E EL  E V+RL  + + KV S + D++ LAK +N ++  +     KLKA  AEL M  ++ L LQQ+++ KE  L   H ++E     SE     ++  ++ Q            I+ E  + QL +G  TTA+PRPNAY+P +E  LPIP+PYGA APF+P+EPG+NMRHIRK + KP EI
Sbjct:   83 LKSSQESELNLLQEVQSFCVELDRQQQELEKAELFREGQNTEVSRLRQQLLQAHNKIQEAENREFHMHNQIECLREEKIYLEKVYESQPKPAEQEKRYLALKESCKEIRKEIAQRRQ------EVSGLTEGIEERHKQTLKVQLKLEENKELIESKEAE---LIELRSRSAQLRNENERIGHKKMDLEKHKAGLELQLQEQEELKKKTQARCWQLEEESRAVKRELEDRMAKMDAAQRQSNFKLTEVELTKEKKAILLEQSSLLDIKIQQTTTERQSLLENVPRQMREKDKLLHHLKKTQLQLQESKNALEQTQELYNKTKSQRDIMPKDDGLKQKIENLQEEIINLKLKIVN-QISLTDLEVQEVEQCVEQEQALIRESNRRQEELHHLKTLILIKADERNQKSRELLKARVRYNRISEDIRGKQLQVQDHKKQHQQIQSRLGMLAKMYSVIKAERNKCVNLNQIATQKTSEMMEKLKILESEYEIQRTTAVGRNRLLQKSRLKQAQSSTLRDSLRNDISKEAWMLEEMRCKRDEQRVNISKLAHLINSQEHQLLHIHKSHETAVKNRNEQRVQLLEREEELCIFYEKVNGQESLIQERNLEIEALEEEIHSLRMLITEERRQIDLCQKQVPCKKAMEEEIALLQIQLSECRDRVLSLDKTLEDHATEKQARELSGEDPSYAELIKITEQLEVRLAEKEARLLENELAYEQVTRLCQQSRTKVESAKEDSLTLAKKVNEFQRCIRDCDNKLKAAAAELAMEKAQALHLQQDLREKELQLDLCHTRLEQGLPPSESIEEEWQRCLRDQRRRQADAEKRARIAEEEERNQLPSGAYTTAEPRPNAYIP-SEDILPIPKPYGALAPFKPTEPGANMRHIRKPQPKPTEI 958          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Cavefish
Match: ccdc146 (coiled-coil domain containing 146 [Source:ZFIN;Acc:ZDB-GENE-041210-217])

HSP 1 Score: 310.842 bits (795), Expect = 8.601e-92
Identity = 225/624 (36.06%), Postives = 377/624 (60.42%), Query Frame = 3
Query: 1050 LDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND---SEFGITSYKLPMKIQE----------LISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            LD+ I+   +E+Q   ++V  + + KDK++  LK+  LQL+ ++ +LE    L+ K ++  ++ PK +   ++    + + I  + K+ + Q + +++E  ++ Q +++E+ L+ + +  + E+  L  L  IKADER QK++E ++   R+NR+ ++++ K L   D++K+ ++IQ +L   AK+Y+VI+ ERNKC NL    T ++SEM EK++IL +E EI RT  V +++ +QK R K  +    RDSL++++SK+  +L + + KR+E ++ I++L  L N  E  ++ + K ++ A++NRN++ +QL+ER EE+CI  EK N +E +I     EI+   +EI  ++  I E +RQI++ +K    K   E E+   +IQL  CRDR+  L+   E+   E + ++L+GEDPS  EL    E+L ++L  KE   +E EL  E V+RL  + + KV S + D++ LAK +N ++  +     KLKA  AEL M  ++ L LQQ+++ KE  L   H ++E     SE     ++  ++ Q            I+ E  + QL +G  TTA+PRPNAY+P +E  LPIP+PYGA APF+P+EPG+NMRHIRK + KP EI
Sbjct:  189 LDIKIQQTTTERQSLLENVPRQMREKDKLLHHLKKTQLQLQESKNALEQTQELYNKTKSQRDIMPKDDGLKQKIENLQEEIINLKLKIVN-QISLTDLEVQEVEQCVEQEQALIRESNRRQEELHHLKTLILIKADERNQKSRELLKARVRYNRISEDIRGKQLQVQDHKKQHQQIQSRLGMLAKMYSVIKAERNKCVNLNQIATQKTSEMMEKLKILESEYEIQRTTAVGRNRLLQKSRLKQAQSSTLRDSLRNDISKEAWMLEEMRCKRDEQRVNISKLAHLINSQEHQLLHIHKSHETAVKNRNEQRVQLLEREEELCIFYEKVNGQESLIQERNLEIEALEEEIHSLRMLITEERRQIDLCQKQVPCKKAMEEEIALLQIQLSECRDRVLSLDKTLEDHATEKQARELSGEDPSYAELIKITEQLEVRLAEKEARLLENELAYEQVTRLCQQSRTKVESAKEDSLTLAKKVNEFQRCIRDCDNKLKAAAAELAMEKAQALHLQQDLREKELQLDLCHTRLEQGLPPSESIEEEWQRCLRDQRRRQADAEKRARIAEEEERNQLPSGAYTTAEPRPNAYIP-SEDILPIPKPYGALAPFKPTEPGANMRHIRKPQPKPTEI 810          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Cavefish
Match: ccdc146 (coiled-coil domain containing 146 [Source:ZFIN;Acc:ZDB-GENE-041210-217])

HSP 1 Score: 253.447 bits (646), Expect = 4.119e-70
Identity = 250/812 (30.79%), Postives = 437/812 (53.82%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSP----------GLKE--KEIK----------TKLTDSINELKKEISDLKLKQKENIEISKLNE------------EIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIE 2624
            L+ S+E+E NLLQ  + + ++++++   L++A  F    NTEVS++RQ LL+ HN     E+R   ++ +I  L  EK  LE      P           LKE  KEI+          + LT+ I E  K+   ++LK +EN E+ +  E              F + +  F   C  L A    L+E  S+  Q     E+I  +  + ++ K     Q     +L         + EE     K +      +  + Q + +    ++E+ +EK+  L      LD+ I+   +E+Q   ++V  + + KDK++  LK+  LQL+ ++ +LE    L+ K ++  ++ PK +   ++    + + I  + K+ + Q + +++E  ++ Q +++E+ L+ + +  + E+  L  L  IKADER QK++E ++   R+NR+ ++++ K L   D++K+ ++IQ +L   AK+Y+VI+ ERNKC NL    T ++SEM EK++IL +E EI RT  V +++ +QK R K  +    RDSL++++SK+  +L + + KR+E ++ I++L  L N  E  ++ + K ++ A++NRN++ +QL+ER EE+CI  EK N +E +I     EI+   +EI  ++  I E +RQI++ +K    K   E E+   +IQL  CRDR+  L+   E+   E + ++L+GEDPS  EL    E+L ++L  KE   +E EL  E V+RL  + + KV S + D++ LAK +N ++  +     KLKA  AEL M  ++ L LQQ+++ KE  L   H ++E
Sbjct:  122 LKSSQESELNLLQEVQSFCVELDRQQQELEKAELFREGQNTEVSRLRQQLLQAHNKIQEAENREFHMHNQIECLREEKIYLEKVYESQPKPAEQEKRYLALKESCKEIRKEIAQRRQEVSGLTEGIEERHKQTLKVQLKLEENKELIESKEVSYICHSVPVHCRAFISPARPFDVCCLCLQAE---LIELRSRSAQLRNENERIGHKKMDLEKHKAGLELQLQEQEELKKKTQARCWQLEEESRAVKRELEDRMAKMDAAQRQSNFKLTEVELTKEKKAILLEQSSLLDIKIQQTTTERQSLLENVPRQMREKDKLLHHLKKTQLQLQESKNALEQTQELYNKTKSQRDIMPKDDGLKQKIENLQEEIINLKLKIVN-QISLTDLEVQEVEQCVEQEQALIRESNRRQEELHHLKTLILIKADERNQKSRELLKARVRYNRISEDIRGKQLQVQDHKKQHQQIQSRLGMLAKMYSVIKAERNKCVNLNQIATQKTSEMMEKLKILESEYEIQRTTAVGRNRLLQKSRLKQAQSSTLRDSLRNDISKEAWMLEEMRCKRDEQRVNISKLAHLINSQEHQLLHIHKSHETAVKNRNEQRVQLLEREEELCIFYEKVNGQESLIQERNLEIEALEEEIHSLRMLITEERRQIDLCQKQVPCKKAMEEEIALLQIQLSECRDRVLSLDKTLEDHATEKQARELSGEDPSYAELIKITEQLEVRLAEKEARLLENELAYEQVTRLCQQSRTKVESAKEDSLTLAKKVNEFQRCIRDCDNKLKAAAAELAMEKAQALHLQQDLREKELQLDLCHTRLE 929          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005509.1 (pep scaffold:Pmarinus_7.0:GL476755:198637:219471:-1 gene:ENSPMAG00000005005.1 transcript:ENSPMAT00000005509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.872 bits (847), Expect = 3.045e-99
Identity = 268/890 (30.11%), Postives = 470/890 (52.81%), Query Frame = 3
Query:  300 SRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKLT-DSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDNLNATKL-------RLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXME--KEELINISK-FDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKH--MNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND----------------SEFGITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            +R++E  LL+ +K++T +++ +   L+ A+ FP   +T+V ++R  LL+ HN     E+    L+YKI SL+ EK +L+ E  R P   + E K KL  +   +L++E+S  K       E+  L EE+ +++  +      +LN  K+        LV+ +    +  K I+ +  +  EQ+E +RAA E  +   +          E  + E + +++  D  + Q    + + EL  + + L    E+E + Q D+      +    M +++ K   D N+       +M  LK +  QLK+  ++L  +   H K  A ++  P+ +      I++ R +IE +K+    + + SE E   +   + EE RL     + R ++  L  LAQ+KA+EREQK+++  +   R+ R++ E+K K L+ +D++K+ +EI L+L++F++LYNVI++ERN+CAN+I     +S+E REK++IL NE+EIL ++   K   +QKQR K   +  +RD+ +++ ++      + +E+    Q  + RL     +A+     LR + + A++ R  RA QL+E   EVC L E+ +  +     G   +Q   +E  F+     E  RQ+ + R+   ++   + +++   +QL   +D + ELE + E+P+   R++ L G+D SP EL  K EEL  +L HKEE  +EK+L+LE VSRLA     +      DT+ LA  +N  + ++    ++L A  +EL M  +  L+LQQEV+ +   ++  H ++                    E      +L  + +E  + +  +    +G  +TA+PRPN Y+P+++  LP+PRPYGA APF+PSE G++MRHIRK  +KPIEI
Sbjct:    1 TRDSEEALLRETKRYTEELQGQRGQLESADAFPDGQSTDVGRLRSQLLRHHNALSQSEETHTQLHYKIQSLQDEKNLLQKEYERMPKPGDLERKAKLVMEGCEDLRREVSQRK------AEVQSLQEEL-ESRQGQMIREQKSLNQQKIMRENLKNELVQIHMVPGEIMKEIKAVEHKKQEQEE-RRAALEAQSRDAQAALAGAAVRAEEARHEAVAVAEELDARRTQ--LDAQRHELQRLARDLAFAGEREAQRQGDRYDATTPVHGTKMKAQRMKPSYDENANQNYNRSLMNVLK-SDKQLKAARDALALVQSAHAKTHAQVDSMPQDDGSNAHRIKELRDDIEAKKRQLLKEESLSEAEARAMEAHLAEEARLGGLHMELREQLRSLLHLAQVKAEEREQKSRDSAKAKIRYERILQEVKAKDLSIVDHKKRHQEIVLRLKEFSQLYNVIKLERNRCANMILAAAQQSAETREKLKILENELEILVSSSSSKALMIQKQRKKHQTVALSRDTARADTTRCGREGRELEERHQRSQEALARLRAHVERAQSGSRELRSRYEEAVRQRRARASQLLELEGEVCALYERLHVGDTAAREGHVALQALEEEARFLAMARLEETRQLGLARRDGPSRRMLDEQLIGLHLQLLQYQDHIRELEGQLEDPE-GRRVRFLEGKDLSPSELARKTEELEEQLAHKEEQLLEKQLVLEQVSRLAERADAQAREGHNDTLSLAGKMNGVRGRLRARTRRLMALVSELAMRQAAALRLQQEVRERAALVESCHARLAQGLAPCDGAEREWRSALRDEHRRRCERLARQKEEAAAAD--RTTAGDGAASTAEPRPNCYIPDDDLGLPVPRPYGALAPFKPSETGASMRHIRKPSIKPIEI 876          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005099.1 (pep scaffold:Pmarinus_7.0:GL476392:969020:986502:-1 gene:ENSPMAG00000004604.1 transcript:ENSPMAT00000005099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 1.229e-21
Identity = 89/320 (27.81%), Postives = 173/320 (54.06%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDR--LAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSEC 2558
            LY  ++ +RN  +  +       +E + K++I+N++I+ L+  +  K+  + K+  +   +   R++L+ E+ +     ++ K   +  ++E  +L ++ ++A++  +  +K+ D  L  R+    QL+ RN+E+ +L EK   ++  ++ GE + + R+++I  +K  I++L+R+  IL +++ N     REV  Y +Q ++ R+R     LE E ENP    R +KL G DPS  EL  K   L  +LI K E  +E+ELL++   +L  EL  K +  R    ++A+ L  Y+  +    K++K+  +EL M  S+C
Sbjct:  490 LYEAVRSDRNLYSKNLIEAQDEITETKRKLKIMNHQIDQLKEEITAKEATLVKEHMENQRVEKEREALKVELQRMKQQAAETKAFIDSQEVEERKLLRIISEADQDRLRQKKELDQVLTERDVLGTQLVRRNDELALLYEKIKIQQSTLNKGEVQYRQRLEDIRLLKLEIRKLRREKNILTRSTANVEDLRREV--YHMQRDLLRERTRCKALEEELENPMNIHRWRKLEGSDPSTYELIQKIHMLQKRLITKTEEVVERELLIQEKEKLYVEL--KHILARQPGPEVAEQLQIYQQTLREKTKQMKSLASELNMYESQC 805          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Nematostella
Match: EDO49671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFV9])

HSP 1 Score: 522.316 bits (1344), Expect = 1.618e-170
Identity = 341/886 (38.49%), Postives = 542/886 (61.17%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKLTDSINELKKEISDLKLK-QKENIEISKLNEEI--FQTKSDEFS----AICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRA--ANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIEND---SEFGITSYKLPMKIQELISYEGHQ----------YQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            L+ +RE E +LL  +K+   +V+++   L++ ++FP   N EV+K+RQ LLK HN+    ++R   L +K+  L+ EK MLE E  R P  K  EI+ +L     E+ K + DLK++  +  +E   L EE+   Q   DE         +     +  LV+ +SQ    +K I+ I ++  + ++ ++    + +         D  +  +E E++      D  +    Y S + E+D + K+ E+ +E++ E   D+  LDL++KH   EK+   D    KT+ K++ +K+LK++ LQLK  E++L  +  ++ K ++ +   P+ +    +  ++ ++E++  K+    QN  +  E+A++ Q IQEEERLL + S+ R++VI+L RLAQIKADEREQKA++Y++   R+ R +++LK K L   D  KK  E+Q +L DFAKLY+VI+ ERNKC NLI T T +++EMREKI+IL NEIEILR+ +  KD+ +QK R K +  +  RDSL++E SK+     + +EKR +++L+I +LN+L N+AEE MV LRK+ + ++Q RND  +QLIERNEEVC+  EK N ++ +I  G+ E++ R +EI F+K  + E++R I +  K   NK   + E+V  +IQL   RDRLA+LE E E+P  E R++ L+G DP P  L  K EEL ++L  KEE  +EK+L+ E V+RLA+  +NK  + + DT++LAK +N Y+ ++    +K+ A  +EL+MN +  L+LQQ VK KE  +++ + ++E     SE     ++  ++ +E    +  Q          Y+L  G  TTA+PRPNAY+P+++T+LPIPRPYG+ APF+P+EPGS MRHIRK  +KPIEI
Sbjct:   71 LKSTREQESSLLHNAKELHQEVQRQRAELEKGDNFPDGENNEVNKLRQELLKHHNELAQADERQYQLEFKLEGLKEEKMMLEREYGRMP--KAGEIEKQL----KEVNKSVEDLKIEIAQRTVETKSLREELENRQKLVDELHKEVEGDLEKQQTLRDELVQVHSQPAHISKQIDLISRQYKDVEDKRKGLDGDIEEIVKELQRLDGRRTYLEDEKMELSEALDRQR--HTYESKEREVDVLIKEYELAKERQAEFMGDRGTLDLNLKHAAIEKKTQHDVHARKTREKERDLKSLKKSELQLKVGEDALAHVKSIYDKVKSQVESAPRDDGTLLDKRKELQREVDVTKRTLAQQNALTSRERARVEQMIQEEERLLMEQSELRVDVIDLTRLAQIKADEREQKARDYMRAELRYQRALEDLKTKNLNIQDSAKKYAEMQHRLSDFAKLYDVIKNERNKCVNLIQTSTQKAAEMREKIKILQNEIEILRSKVNAKDRLLQKARLKRSNAVVIRDSLRNEASKQGKQDEESREKREQLRLDIAKLNELINKAEENMVQLRKRYETSVQERNDMGIQLIERNEEVCVFYEKLNIQDTMIRNGDVELKAREEEIRFLKMELNEIRRGIGLANKNMPNKRALDNELVTLQIQLAAARDRLADLEKELEDPSNEERVRLLSGADPEPDILAKKIEELELRLAEKEEKLLEKDLIFEEVTRLADRTKNKAETGKEDTLELAKKVNEYQAKIKDTTRKMMAMVSELSMNQANALKLQQVVKGKEQEVEQAYIRMERGEAPSEEAEREWQRMIRDEERREVDNIQAMQREEEEEHYRLPGGIYTTAEPRPNAYIPDDDTELPIPRPYGSLAPFKPTEPGSTMRHIRKPIIKPIEI 948          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Nematostella
Match: EDO42722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S4])

HSP 1 Score: 52.7582 bits (125), Expect = 6.153e-8
Identity = 43/154 (27.92%), Postives = 85/154 (55.19%), Query Frame = 3
Query: 1797 RDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENP 2258
            +D+L++E+ +     ++ K    + + E  +L ++ ++A+   +  +K+ D  +  R+    QL+ RN+E+ +L EK   ++  ++ GE + + R+++I  +K  IK+L+R+  IL K   N     REV +++ +L   R R   LE E ENP
Sbjct:    5 KDALKAELQRMKQQAAESKAYIEQQEAEERKLLKIISEADAERMRQKKELDQVIGERDILGTQLVRRNDELALLYEKIKIQQSTLNKGEIQYRQRLEDIRLLKLEIKKLRREKNILTKNVANVEDLRREVYHHQRELLRERTRCKALEEELENP 158          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Medaka
Match: ccdc146 (coiled-coil domain containing 146 [Source:NCBI gene;Acc:101166596])

HSP 1 Score: 124.02 bits (310), Expect = 1.589e-28
Identity = 75/220 (34.09%), Postives = 123/220 (55.91%), Query Frame = 3
Query: 2250 ENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIENDSEFGITSY-----------------KLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRK 2858
            E+ + E    +L  + PS +EL  K E+L   L  +E   +EKELL+E V+RL   L  +  + + D++ LAK LN  +  +    +++ A +AEL++  ++    QQ++K KE  +++   ++E     G++ +                 +   + +E ++ E     L +GK TTA  RPNAY+PEN+T LP+P+PYGA APF+PS+PG+NMRH  K
Sbjct:  546 ESVNREADFTELKSKVPSSVELVKKMEQLEGNLAERERQLLEKELLVEQVTRLTKPLGEQAENYQQDSLSLAKRLNEVRTHLIDTNQRIMAVSAELSVKQADASCEQQQIKEKEVQMEQCQRRLEQ----GLSPHPEIEEEWKRRLRDKRRRQKDKEEKEKLAGEDKWRHLQSGKRTTANIRPNAYIPENDT-LPLPKPYGAMAPFKPSQPGANMRHFAK 760          
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Medaka
Match: cfap58 (cilia and flagella associated protein 58 [Source:NCBI gene;Acc:101173115])

HSP 1 Score: 54.299 bits (129), Expect = 6.168e-7
Identity = 82/318 (25.79%), Postives = 154/318 (48.43%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAE-NPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSE 2555
            L   +  ERN  +  I       +E++ +IR L+N++  L+  +  K +     +++   +    ++L+ E+    + L + K+  +  + E   L+++ +  +     L+ Q       R+    QL+ RN+E  +L EK   ++ I++ G+   + R+++I  +K  IK L+ +   + +T  N  +  +E+++  +Q E+ R+R+     E +  P    R ++L G DP    L  K + L  +LI K +   E+ELLL+   +L  EL  K +  R    + A+ L  Y+F +    KKLK  TAEL M  SE
Sbjct:  476 LLESVMSERNLYSKSIAEAQDEITELKRRIRTLSNQVSRLKEEISIKHQDCASSQAEHKRLDKENENLREELQSMKLQLEETKKHFDSQRAEQQNLHKIISDNDSEYTRLKGQLQQVTGERDSLGKQLLHRNDERSLLYEKIRIQQSILAKGDFHYKQRLEDIRLLKLEIKRLQCKKSRMDRTMPNTEELRQELIH--LQKELIRERVRNSALEEQLKPINIHRWRQLEGGDPGKYLLIQKIQCLQKRLITKTQELEEQELLLQEKEKLYVEL--KTMLARRPGPEAAEQLWQYEFTLRDRSKKLKVLTAELRMLDSE 789          
BLAST of coiled-coil domain-containing protein 146 vs. Planmine SMEST
Match: SMESG000006416.1 (SMESG000006416.1)

HSP 1 Score: 1606.27 bits (4158), Expect = 0.000e+0
Identity = 860/873 (98.51%), Postives = 866/873 (99.20%), Query Frame = 3
Query:  264 KSYLIKVQLLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIENDSEFGITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 2882
            K + +  QLLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSANLRKL+DDLLKNNMEKEELINISK DYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMK LKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELKFKEYIEKKRKEIEHRKKLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYEKKKKEIQLKLEDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMD+IDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLI+KEECFMEKELLLEAVSRLANELQNKVLS+RVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKE SLKELHYKIENDSEFGITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI
Sbjct:   99 KRFFLLCQLLEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDNLNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSANLRKLSDDLLKNNMEKEELINISKLDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKGLKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELKFKEYIEKKRKEIEHRKKLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYEKKKKEIQLKLEDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDKIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIYKEECFMEKELLLEAVSRLANELQNKVLSSRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKEYSLKELHYKIENDSEFGITSYKLPMKIQELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPSEPGSNMRHIRKQKLKPIEI 971          

HSP 2 Score: 155.992 bits (393), Expect = 1.666e-38
Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 2
Query:   74 LGKRVLDKAPSFANENDGLGDYLNSPYSEEYLFEEITAAQPSHQNNSDIEAITASESLAFQCLEELFNKGSIT 292
            LGKRVLDKAPSFANENDGLGDYLNSPYSEEYLFEEITAAQPSHQNNSDIEAITASESLAFQCLEELFNKGSIT
Sbjct:   18 LGKRVLDKAPSFANENDGLGDYLNSPYSEEYLFEEITAAQPSHQNNSDIEAITASESLAFQCLEELFNKGSIT 90          
BLAST of coiled-coil domain-containing protein 146 vs. Planmine SMEST
Match: SMESG000069791.1 (SMESG000069791.1)

HSP 1 Score: 226.868 bits (577), Expect = 1.453e-61
Identity = 236/792 (29.80%), Postives = 430/792 (54.29%), Query Frame = 3
Query:  291 LEKSRENEFNLLQLSKKWTIKVEKENFILDQANDFPGDSNTEVSKMRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKEIKTKLTDSINELKKEISDLKLKQKE-NIEISKLNEEIFQ-TKSDEFSAICDN-LNATKLRLVEN----------NSQM-NQYAKAIEKIRKETSEQDEIKRAANEQSAXXXXXXXXXXXXXMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKETELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKSNEESLESLNVLHLKAEADLNLFPKPELXXXXXXXXXXXXXXXXXXLFDVQNTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKAKEYIQKNKRFNRVIDELKEKYLAQLDYXXXXXXXXXXXXDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDRLAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTMNMSECLQLQQEVKNKECSLKELHYKIE 2624
            L K+R+NE++LLQ+SK++   +E +   L +++ FP + +T VS++R   L+  N  +A  +R+E L YK+  L  EKK+L+ E  R P  +   ++ +  D I  + +    L L+ +E  IEI KL  E ++ T++   S   +N +   K+ +VE            SQ+  QY+K  EK+R+  +E ++      E+  NL KL+D+L ++ ++++    + K      + +      + DEI K L + RE E   + DK   +L +++  + K++  +      K K+K +KALK A LQL  + E L     +  K       FPK +  + +   K   E+ + K + + + T   V  +K+ Q++ E +R LY+L++ R E +E+ +LA   A++RE  A ++++  +R+ +++DEL+ K    LD +K+ + ++ +    A+LY+ I+MERNKC  L+        E +EK+++  NE  I+   L  ++K +   + +++ II  RD+ ++E+ K + +   Q  KR  ++L I RLN + N+ E  ++  +K  +  +  RN+RA+QLIERNE+V IL E+   ++      + E+Q  ++ I+ +++   EL   IE++ K    + Q +++      +  I ++   EL    E+P    R++ L G D     LQ K   +  +LI+KEE  +EK+LL EAVSRL +++Q + +  + DT+ +AK++N+ K ++  I K LK KTAELT+ ++E  +L+ +V      L E + ++E
Sbjct:   69 LTKTRDNEYDLLQMSKRFIGVLEVQIAELGKSDQFPENISTVVSRLRCDYLRTENTLMATNERVEKLTYKMELLNAEKKLLQREYSRMPKAELDNLEDE--DIIEAMHRRTKTLTLENQEFTIEIDKLKRERYKLTENLRISLEQENEIKEVKIEVVELIEKTDSDLFLTSQLPGQYSKETEKLRRYKAESEKELVHCCEELENLTKLSDELAQHCLDQQNETAVIKSKLIAEKKEKHEKSKQTDEIIKNLNLSRELELNFRTDKATQELALQNNANIKREYLESQTKLGKDKEKFLKALKTATLQLNISNEGLYQSKQIFEKVYNKYMSFPKDDSTWFDKRNKLDDEVTNIKVMMEEEATKESVIASKVQQAVSEADRKLYNLNNYRSETVEMVKLATKIAEKRENAANDFLRAERRYKKILDELELKTQTILDQKKELENLEARASVVARLYSDIKMERNKCVALLQLTNQTHLEHKEKLKLRYNEKGIIIKKLNDREKSIIFLKKEISGIIIIRDTARNEICKVSAIRIDQNYKREVMRLTIQRLNNMFNKIEADVIQTKKLTEKNILFRNERAMQLIERNEDVYILDERTKIQDSRYRNAQIELQSLIERINCLRRYRNELVHLIELVHKKVPYQKQLQKDYKKLFNEFNIAKETCNELIKNVEDPYAPGRLRFLEGRDLDSENLQKKVNIVESRLINKEEELLEKDLLYEAVSRLVDQVQLRSVIGKNDTIKVAKSINHIKSRIMDIEKHLKVKTAELTIKITEVNKLEMQVDKNNRELNEQYGRME 858          
BLAST of coiled-coil domain-containing protein 146 vs. Planmine SMEST
Match: SMESG000061980.1 (SMESG000061980.1)

HSP 1 Score: 106.686 bits (265), Expect = 3.551e-23
Identity = 95/318 (29.87%), Postives = 174/318 (54.72%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQL---EINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDR--LAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTM 2543
            LY  ++ +RN+ +  +       +EM+ K++I+N++I+ LR  +  K+  + K++++  ++   +D L SE+ +   L S+  E +  I+    E  +L ++  +A+   V  +K+ +  +  R+    QL+ +N+E+ +L EK   ++ I++ GE +   R+D+I  +K  IK+L+R+  IL+K+  N +  +REV  Y +Q E+ R+R     LE E ENP    R +KL G DPS  E+  K + L  +LI K E  +EKE+L++   +L  EL  K +  R    ++A+ L  Y+  +    K+LK   +E  M
Sbjct:  497 LYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVKEKAEKQKVEKEKDQLNSELQR---LRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQRLDDIRLLKLEIKKLRREKNILQKSVANVDDLKREV--YHLQRELLRERTRCKALEEELENPMNVHRWRKLEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVEL--KHILARQPGPEVAEQLAMYQITLKQKNKQLKTLVSETNM 807          
BLAST of coiled-coil domain-containing protein 146 vs. Planmine SMEST
Match: SMESG000061980.1 (SMESG000061980.1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.877e-20
Identity = 95/333 (28.53%), Postives = 174/333 (52.25%), Query Frame = 3
Query: 1605 LYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEI---QLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRD--RLAELEFEAENPDLETRIKKL---------------NGEDPSPIELQSKFEELHIKLIHKEECFMEKELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAKTAELTM 2543
            LY  ++ +RN+ +  +       +EM+ K++I+N++I+ LR  +  K+  + K++++  ++   +D L SE+ +   L S+  E +  I   + E  +L ++  +A+   V  +K+ +  +  R+    QL+ +N+E+ +L EK   ++ I++ GE +   R+D+I  +K  IK+L+R+  IL+K+  N +  +REV  Y +Q E+ R+  R   LE E ENP    R +KL                G DPS  E+  K + L  +LI K E  +EKE+L++   +L  EL  K +  R    ++A+ L  Y+  +    K+LK   +E  M
Sbjct:  497 LYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVKEKAEKQKVEKEKDQLNSELQR---LRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQRLDDIRLLKLEIKKLRREKNILQKSVANVDDLKREV--YHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVEL--KHILARQPGPEVAEQLAMYQITLKQKNKQLKTLVSETNM 822          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC1461.272e-10632.71coiled-coil domain containing 146 [Source:HGNC Sym... [more]
CFAP584.096e-1426.20cilia and flagella associated protein 58 [Source:H... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ORY7.157e-624.51gene:FBgn0046323 transcript:FBtr0346720[more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ccdc1465.322e-5237.85coiled-coil domain containing 146 [Source:ZFIN;Acc... [more]
cfap581.164e-2230.15cilia and flagella associated protein 58 [Source:Z... [more]
cfap582.337e-2230.15cilia and flagella associated protein 58 [Source:Z... [more]
ccdc1466.493e-632.23coiled-coil domain containing 146 [Source:ZFIN;Acc... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CCDC1461.720e-13836.96coiled-coil domain containing 146 [Source:NCBI gen... [more]
CCDC1462.775e-13836.43coiled-coil domain containing 146 [Source:NCBI gen... [more]
CCDC1461.499e-13535.77coiled-coil domain containing 146 [Source:NCBI gen... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccdc1464.886e-9435.02coiled-coil domain containing 146 [Source:MGI Symb... [more]
Cfap588.726e-1827.66cilia and flagella associated protein 58 [Source:M... [more]
Ccdc1461.529e-934.88coiled-coil domain containing 146 [Source:MGI Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IYE0|CC146_HUMAN6.106e-10632.71Coiled-coil domain-containing protein 146 OS=Homo ... [more]
sp|Q66H60|CC146_RAT2.518e-10532.52Coiled-coil domain-containing protein 146 OS=Rattu... [more]
sp|A8HUA1|CFA58_CHLRE5.702e-2327.36Cilia- and flagella-associated protein 58 OS=Chlam... [more]
sp|B2RW38|CFA58_MOUSE6.104e-1727.66Cilia- and flagella-associated protein 58 OS=Mus m... [more]
sp|Q5T655|CFA58_HUMAN1.967e-1326.20Cilia- and flagella-associated protein 58 OS=Homo ... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HBW20.000e+040.41coiled-coil domain-containing protein 146 OS=Lingu... [more]
A0A2C9KBR07.463e-17640.34Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A267EK694.014e-17339.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FZ877.851e-17339.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A433SM353.565e-17140.22Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccdc1461.610e-9932.69coiled-coil domain containing 146 [Source:ZFIN;Acc... [more]
ccdc1468.601e-9236.06coiled-coil domain containing 146 [Source:ZFIN;Acc... [more]
ccdc1464.119e-7030.79coiled-coil domain containing 146 [Source:ZFIN;Acc... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005509.13.045e-9930.11pep scaffold:Pmarinus_7.0:GL476755:198637:219471:-... [more]
ENSPMAT00000005099.11.229e-2127.81pep scaffold:Pmarinus_7.0:GL476392:969020:986502:-... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO496711.618e-17038.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427226.153e-827.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc1461.589e-2834.09coiled-coil domain containing 146 [Source:NCBI gen... [more]
cfap586.168e-725.79cilia and flagella associated protein 58 [Source:N... [more]
back to top
BLAST of coiled-coil domain-containing protein 146 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000006416.11.666e-3898.51SMESG000006416.1[more]
SMESG000069791.11.453e-6129.80SMESG000069791.1[more]
SMESG000061980.13.551e-2329.87SMESG000061980.1[more]
SMESG000061980.12.877e-2028.53SMESG000061980.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009251 ID=SMED30009251|Name=coiled-coil domain-containing protein 146|organism=Schmidtea mediterranea sexual|type=transcript|length=2928bp
ATCTTCGTGCATTTTTAATATTATGTCAGAAAATTCTTCTAGCGAGGAAG
ACAATAACATTATCAATGAAAATTTAGGAAAAAGAGTTTTAGATAAAGCC
CCTTCTTTTGCTAATGAAAATGATGGCCTTGGAGACTATTTAAATTCACC
CTATTCTGAGGAATATTTGTTTGAAGAAATTACTGCAGCTCAGCCATCAC
ATCAAAATAATTCTGACATAGAAGCTATTACTGCTTCAGAAAGCTTAGCT
TTTCAATGTTTAGAAGAGTTATTTAATAAAGGTTCAATTACTTGAAAAAA
GTCGAGAAAATGAATTCAATCTACTTCAGCTATCAAAGAAATGGACAATT
AAAGTGGAAAAAGAGAATTTTATATTGGATCAAGCCAATGATTTTCCCGG
TGATAGCAATACTGAAGTTTCTAAAATGAGACAATCACTTCTAAAATTTC
ATAATGATCAATTAGCAATTGAGGATCGACTAGAAACTCTCAATTACAAG
ATATCAAGTCTTGAAGGGGAGAAAAAAATGTTGGAAAATGAGCTCCATCG
TTCTCCAGGATTAAAGGAGAAAGAAATTAAAACAAAACTCACTGATTCAA
TAAATGAGTTAAAAAAGGAAATTTCGGATTTAAAATTGAAACAGAAAGAA
AATATTGAAATTTCTAAATTAAACGAGGAAATCTTTCAAACTAAAAGTGA
TGAATTCAGTGCAATATGTGACAATTTGAATGCTACAAAACTAAGGTTGG
TCGAAAACAATTCACAAATGAACCAATATGCAAAAGCAATTGAAAAAATC
AGAAAAGAAACAAGTGAGCAAGATGAAATTAAAAGAGCTGCTAATGAACA
GTCCGCTAATTTGCGTAAACTAAATGATGATTTGCTAAAAAACAATATGG
AGAAAGAAGAACTTATTAATATATCGAAATTTGATTACAATAAAATTCAA
GGTCAATATATATCAATACAATCAGAATTAGATGAAATAAAAAAACAATT
GGAAATATACAGAGAAAAAGAAACAGAACTACAGCTGGATAAGGTAAAAC
TTGATTTAGATATCAAACATATGAATTCAGAAAAACAAAAATCTCGTGAT
GACGTCAATAGTAAAACTAAAGCTAAAGATAAAGTTATGAAAGCTCTTAA
AGAAGCATTACTTCAACTAAAAAGTAATGAGGAAAGTCTCGAATCTTTGA
ATGTTTTACATCTAAAAGCGGAAGCTGATTTGAATTTATTTCCGAAACCA
GAATTAAAATTTAAAGAATACATCGAAAAGAAAAGAAAAGAAATCGAGCA
CCGTAAAAAGCTTTTTGACGTCCAAAATACATACTCTGAAGTTGAAAAGG
CCAAGTTAACACAAAGTATCCAAGAAGAAGAAAGGCTTCTTTATGATCTG
AGCGATTCACGTATAGAAGTTATTGAATTGAATAGATTGGCTCAAATTAA
AGCCGATGAAAGAGAGCAAAAAGCTAAAGAGTATATTCAAAAAAATAAAA
GATTTAATCGAGTCATAGATGAATTGAAAGAAAAATATTTAGCACAGCTT
GATTATGAAAAAAAGAAAAAGGAAATTCAGTTAAAACTTGAAGACTTTGC
AAAATTGTACAATGTGATTCAAATGGAACGAAACAAATGTGCAAATTTGA
TAAACACTGTTACTCATAGGAGTTCAGAAATGAGAGAGAAAATAAGAATC
TTGAATAATGAAATAGAAATTCTCCGTACCAATTTAGTACAAAAGGATAA
ATATGTACAGAAGCAAAGAAGCAAATTGACAGAAATCATTGCAACAAGAG
ATTCTTTGCAATCGGAAGTTTCTAAAAAGAATATGTTATTGTCAAAGCAA
AAAGAAAAAAGAAATGAGATTCAACTGGAAATAAATAGACTCAACCAATT
AGGTAATCAAGCAGAAGAAACTATGGTACTTCTTCGTAAGCAGAACGATT
TGGCTTTGCAAAATAGAAACGACAGAGCTCTACAACTAATCGAACGCAAT
GAAGAAGTCTGCATTCTACAGGAAAAATTCAACTTCAAAGAAGAAATAAT
AAGTGCTGGTGAAAAGGAAATTCAAATCAGAATGGATGAAATAGATTTTA
TGAAACAAAACATAAAAGAACTGAAAAGACAAATTGAAATATTAAGAAAA
ACTTCAATGAATAAAAACCAGTTTGAAAGAGAAGTTGTAAATTACAAGAT
TCAACTCGAGATTTGCCGTGATCGTTTGGCAGAGCTAGAATTTGAAGCTG
AAAATCCAGATTTGGAAACCAGAATTAAAAAGTTAAATGGTGAAGATCCA
TCTCCTATAGAGTTGCAATCAAAATTCGAAGAATTACATATCAAGTTGAT
TCACAAAGAAGAATGTTTTATGGAAAAAGAATTATTATTGGAAGCAGTAT
CCAGACTAGCAAATGAACTACAAAACAAGGTATTATCAACCAGGGTGGAT
ACTGTTGACCTTGCAAAAACATTGAACAACTATAAATTTCAAATGGGCCT
CATTATAAAAAAGCTCAAAGCTAAAACGGCAGAATTAACCATGAATATGT
CTGAATGTTTACAATTGCAACAGGAAGTCAAAAATAAAGAATGTTCTCTT
AAAGAGTTACATTACAAAATTGAAAATGACTCCGAATTTGGTATCACTAG
TTACAAATTACCTATGAAAATTCAAGAATTAATCAGTTATGAAGGTCATC
AGTATCAATTAACCAATGGGAAATTGACTACAGCGCAGCCAAGGCCGAAT
GCCTACATGCCAGAAAACGAAACTGATTTACCGATACCGAGACCCTACGG
AGCTCATGCTCCATTCCAACCGTCAGAACCTGGGTCGAATATGAGACACA
TACGGAAACAGAAATTAAAACCAATCGAAATTTAAATAAATTTCAAAAAA
TACTAAATTATTTATTATAAAATTTTAC
back to top

protein sequence of SMED30009251-orf-1

>SMED30009251-orf-1 ID=SMED30009251-orf-1|Name=SMED30009251-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=820bp
MRQSLLKFHNDQLAIEDRLETLNYKISSLEGEKKMLENELHRSPGLKEKE
IKTKLTDSINELKKEISDLKLKQKENIEISKLNEEIFQTKSDEFSAICDN
LNATKLRLVENNSQMNQYAKAIEKIRKETSEQDEIKRAANEQSANLRKLN
DDLLKNNMEKEELINISKFDYNKIQGQYISIQSELDEIKKQLEIYREKET
ELQLDKVKLDLDIKHMNSEKQKSRDDVNSKTKAKDKVMKALKEALLQLKS
NEESLESLNVLHLKAEADLNLFPKPELKFKEYIEKKRKEIEHRKKLFDVQ
NTYSEVEKAKLTQSIQEEERLLYDLSDSRIEVIELNRLAQIKADEREQKA
KEYIQKNKRFNRVIDELKEKYLAQLDYEKKKKEIQLKLEDFAKLYNVIQM
ERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSK
LTEIIATRDSLQSEVSKKNMLLSKQKEKRNEIQLEINRLNQLGNQAEETM
VLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQ
IRMDEIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRDR
LAELEFEAENPDLETRIKKLNGEDPSPIELQSKFEELHIKLIHKEECFME
KELLLEAVSRLANELQNKVLSTRVDTVDLAKTLNNYKFQMGLIIKKLKAK
TAELTMNMSECLQLQQEVKNKECSLKELHYKIENDSEFGITSYKLPMKIQ
ELISYEGHQYQLTNGKLTTAQPRPNAYMPENETDLPIPRPYGAHAPFQPS
EPGSNMRHIRKQKLKPIEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005814centriole
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 52..72
NoneNo IPR availableCOILSCoilCoilcoord: 350..370
NoneNo IPR availableCOILSCoilCoilcoord: 580..607
NoneNo IPR availableCOILSCoilCoilcoord: 472..506
NoneNo IPR availableCOILSCoilCoilcoord: 19..39
NoneNo IPR availableCOILSCoilCoilcoord: 171..205
NoneNo IPR availableCOILSCoilCoilcoord: 108..128
NoneNo IPR availableCOILSCoilCoilcoord: 549..576
NoneNo IPR availableCOILSCoilCoilcoord: 132..152
NoneNo IPR availableCOILSCoilCoilcoord: 238..261
NoneNo IPR availableCOILSCoilCoilcoord: 416..436
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 795..819
NoneNo IPR availablePANTHERPTHR32083:SF34COILED-COIL DOMAIN-CONTAINING PROTEIN 146coord: 1..819
NoneNo IPR availablePANTHERPTHR32083FAMILY NOT NAMEDcoord: 1..819