Transmembrane protein

Overview
NameTransmembrane protein
Smed IDSMED30009231
Length (bp)6957
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein (SMED30009231) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein (SMED30009231) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein (SMED30009231) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein (SMED30009231) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009231

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009231SMESG000002927.1 SmedASXL_017365SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30009231SMESG000002927.1 SmedASXL_017364SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009231SMESG000002927.1 dd_Smed_v4_16643_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009231SMESG000002927.1 dd_Smed_v4_12002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009231SMESG000002927.1 dd_Smed_v4_12002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009231SMESG000002927.1 dd_Smed_v4_12002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009231SMESG000002927.1 dd_Smed_v6_12002_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30009231SMESG000002927.1 Contig31704newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009231SMESG000002927.1 Contig31704uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
ciliated epithelial cellSMED30009231SMESG000002927.1 dd_Smed_v4_16643_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009231SMESG000002927.1 dd_Smed_v4_12002_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30009231SMESG000002927.1 dd_Smed_v4_12002_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30009231SMESG000002927.1 gnl|ti|1389002978_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30009231SMESG000002927.1 gnl|ti|1374062647_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein vs. Ensembl Zebrafish
Match: si:ch73-242m19.1 (si:ch73-242m19.1 [Source:ZFIN;Acc:ZDB-GENE-131121-474])

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 551/1909 (28.86%), Postives = 976/1909 (51.13%), Query Frame = 3
Query:  903 LPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSN------PTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGR-IHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQ-----DFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFS--GTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNE---EIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSI--INQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLM---RNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKE-LTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTP 6560
            LPL + +L   +  L    + Y +E +   I+++ADEMEL + V   F+T F  QE+M IF  YD   +   ++G  +    + K A+W+P+I++KPK      K + +L+    +DELL+  +  +  ++  +V DAL+     V  P     A+ +      + S++++ IY    +   +       P   D        +     QT      +   +  DD   V+GA+ S + LRHL+IR+L+R CLS+LNY RSVERT+V++  GL     VG    +N      I   +   G + SH +++NTP ++++   +FM+F EVEN  D+Y   DGR IH +DQ G +I+YDVA+ D E+LE +LLL AS FI K+  L ++   + + QRL             A  +VDR  VL D+WT     LE K ++L+ Y+EAY +  + +E+  ++Q + ++M+++P++D  + YFV +YR     L+    + + +LN QID QR+Y++ I  + Q     ++GLP   + K L+++      LK++YFLE H SL + C + E LE    E+    +    +  + LE+K+ +       ++ S GV+Y+PQ+QRDLF   FIE+P ++  L   Y+        R   + R++ ++  F  L E++TLR R+ ++  E+E L+++Y+  +  +G+DE HLY+R +QF            +  ++++ +QD+    D+F P++LPLA+ E+DE  + KFSF+ + +V++++    VENL +VL  Q+  +NAL   +   + C       +   LD  + +DL+ +   +  + +                    R  + + K+    AF SIQLEK   RD  +N +IKK    G+ K +  +V ++KR L++ +   F +R+ +  +R Q+I    S++ +L+ VP + ++ F  G    K  DP  ++  E     DPR  +   RR+LS +G   LNLWFIPH+TE+L ++R   ++   + L+N + I+   HDI+++LV F+RL  S                DS+    S+Q +                   D G +  +  EL ++  QI  L + +  ++V  LL   R+V FL+F+  + + + + FL++ N+ A+++++ NM      ++++      +  L+VP+PLEA   +A++LYP+RS   I+ L P L+M D    I+  +QL L  L+D  R   +G  + ++L ++DVL+ G     R    L M   ++          K   +  L+  D + N        KK   +      ++ +   + +++L K++ + K  W  R+   + I  P  F  F+++Y++E  +P M++L  Q  + +  +Q   + T   + P G  E+ +K  QL +++E  E  MI  L+ RI  +   VM ER+R +  +P DLWK+P+ K ++S++RP I EDF+  LM     + E+      +TF+  HL  CL  L+ +V++ +K  ++ Y+ +YE+ L+ Q QLLY RE+++++++ + LQ       D   +++D    ++LE+ ALRAKV ++ E+    +Q +  + R+ Y+++V  LFS     K ++D Y E +     + I  VR E    + K+K +      ADD  +  +    KE L  L  +N  L  ++ +++    W     +   QK +     +    K     V++ SEQK  +  +ELD +K  L   + E   ++K +  + ++  D +H + R A + +++  ++   ++ L  ++ ++ S + T+S  L ++    +    +S R +  +R  L +ER +K  AF  VD L +Q+  +EAA    K   P
Sbjct:   39 LPLLSTNLEDFKVQLDFLLSHYDVEYNTNSIKTTADEMELISLVLYVFRTVFKQQEEMKIFLQYDSTEATDRRFGRKSPNMTLRKQASWIPHIQMKPKRDPWQQKQMAKLKELRLMDELLQMHSSLLEDSDLHKVTDALKQLITSVCQP----EASSLK-----DTSDVWRNIYNTANMLQVTTGQMIRLPKYADQRPSERKSEG--CGQTQSACVFEKDEDAVDDSVMVRGAFESLIFLRHLRIRELKRVCLSLLNYLRSVERTLVMDGAGL---ESVGGDLVRNMEETGWIYAVRKDDGALNSHHFIYNTPVDYKVRCAEFMEFPEVENLHDYY-STDGRFIHTQDQRGLYIVYDVALKDLEELEQNLLLTASHFILKSTDLHTSCGSEEELQRL-------------ARTDVDRIAVLLDLWTCEADFLEHKIQLLNCYLEAYQHVTDPEEQFRLAQVITDIMHRRPQMDFTAGYFVQSYRDSIVCLQSHQQLIKLVLNNQIDEQRQYLQRIWRDGQKGSPSEYGLPPNYIPKHLVSIGGSRPALKSVYFLEIHPSLGLACQLYEGLERACTELFELHRAKAPSQRVKLEQKLLKTALHHWHTLTSPGVTYSPQIQRDLFLDVFIEDPALVRDLG-LYIVRCADEQERKQGKDRQMFMLETFCTLLELVTLRHRIFESAAETEHLSQLYKSLSRVIGFDEVHLYMRLVQF--EFAVRKETPKQLPVFLTALQDNRQEADRFIPNSLPLAVQELDENHICKFSFRSKEAVLQLMNEASVENLRVVLMCQVVQRNALIGALKQASVC------FRTEKLDQSSDSDLKLQHEESASSTT--------------------RRRAVDDKNRFAGAFVSIQLEKVSLRDEMLNTFIKKKEQMGSLKMNSEDVCRIKRKLIVDFCHRFNERVCECFVRGQLISLTFSLLSLLREVPHIRDQHFIMG----KPEDPRADLQAEGRPSPDPRTFQPCPRRLLSADGKSLLNLWFIPHYTEVLLMFRTLKEKERQQALQNSLQIMSALHDIVYYLVSFARLGNS----------------DSLCSRSSTQKLTA-----------------DWGGLESIGAELWDVQRQIESLCESSSSESVGRLLQLHRDVLFLRFDTAVRYMIRDAFLSSGNLSAYQSMTENMSHALPIMSDM--IVGGANLLSVPQPLEAASSQAQKLYPWRSFLAIHGLHP-LVMWDV-SPIEHYMQLCLCDLNDRCRMEANGAILGVSLIMDDVLSSG-----RDAMPLQMQTTDD---------NKSTSDRELLD-DGMAN------NKKKAECVCQAEDAFQSLLKQKGFLLLWKQMEVFKESWTQRQTSFKTINTPALFKHFSQLYRVEIFFPSMQALAQQMDV-EKEYQILLSQTQTVLPPPGAAEVDIKAWQLLRLLEMTEVDMIRALQNRINTEMTLVMSERSRHDMQIPADLWKRPSAKHSVSLERPQIVEDFIQRLM-----SAEERQTDGQVTFSTAHLQDCLTELSCAVMNREKSVFQRYSQFYEHILQQQEQLLYQREQDVKELEAKNLQSS-----DPYRKVSDVCRGMMLEITALRAKVNQLEEEKRNLDQHLNLKHRERYDTLVHQLFSSCLLLKARLDSYNEKMDHDVRQLISSVRKEGVDRIIKLKTRLSP---ADDNQSLIHTLQQKELLEDLDGENSRLAALVCKLRIFSRWKLLTEQERIQKELLHWRLNEASCKTEAVKVKLISEQKEIVSRQELDAVKEALLQCQTEYEHIQKQITLQSQKLQDIEHRSARDAQSRQELQTLRMESVETLQEDVLDRESQLRTLSAQLQKHTHDTQIRQQRSHRHIRQVRGQLHQERSLKLEAFQHVDKLHNQIQNYEAALQ-CKSTVP 1813          
BLAST of Transmembrane protein vs. Ensembl Zebrafish
Match: ccdc162 (coiled-coil domain containing 162 [Source:ZFIN;Acc:ZDB-GENE-131121-612])

HSP 1 Score: 104.375 bits (259), Expect = 3.385e-25
Identity = 47/130 (36.15%), Postives = 87/130 (66.92%), Query Frame = 3
Query:   54 LEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYK 443
            LE  L ++I  L+++IE+  + + I SK  SS+++PKD  +FR +R+ +L + LQV+  +P+  QAEV + E+  C ++E+    +PLL+HQ++ D+  ++   KY  +LRW+R+  ++ ++E +YP+YK
Sbjct:   14 LEAELSAQIHSLRTEIEDKDISHQIFSKPYSSVHIPKDASYFRLERQRVLHKALQVSSTKPVVSQAEVAQREMEICLNQEHKADGLPLLLHQFYTDQTYKLARCKYLLMLRWRRFGRHSTVLEKLYPQYK 143          
BLAST of Transmembrane protein vs. Ensembl Xenopus
Match: ENSXETT00000038343.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:74887814:74921018:-1 gene:ENSXETG00000013821.1 transcript:ENSXETT00000038343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.424 bits (607), Expect = 4.613e-65
Identity = 213/791 (26.93%), Postives = 362/791 (45.76%), Query Frame = 3
Query: 4203 IEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKL----NMNDFE-NVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITH-PIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNT 6557
            +EI   I  L +P + K V  LL  RR V FL+FE  + + +       R V      SA M                                   LYP+R+ +   G + +       +  ++QL L  ++D +R   HGE V + L +ED+L   N   S          +++DF+ ++   G     +        PV +  +QP          ++ H PI  ++L+++++IL K+L + K  WG  KL +E I     +  F+++Y+ +  YP MK +  Q    +   +G    T + + PKG  E  ++  QL K++E  E  MI +++K+  ++   V  ER+RE  +LP +LWK+  MKE  S  RP I E FV  LM               +TF K+HL  CL++LA  V+  ++ ++E Y+M+YEN L  +HQLLY +E      +   L K L T        A+ +H LLLEV ALRAK++++ E+SL   +TIR+E+++E+ ++V++LF+     K++++ Y   +     + I  VR E   ++  +K+K G                +K+ +SL  QN                                +K+  K K SV        Q+V ++ ++L   +  LT T+ E + L + L          +H   ++    +Q    K   +D+L+ +I ++ S + T++     + +  +   +K  REV  +R  L +ER +K  AF +VD+L +QVY+ E  F+I   +T
Sbjct:   67 LEIQKSIDSLSNPQDPKEVASLLLLRREVIFLQFEAAVRYLI-------RYVLMGYITSAFM-----------------------------------LYPWRTFLANGGLFPLAISNLHTLGYHMQLCLCEMTDQERSVAHGELVGVKLLMEDILQSDNTLISFTIEDFQPDRHLDDFQPDIYWRGSWGGPE--------PVQSTCHQPI---------LVPHDPIGVFQLLKSFLILWKQLEMFKERWGKLKLQVEKINTVPLYKQFSELYRDDIFYPTMKVIARQMGKEE-EFEGITLRTQVVLPPKGASEAKIRICQLHKILEDIEIHMIHEVKKKTAKELTLVKTERSRE-ASLPTELWKQNVMKEHYSPVRPQIVEKFVQNLMSE-------------VTFRKDHLEDCLKSLACDVMARERSNFETYSMFYENLLHQEHQLLYQKE------QVGYLYKPLLT--------AEMSHELLLEVTALRAKLSDLEEESLSSRETIRKEIQEEHEALVRSLFAQCVYLKSKLEEYYINMKQHVSELISGVRKEGVDDIILLKKKYG---------------FTKDYSSLAAQN--------------------------------KKEGLKLKLSVA-------QEVTLLRQQLMVARTSLTRTQAENSHLNQQL------CNGLEHRYSQEMRNRQQAEREKSASVDKLLGDIQDRESRLRTVTEEAERSSRMGQMEQNKIKREVKQMRSQLIQERSLKLDAFHRVDELQTQVYDLE-MFSIRNSST 708          
BLAST of Transmembrane protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 683/2241 (30.48%), Postives = 1160/2241 (51.76%), Query Frame = 3
Query:   51 ILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHAL----LVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPT-----------KNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNG-----VGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMI--GDNVQ---DFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMD---SLGVS-------YTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIK--LINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCN----ACRPSLYTLKERDLDA---CNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYI--KKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQC-----YKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQ-QNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISR 6617
            +LE  L  ++ ELK+++E+  L  G  ++  SS+ +PKD  HFRR+R+  L+RTLQV + +P+ +QA+V++ EL SC  REYT +++PLL+ QY+ +RI ++  SKY H+LRWKR C  +  +E +YP YK+++ +IM E+ DS  R  RL+  RE  L       D +  +D+ IY RWL+CHL +L+ +    + +Q+ PI+     +A  V       S++  K         A   D       L AA   S  PL P         +G G    +    LP H  D + L+  L    + + I  DV  +  SA EM L++SV++ F++ F  Q++M  F  Y+      +   +   T  + K A+W+P++K+KPK      K +TRL+   +IDEL+   ++F+ +++  RV   L+ HA     +  + P    A  +  R   N  +++K IY N +L+   NP+            +D S    T   Y F   +Q+LGL D  E   +P  ++GAYLS+L LRHL IR+LQR CL +LN+FRSVERT+ +N  GL+L +G     +GD S+ N        G  G    +G+H Y+  TP E +++   F++F+E EN DDF+  + G +H +DQ G +++YD A+ D ++LE +LLLIAS +I K K+ R             E +S    +  +AH  VDRF VL+D+WT  T LLE K+++LD Y EAY +T + +ER  ++Q+M ++M+++P+ D+  +YF  AYR +CT LR+   + R +L+  ++ QR+Y++ +  GD+ +    FGLPL V+ K  ++++        ++ LE H SL +   + ++LE  F+E  +  K  + +           + Q+EI S+     L +S       Y+ Q+QR+LFS   + +P ++ ++    L  + S   +G K+ +     L++ F RL E++TLR RL++ + ES  LA +Y+  A+++G++E HL+LRP+ F      +      P ++I+++ +D S +D++ P++L LAI+E+D+  +GKFSF  + +++++    GVEN+ + L  Q   +NAL   +            SL  LKE   D       +  R +  TT G       P       TP       +  F      PEAF SIQLEK+  RD  +N ++  K+       S  +VEKVK++L++ Y      R+   SLR QI+ Y NS+  +L   PT+   FF  G   EKK   + +   +    R  + R R +LS +G  FLNLWFIPH +E+LF+++   +E     L   + +V + HDI+ +   F++L    A     L + N  + D                G  EGI                  EL E+   I  L  P +   V + L  RR VT L+F+  + H LL TFLA  N  A+++V+ +  +    L+N    +  S +L++P+PL+    +A  L+P+R+ +   GP+ ++      ++ ++Q+ L GLSD DR   HGE V + + +EDVL    L      RK +  +++  L          + + + +P    G  P+  + + K + +    QC       L+++++IL KRL +LK  WG  KL  + I +      F+++Y+ E LYP MK+L  Q    D   +       I + PKG  EI +K +QL K++E+ E  MI ++ +++ R+    + E+++EE  LP D WK   MKE  SV RP I E FV  LM+++  +  K      +TF +EHL  C+ +L   V+  ++ ++E Y+M YE+ L+H  Q L  +E+E++     LL++      D   Q+A+ +H +++E+ ALRA++ ++ E++L  +  IR+EV++EY  +VQ LF      K ++D  +  L     + I EVR E    + ++K+  G+    D+E  E   K  ++L +L Q  +  L  ++ + +SL  W     + + +  +++ E +    K     +++ +EQ+  ++ ++L   +  LT  + +   L +  D + +   + +H   + + T +Q+ ++K   +++L+ ++ +K   +  ++       K  +    K  R++  +R  L +ER +K  AF +V +L SQ+Y+ +  +  V+  +P+   +  +    S S +SR
Sbjct:   15 LLEKELAVKLSELKTEVEDQGLFPGTGNRIFSSVQIPKDVAHFRREREAALKRTLQVAESKPLVIQADVLKRELESCLRREYTPENLPLLLLQYYTERITQLGQSKYLHVLRWKRLCQTSMAMEELYPLYKKQVDYIMQEFNDSVQRAERLSVARENLLMGKNNRPDLVTQEDLAIYTRWLVCHLHALRTIHHFLQALQYLPISRVLSLAAKQVSGS----SEEDGK---------ACVTD-------LHAA---SPGPLGP-------HVSGSGRT--DAAFVLPQHVTDRDDLKPQLRRLLSHFHIPDDVQKLSDSAKEMGLFSSVSQNFQSIFMEQQRMWTFPDYEAGRGNVQNPTMSGPTTTLRKRADWIPFVKVKPKCDPWQKKMLTRLKERKRIDELMNLQSQFLKISDPVRVMQVLQDHAAKTVPMASNHPSRPPAQPLHPR---NYDQVWKNIYSNPKLYQAENPSDDDFAKPHLSQSSDGSLKQRTETGYNFAVALQLLGLSDGTEPDRNPVLMRGAYLSFLCLRHLHIRELQRICLGVLNFFRSVERTLTMNTSGLTLVSGTLVPTLGDSSWIN-----MSKGGMGTLQGLGTHHYIHGTPAEHKVHSIQFLEFSEAENQDDFHTTQAGYVHTQDQLGEYVVYDSALQDLKELESELLLIASHYIEKEKSHRG------------ECRSEGSQLLGWAHANVDRFAVLYDLWTCETNLLEGKRQLLDSYFEAYQHTLDPEERFALAQAMTDIMHRRPKFDLSHSYFTKAYRDDCTCLRLHLQLVRGILSHHLEQQRDYVQRLWRGDHPEAPKTFGLPLNVICKQFVSISNSCPASGKVHPLELHPSLGLAGLIPKALEHLFREARHAHKAASPS----------SLAQIEICSLQLALDLWLSPVKPEAWYSAQLQRELFSAQVMGDPFLMEEVG---LLALRSAVDKGVKQGQDFHTLLLDTFSRLLELLTLRHRLIETSVESAYLAGLYKELALEMGFEESHLHLRPVHF-EFASHKDKVDPPPPVFITSLLEDSSRVDRYCPTSLVLAISELDDNQIGKFSFHTKEAILKLFVHSGVENMQVTLACQTAQRNALMVAIQQAFFYHIPGAGSLVDLKETSSDPRHHGGVSPCRRDSRTTNGKECLLLTPTLK----TPDTF--THSSGFKTSKRAPEAFVSIQLEKAGLRDLMLNTFLHRKQTMMDQIKSPDDVEKVKKELIVEYCQKLNRRMSHYSLRGQIMAYCNSLRVLLDDFPTIRNTFFMVGQPNEKKGLKDSSGELKADSSRSFQPRPRSLLSADGRVFLNLWFIPHPSEVLFMFKSLPEEEAFRALTLTLQLVASLHDIVAYTFSFAKLGNCPACFDLPL-SPNPLMRD---------------WGGAEGI----------------GNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRH-LLRTFLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGPFPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVL----LGSCHVIRKAS-TEWQAAL-------DNAQPDWSKLP----GLYPNQLESHPKASALLEG-QCDVVMSLSLLKSFLILWKRLEVLKEHWGRFKLRGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSI-LPPKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDRWKHQVMKENFSVMRPQIVERFVQRLMEDSQDDGPK------ITFRREHLEACILSLGCDVMARERSNFETYSMCYEHILQHTRQKLSQKEQEVD-----LLRRSQVPSEDCAGQVAELSHDMIMEITALRAQLTDLEEENLNLKIQIRKEVQEEYRELVQALFLTCLRIKEKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGS-ARPDEETKENTAK--EQLCALEQDHSSTLAALLCKARSLGRWRLAVQQAHLRGQLSRAEMESILSKKECLRIKLMAEQEAALLHQQLLAARQALTKAQTDNRKLWRQNDTQAQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQLLTEEAERASKRGQLQQKKMDRDLKQMRNRLAQERSVKLDAFQRVQELQSQLYDIQ--WPSVQMGSPVGLRSQTHCSLSSASTLSR 2116          
BLAST of Transmembrane protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 332.798 bits (852), Expect = 1.148e-98
Identity = 202/584 (34.59%), Postives = 315/584 (53.94%), Query Frame = 3
Query:   51 ILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHAL----LVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPT-----------KNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNG-----VGDRSYQN 1742
            +LE  L  ++ ELK+++E+  L  G  ++  SS+ +PKD  HFRR+R+  L+RTLQV + +P+ +QA+V++ EL SC  REYT +++PLL+ QY+ +RI ++  SKY H+LRWKR C  +  +E +YP YK+++ +IM E+ DS  R  RL+  RE  L       D +  +D+ IY RWL+CHL +L+ +    + +Q+ PI+     +A  V       S++  K         A   D       L AA   S  PL P         +G G    +    LP H  D + L+  L    + + I  DV  +  SA EM L++SV++ F++ F  Q++M  F  Y+      +   +   T  + K A+W+P++K+KPK      K +TRL+   +IDEL+   ++F+ +++  RV   L+ HA     +  + P    A  +  R   N  +++K IY N +L+   NP+            +D S    T   Y F   +Q+LGL D  E   +P  ++GAYLS+L LRHL IR+LQR CL +LN+FRSVERT+ +N  GL+L +G     +GD S+ N
Sbjct:   15 LLEKELAVKLSELKTEVEDQGLFPGTGNRIFSSVQIPKDVAHFRREREAALKRTLQVAESKPLVIQADVLKRELESCLRREYTPENLPLLLLQYYTERITQLGQSKYLHVLRWKRLCQTSMAMEELYPLYKKQVDYIMQEFNDSVQRAERLSVARENLLMGKNNRPDLVTQEDLAIYTRWLVCHLHALRTIHHFLQALQYLPISRVLSLAAKQVSGS----SEEDGK---------ACVTD-------LHAA---SPGPLGP-------HVSGSGRT--DAAFVLPQHVTDRDDLKPQLRRLLSHFHIPDDVQKLSDSAKEMGLFSSVSQNFQSIFMEQQRMWTFPDYEAGRGNVQNPTMSGPTTTLRKRADWIPFVKVKPKCDPWQKKMLTRLKERKRIDELMNLQSQFLKISDPVRVMQVLQDHAAKTVPMASNHPSRPPAQPLHPR---NYDQVWKNIYSNPKLYQAENPSDDDFAKPHLSQSSDGSLKQRTETGYNFAVALQLLGLSDGTEPDRNPVLMRGAYLSFLCLRHLHIRELQRICLGVLNFFRSVERTLTMNTSGLTLVSGTLVPTLGDSSWIN 563          
BLAST of Transmembrane protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 313.923 bits (803), Expect = 5.208e-89
Identity = 226/826 (27.36%), Postives = 422/826 (51.09%), Query Frame = 3
Query: 4158 RDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQC-----YKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQ-QNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISR 6617
            RD+ G     +  EL E+   I  L  P +   V + L  RR VT L+F+  + H LL TFLA  N  A+++V+ +  +    L+N    +  S +L++P+PL+    +A  L+P+R+ +   GP+ ++      ++ ++Q+ L GLSD DR   HGE V + + +EDVL    L      RK +  +++  L          + + + +P    G  P+  + + K + +    QC       L+++++IL KRL +LK  WG  KL  + I +      F+++Y+ E LYP MK+L  Q    D   +       I + PKG  EI +K +QL K++E+ E  MI ++ +++ R+    + E+++EE  LP D WK   MKE  SV RP I E FV  LM+++  +  K      +TF +EHL  C+ +L   V+  ++ ++E Y+M YE+ L+H  Q L  +E+E++     LL++      D   Q+A+ +H +++E+ ALRA++ ++ E++L  +  IR+EV++EY  +VQ LF      K ++D  +  L     + I EVR E    + ++K+  G+    D+E  E   K  ++L +L Q  +  L  ++ + +SL  W     + + +  +++ E +    K     +++ +EQ+  ++ ++L   +  LT  + +   L +  D + +   + +H   + + T +Q+ ++K   +++L+ ++ +K   +  ++       K  +    K  R++  +R  L +ER +K  AF +V +L SQ+Y+ +  +  V+  +P+   +  +    S S +SR
Sbjct:   55 RDWGGA--EGIGNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRH-LLRTFLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGPFPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVL----LGSCHVIRKAS-TEWQAAL-------DNAQPDWSKLP----GLYPNQLESHPKASALLEG-QCDVVMSLSLLKSFLILWKRLEVLKEHWGRFKLRGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSI-LPPKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDRWKHQVMKENFSVMRPQIVERFVQRLMEDSQDDGPK------ITFRREHLEACILSLGCDVMARERSNFETYSMCYEHILQHTRQKLSQKEQEVD-----LLRRSQVPSEDCAGQVAELSHDMIMEITALRAQLTDLEEENLNLKIQIRKEVQEEYRELVQALFLTCLRIKEKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGS-ARPDEETKENTAK--EQLCALEQDHSSTLAALLCKARSLGRWRLAVQQAHLRGQLSRAEMESILSKKECLRIKLMAEQEAALLHQQLLAARQALTKAQTDNRKLWRQNDTQAQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQLLTEEAERASKRGQLQQKKMDRDLKQMRNRLAQERSVKLDAFQRVQELQSQLYDIQ--WPSVQMGSPVGLRSQTHCSLSSASTLSR 843          
BLAST of Transmembrane protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 313.923 bits (803), Expect = 5.822e-89
Identity = 226/826 (27.36%), Postives = 422/826 (51.09%), Query Frame = 3
Query: 4158 RDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQC-----YKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQ-QNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISR 6617
            RD+ G     +  EL E+   I  L  P +   V + L  RR VT L+F+  + H LL TFLA  N  A+++V+ +  +    L+N    +  S +L++P+PL+    +A  L+P+R+ +   GP+ ++      ++ ++Q+ L GLSD DR   HGE V + + +EDVL    L      RK +  +++  L          + + + +P    G  P+  + + K + +    QC       L+++++IL KRL +LK  WG  KL  + I +      F+++Y+ E LYP MK+L  Q    D   +       I + PKG  EI +K +QL K++E+ E  MI ++ +++ R+    + E+++EE  LP D WK   MKE  SV RP I E FV  LM+++  +  K      +TF +EHL  C+ +L   V+  ++ ++E Y+M YE+ L+H  Q L  +E+E++     LL++      D   Q+A+ +H +++E+ ALRA++ ++ E++L  +  IR+EV++EY  +VQ LF      K ++D  +  L     + I EVR E    + ++K+  G+    D+E  E   K  ++L +L Q  +  L  ++ + +SL  W     + + +  +++ E +    K     +++ +EQ+  ++ ++L   +  LT  + +   L +  D + +   + +H   + + T +Q+ ++K   +++L+ ++ +K   +  ++       K  +    K  R++  +R  L +ER +K  AF +V +L SQ+Y+ +  +  V+  +P+   +  +    S S +SR
Sbjct:   55 RDWGGA--EGIGNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRH-LLRTFLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGPFPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVL----LGSCHVIRKAS-TEWQAAL-------DNAQPDWSKLP----GLYPNQLESHPKASALLEG-QCDVVMSLSLLKSFLILWKRLEVLKEHWGRFKLRGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSI-LPPKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDRWKHQVMKENFSVMRPQIVERFVQRLMEDSQDDGPK------ITFRREHLEACILSLGCDVMARERSNFETYSMCYEHILQHTRQKLSQKEQEVD-----LLRRSQVPSEDCAGQVAELSHDMIMEITALRAQLTDLEEENLNLKIQIRKEVQEEYRELVQALFLTCLRIKEKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGS-ARPDEETKENTAK--EQLCALEQDHSSTLAALLCKARSLGRWRLAVQQAHLRGQLSRAEMESILSKKECLRIKLMAEQEAALLHQQLLAARQALTKAQTDNRKLWRQNDTQAQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQLLTEEAERASKRGQLQQKKMDRDLKQMRNRLAQERSVKLDAFQRVQELQSQLYDIQ--WPSVQMGSPVGLRSQTHCSLSSASTLSR 843          
BLAST of Transmembrane protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 243.432 bits (620), Expect = 7.175e-67
Identity = 186/687 (27.07%), Postives = 349/687 (50.80%), Query Frame = 3
Query: 4575 IQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQC-----YKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQ-QNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISR 6617
            +Q+ L GLSD DR   HGE V + + +EDVL    L      RK +  +++  L          + + + +P    G  P+  + + K + +    QC       L+++++IL KRL +LK  WG  KL  + I +      F+++Y+ E LYP MK+L  Q    D   +       I   PKG  EI +K +QL K++E+ E  MI ++ +++ R+    + E+++EE  LP D WK   MKE  SV RP I E FV  LM+++  +  K      +TF +EHL  C+ +L   V+  ++ ++E Y+M YE+ L+H  Q L  +E+E++     LL++      D   Q+A+ +H +++E+ ALRA++ ++ E++L  +  IR+EV++EY  +VQ LF      K ++D  +  L     + I EVR E    + ++K+  G+    D+E  E   K  ++L +L Q  +  L  ++ + +SL  W     + + +  +++ E +    K     +++ +EQ+  ++ ++L   +  LT  + +   L +  D + +   + +H   + + T +Q+ ++K   +++L+ ++ +K   +  ++       K  +    K  R++  +R  L +ER +K  AF +V +L SQ+Y+ +  +  V+  +P+   +  +    S S +SR
Sbjct:    1 MQMCLCGLSDCDRRVAHGELVGVQMLMEDVL----LGSCHVIRKAS-TEWQAAL-------DNAQPDWSKLP----GLYPNQLESHPKASALLEG-QCDVVMSLSLLKSFLILWKRLEVLKEHWGRFKLRGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSIL-PPKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDRWKHQVMKENFSVMRPQIVERFVQRLMEDSQDDGPK------ITFRREHLEACILSLGCDVMARERSNFETYSMCYEHILQHTRQKLSQKEQEVD-----LLRRSQVPSEDCAGQVAELSHDMIMEITALRAQLTDLEEENLNLKIQIRKEVQEEYRELVQALFLTCLRIKEKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGS-ARPDEETKENTAK--EQLCALEQDHSSTLAALLCKARSLGRWRLAVQQAHLRGQLSRAEMESILSKKECLRIKLMAEQEAALLHQQLLAARQALTKAQTDNRKLWRQNDTQAQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQLLTEEAERASKRGQLQQKKMDRDLKQMRNRLAQERSVKLDAFQRVQELQSQLYDIQ--WPSVQMGSPVGLRSQTHCSLSSASTLSR 653          
BLAST of Transmembrane protein vs. UniProt/SwissProt
Match: sp|Q0VG85|CC162_MOUSE (Coiled-coil domain-containing protein 162 OS=Mus musculus OX=10090 GN=Ccdc162 PE=1 SV=4)

HSP 1 Score: 313.923 bits (803), Expect = 4.073e-88
Identity = 226/826 (27.36%), Postives = 422/826 (51.09%), Query Frame = 3
Query: 4158 RDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQC-----YKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQ-QNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISR 6617
            RD+ G     +  EL E+   I  L  P +   V + L  RR VT L+F+  + H LL TFLA  N  A+++V+ +  +    L+N    +  S +L++P+PL+    +A  L+P+R+ +   GP+ ++      ++ ++Q+ L GLSD DR   HGE V + + +EDVL    L      RK +  +++  L          + + + +P    G  P+  + + K + +    QC       L+++++IL KRL +LK  WG  KL  + I +      F+++Y+ E LYP MK+L  Q    D   +       I + PKG  EI +K +QL K++E+ E  MI ++ +++ R+    + E+++EE  LP D WK   MKE  SV RP I E FV  LM+++  +  K      +TF +EHL  C+ +L   V+  ++ ++E Y+M YE+ L+H  Q L  +E+E++     LL++      D   Q+A+ +H +++E+ ALRA++ ++ E++L  +  IR+EV++EY  +VQ LF      K ++D  +  L     + I EVR E    + ++K+  G+    D+E  E   K  ++L +L Q  +  L  ++ + +SL  W     + + +  +++ E +    K     +++ +EQ+  ++ ++L   +  LT  + +   L +  D + +   + +H   + + T +Q+ ++K   +++L+ ++ +K   +  ++       K  +    K  R++  +R  L +ER +K  AF +V +L SQ+Y+ +  +  V+  +P+   +  +    S S +SR
Sbjct:   55 RDWGGA--EGIGNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRH-LLRTFLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGPFPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVL----LGSCHVIRKAS-TEWQAAL-------DNAQPDWSKLP----GLYPNQLESHPKASALLEG-QCDVVMSLSLLKSFLILWKRLEVLKEHWGRFKLRGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSI-LPPKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDRWKHQVMKENFSVMRPQIVERFVQRLMEDSQDDGPK------ITFRREHLEACILSLGCDVMARERSNFETYSMCYEHILQHTRQKLSQKEQEVD-----LLRRSQVPSEDCAGQVAELSHDMIMEITALRAQLTDLEEENLNLKIQIRKEVQEEYRELVQALFLTCLRIKEKLDENQFNLIQKVCELIGEVRAEGIANVKQLKKTWGS-ARPDEETKENTAK--EQLCALEQDHSSTLAALLCKARSLGRWRLAVQQAHLRGQLSRAEMESILSKKECLRIKLMAEQEAALLHQQLLAARQALTKAQTDNRKLWRQNDTQAQLLRELEHRVTQDSVTRQQLDIIKTSGMEKLLKDVEQKEQKLQLLTEEAERASKRGQLQQKKMDRDLKQMRNRLAQERSVKLDAFQRVQELQSQLYDIQ--WPSVQMGSPVGLRSQTHCSLSSASTLSR 843          
BLAST of Transmembrane protein vs. TrEMBL
Match: A0A4S2LFV1 (DUF4549 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007481 PE=4 SV=1)

HSP 1 Score: 1984.92 bits (5141), Expect = 0.000e+0
Identity = 1041/2141 (48.62%), Postives = 1455/2141 (67.96%), Query Frame = 3
Query:  765 FNDEAPLPPPLVAAT-FVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNN--GVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGAN-SNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTG---KTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENV-----------------------DVNDSIEHSLSSQ-FVIQIAQGA---EEGIEINRP-------------------------RDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLL---------------------GXXXXXXXXXEVALV--PVDNLG---------------NQPSSD--------------DKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENH 6854
            F+++AP PP ++ AT F +  PL+PT+ N  LA++GGG+VT++K    PLH+NDL  LR HL+ +C+ YGI+M++  I+SSADEMEL+A +NRKF+  F+ QE+M  FKTYD   S SE+WGLD++ + V KP+NWLPY+KL+PK H  +VK    LR+   +D+LL+A+A F+ + + ++VQD+LRHHA+LVQHPP++HSA+V+SHRQG + +EIFKKIY N + F  ++    DS    +  D+Y+F Q MQMLGLDD+   KDDPSSVQGAYLSYLHLRHLK+RD+ RTC+S+LNYFRS+ERT+ INDQGLS+N+  GV   S  NHR G+   GH+GGG  I  HGYLFN+P+EF+I E +FMQFAE++NHDDFYFHE+GRIHVRDQ G WIIYD A+ DF KLE DLLL+A+ FI K++ LR++S  K+K    +E+Q  D DI +YAH +VDRFGVL+DIW N  A  + K+K++D+YME Y +  +RD RR ++Q M NLMY++PR+D+  +YFV AYR EC ILR + +I R +LN QI NQREY+K I  +  +FG+P P++E+  IAV++DE++L  +Y LEFH SLS    +  +++   +++     P     EI+LEK+ Y+ ++ E++++  LG SYT Q+QRDLFS +F+E+ I + +L++++L  I +RN+RGDK++R++ L+NE GRL +++TLR RL+D  WE EVL+KIY   A ++G+D+FHL++RP+QFEAAK KEGA+  +P +YI+ +QDDDS +DKF PSALPLAI+E+DE  +GKFSF+G+ ++MEMLE++GVEN++ +LK+Q  HKNAL A V L    RPS Y++          T     + + TGAN  +++     Q GPTPLAL+  R+      D HPEAFFSIQLEKSP RDR  N +IK+  G G     S VE EK+KR+ +  +  DF  R Q  SLR+QII  Y+SI+ +L+ VPTV+E FF  G AFEKKN PED++  +  DPR LR R RR+LS +G+K  N WFIPHF E+LF++R  DD   T+ L+ +  +    HDILH+L+ ++RL ISSAKI+ E + + +                       +V  +I  + S++ FV Q++         + ++ P                          D+DGG MS L+TEL EI +QI+ L DPT+ + VI++L  RR+V FL+F+ C+   L ETFLA  NV+A+K V  N  FP  EL++VQR    +  +NVPEPLEARD +A+ ++P+RS++N  GP+L+       I+ NI+L LAGL  VDRPTVHGE +++NLCLEDVL  G++PE++AG  + +   EN+  +                     G          VA    PV+  G                Q SS               DK  KL+ +  P+  Y L++ ++IL KR+ LLK  WG R+LG+EAI NP+ F  F  IYK EKLYPL++SL IQYR PD+   GP   TDI V PKGIPE+VV+QRQL K+IE FE  MI DLRK ++RQTD V+KERNREEGNLPL+LWK+PAMKE +SVKRP +A++F+ ELM +     EK   +DT T TK+ LN+ LQ +AISV+  Q+ESYENY+MYYEN LK+QH LLYA+EREIE +K+ L Q EL T V VQFQ+++QAH+LLLEV ALRAK+AE+ E +L+ E  +R  VR+E++  ++ LF ++FEQK++ID YR++LH  TL+RI EVR EA+ EM ++KE+SGA+ +A+DELAERNL+LS+E+ +LHQ+NI L+QMMSR++ + +W  T ++C F+K I+ +E+ R++ K+ VT + + SEQ+V+++ EE+ +L+ +L++TEK LND+RK LDKEM +K++K+HAAERKAATDKQMA+VKQMHIDQLM+EI EKN+ +  M  +L+ + KS K  ADKSVREVD LRK LREERK+K+SA  KVDDL+SQ+YEFE A++           +G+N   ++   ++      +    G + ++ +++        RP+TY D++ +   PY   HY  FR++     QLR+R+  Q+L N   + H
Sbjct:  385 FSEQAPQPPAMMHATVFGANAPLQPTKANFDLASSGGGIVTNDKVAAPPLHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPKRHEYLVKLTMELRSGTVVDDLLKASANFLKVKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDFFGKASA---DSDEPGKRQDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEIDNHDDFYFHEEGRIHVRDQVGFWIIYDAALEDFNKLEQDLLLLATAFIQKDRQLRTSSNTKKKGVD-QEAQPSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVDKPEFGMPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDRSVQQLYELFTPDQPMQEIVLEKRFYDFLRYEVETLKPLGGSYTAQLQRDLFSSYFVEDAIQMCELSNQHLAAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYSMH------APKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALE--RSKHQLNADYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVTEDFFVIGYAFEKKN-PEDDLDVQVTDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTAIRGALPTAAEVASNIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIEDLSDFDGGPMSMLATELREIQYQINRLPDPTDPEQVIQMLELRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKAIFPWRSLMNSCGPFLLFCFGPSTIEYNIRLCLAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVAGTTNPVNATGTSINTINITHSSETQGQKSSTHGGAGGTGPLTTTADKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVEAINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLVRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHL----EKNAKNDTYTITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEEINLKTESKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIALQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYS-----------SGQNRPGVNLPTMTPKGEAAAG---GARKLSAEIQ--------RPVTYEDLVAKKSGPYTSKHYLRFRQETARVPQLRERLVQQILKNGSYQTH 2486          

HSP 2 Score: 270.011 bits (689), Expect = 1.876e-68
Identity = 121/226 (53.54%), Postives = 174/226 (76.99%), Query Frame = 3
Query:   45 LKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDD 722
            LK  ED LRS+I+EL++QIEEN+L++GIPSKGMSS+Y+PKDPD+FRR+RKLILQRTLQV + +PI +QAE+M  EL +C+ RE+TE+++P+L+HQYF+DRI +++  K+ +LLRWKRYC +TA +E+I  EY  RL+++ +EYLD+SSR HRLA+ REG L+N++ GV+++  +D  IYLR+ + HLQSL    Q   II+W P +HR     +++      L +D
Sbjct:    8 LKTQEDGLRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPQPIMLQAELMMQELDACNQREFTERTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSHLQSLSYTNQLLNIIKWLPYSHRDRIKDSLIKQYPYILCED 233          
BLAST of Transmembrane protein vs. TrEMBL
Match: A0A4V3SDX3 (DUF4549 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007481 PE=4 SV=1)

HSP 1 Score: 1972.21 bits (5108), Expect = 0.000e+0
Identity = 1036/2127 (48.71%), Postives = 1451/2127 (68.22%), Query Frame = 3
Query:  765 FNDEAPLPPPLVAAT-FVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNN--GVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGAN-SNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTG---KTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENV-----------------------DVNDSIEHSLSSQ-FVIQIAQGA---EEGIEINRP----RDYDGGVMSQ-------LSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLL---------------------GXXXXXXXXXEVALV--PVDNLG---------------NQPSSD--------------DKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENH 6854
            F+++AP PP ++ AT F +  PL+PT+ N  LA++GGG+VT++K    PLH+NDL  LR HL+ +C+ YGI+M++  I+SSADEMEL+A +NRKF+  F+ QE+M  FKTYD   S SE+WGLD++ + V KP+NWLPY+KL+PK H  +VK    LR+   +D+LL+A+A F+ + + ++VQD+LRHHA+LVQHPP++HSA+V+SHRQG + +EIFKKIY N + F  ++    DS    +  D+Y+F Q MQMLGLDD+   KDDPSSVQGAYLSYLHLRHLK+RD+ RTC+S+LNYFRS+ERT+ INDQGLS+N+  GV   S  NHR G+   GH+GGG  I  HGYLFN+P+EF+I E +FMQFAE++NHDDFYFHE+GRIHVRDQ G WIIYD A+ DF KLE DLLL+A+ FI K++ LR++S  K+K    +E+Q  D DI +YAH +VDRFGVL+DIW N  A  + K+K++D+YME Y +  +RD RR ++Q M NLMY++PR+D+  +YFV AYR EC ILR + +I R +LN QI NQREY+K I  +  +FG+P P++E+  IAV++DE++L  +Y LEFH SLS    +  +++   +++     P     EI+LEK+ Y+ ++ E++++  LG SYT Q+QRDLFS +F+E+ I + +L++++L  I +RN+RGDK++R++ L+NE GRL +++TLR RL+D  WE EVL+KIY   A ++G+D+FHL++RP+QFEAAK KEGA+  +P +YI+ +QDDDS +DKF PSALPLAI+E+DE  +GKFSF+G+ ++MEMLE++GVEN++ +LK+Q  HKNAL A V L    RPS Y++          T     + + TGAN  +++     Q GPTPLAL+  R+      D HPEAFFSIQLEKSP RDR  N +IK+  G G     S VE EK+KR+ +  +  DF  R Q  SLR+QII  Y+SI+ +L+ VPTV+E FF  G AFEKKN PED++  +  DPR LR R RR+LS +G+K  N WFIPHF E+LF++R  DD   T+ L+ +  +    HDILH+L+ ++RL ISSAKI+ E + + +                       +V  +I  + S++ FV Q++         + ++ P       D  V  +       ++TEL EI +QI+ L DPT+ + VI++L  RR+V FL+F+ C+   L ETFLA  NV+A+K V  N  FP  EL++VQR    +  +NVPEPLEARD +A+ ++P+RS++N  GP+L+       I+ NI+L LAGL  VDRPTVHGE +++NLCLEDVL  G++PE++AG  + +   EN+  +                     G          VA    PV+  G                Q SS               DK  KL+ +  P+  Y L++ ++IL KR+ LLK  WG R+LG+EAI NP+ F  F  IYK EKLYPL++SL IQYR PD+   GP   TDI V PKGIPE+VV+QRQL K+IE FE  MI DLRK ++RQTD V+KERNREEGNLPL+LWK+PAMKE +SVKRP +A++F+ ELM +     EK   +DT T TK+ LN+ LQ +AISV+  Q+ESYENY+MYYEN LK+QH LLYA+EREIE +K+ L Q EL T V VQFQ+++QAH+LLLEV ALRAK+AE+ E +L+ E  +R  VR+E++  ++ LF ++FEQK++ID YR++LH  TL+RI EVR EA+ EM ++KE+SGA+ +A+DELAERNL+LS+E+ +LHQ+NI L+QMMSR++ + +W  T ++C F+K I+ +E+ R++ K+ VT + + SEQ+V+++ EE+ +L+ +L++TEK LND+RK LDKEM +K++K+HAAERKAATDKQMA+VKQMHIDQLM+EI EKN+ +  M  +L+ + KS K  ADKSVREVD LRK LREERK+K+SA  KVDDL+SQ+YEFE A++           +G+N   ++   ++      +    G + ++ +++        RP+TY D++ +   PY   HY  FR++     QLR+R+  Q+L N   + H
Sbjct:  385 FSEQAPQPPAMMHATVFGANAPLQPTKANFDLASSGGGIVTNDKVAAPPLHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPKRHEYLVKLTMELRSGTVVDDLLKASANFLKVKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDFFGKASA---DSDEPGKRQDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEIDNHDDFYFHEEGRIHVRDQVGFWIIYDAALEDFNKLEQDLLLLATAFIQKDRQLRTSSNTKKKGVD-QEAQPSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVDKPEFGMPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDRSVQQLYELFTPDQPMQEIVLEKRFYDFLRYEVETLKPLGGSYTAQLQRDLFSSYFVEDAIQMCELSNQHLAAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYSMH------APKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALE--RSKHQLNADYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVTEDFFVIGYAFEKKN-PEDDLDVQVTDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTAIRGALPTAAEVASNIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIATELREIQYQINRLPDPTDPEQVIQMLELRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKAIFPWRSLMNSCGPFLLFCFGPSTIEYNIRLCLAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVAGTTNPVNATGTSINTINITHSSETQGQKSSTHGGAGGTGPLTTTADKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVEAINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLVRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHL----EKNAKNDTYTITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEEINLKTESKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIALQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYS-----------SGQNRPGVNLPTMTPKGEAAAG---GARKLSAEIQ--------RPVTYEDLVAKKSGPYTSKHYLRFRQETARVPQLRERLVQQILKNGSYQTH 2472          

HSP 2 Score: 270.011 bits (689), Expect = 1.849e-68
Identity = 121/226 (53.54%), Postives = 174/226 (76.99%), Query Frame = 3
Query:   45 LKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDD 722
            LK  ED LRS+I+EL++QIEEN+L++GIPSKGMSS+Y+PKDPD+FRR+RKLILQRTLQV + +PI +QAE+M  EL +C+ RE+TE+++P+L+HQYF+DRI +++  K+ +LLRWKRYC +TA +E+I  EY  RL+++ +EYLD+SSR HRLA+ REG L+N++ GV+++  +D  IYLR+ + HLQSL    Q   II+W P +HR     +++      L +D
Sbjct:    8 LKTQEDGLRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPQPIMLQAELMMQELDACNQREFTERTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSHLQSLSYTNQLLNIIKWLPYSHRDRIKDSLIKQYPYILCED 233          
BLAST of Transmembrane protein vs. TrEMBL
Match: A0A1S8X970 (DUF4549 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=X801_00873 PE=4 SV=1)

HSP 1 Score: 1968.36 bits (5098), Expect = 0.000e+0
Identity = 1030/2118 (48.63%), Postives = 1455/2118 (68.70%), Query Frame = 3
Query:  765 FNDEAPLPPPLVAATFV-STKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNN--GVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRD-----------------------------LFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGAN-SNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTG---KTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENV-----------------------DVNDSIEHSLSSQ-FVIQIAQGA---EEGIEINRP----RDYDGGVMSQ-------LSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEV----ALVPVDNLG--NQPSS-DDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTN 6875
            F+++AP PP ++ A  V +  PL+PT+ NL LA++GGG+VT++K    P+H+NDL  LR HL+ +C+ YGI+M++  I+SSADEMEL+A +NRKF+  F+ QE+M  FKTYD   S SE+WGLD++ + V KP+NWLPY+KL+P+ H  +VK    LR+   +D+LL+A+A F+ + + ++VQD+LRHHA+LVQHPP++HSA+V+SHRQG + +EIFKKIY N ++F  ++    D+    +  D+Y+F Q MQMLGLDD+   KDDPSSVQGAYLSYLHLRHLK+RD+ RTC+S+LNYFRS+ERT+ INDQGLS+N+  GV   S  NHR G+   GH+GGG  I  HGYLFN+P+EF+I E +FMQFAEV+NHDDFYFHE+GRIHVRDQ G WI+YD A+ DF KLE DLLL+A+ FI +++  R +S  K+K    +E+QS D DI +YAH +VDRFGVL+DIW N  A  + K+K++D+YME Y +  +RD RR ++Q M NLMY++PR+D+  +YFV AYR EC ILR + +I R +LN QI NQREY+K I     +FGLP P++E+  IAV++DE++L  +Y LEFH SLS    +  +++   +++     P     EI+LEK+ Y+ ++ E++++  LG SYT Q+QRD                             LFS +F+E+ I + +L++++L  I +RN+RGDK++R++ L+NE GRL +++TLR RL+D  WE EVL+KIY   A ++G+D+FHL++RP+QFEAAK KEGA+  +P +YI+ +QDDDS +DKF PSALPLAI+E+DE  +GKFSF+G+ ++MEMLE++GVEN++ +LK+Q  HKNAL A V L    RPS YT+          T     + + TGAN  +++     Q GPTPLAL+  R+      D HPEAFFSIQLEKSP RDR  N +IK+  G G     S VE EK+KR+ +  +  DF  R Q  SLR+QII  Y+SI+ +L+ VPTV+E FF  G AFEKKN PED++  +  DPR LR R RR+LS +G+K  N WFIPHF E+LF++R  DD   T+ L+ +  +    HDILH+L+ ++RL ISSAKI+ E + + +                       +V  +I  + S++ FV Q++         + ++ P       D  V  +       ++TEL EI +QI+ L DPT+ + VI++L  RR+V FL+F+ C+   L ETFLA  NV+A+K V  N  FP  EL++VQR    +  +NVPEPLEARD +A+ L+P+RS++N+ GP+L+       I+ NI L +AGL  VDRPTVHGE +++NLCLEDVL  G++PE++AG  + +   EN+  +  K  +  ++E+    A  P    G  + P S  DK  KL+ +  P+  Y L++ ++IL KR+ LLK  WG R+LG+E+I NP+ F  F  IYK EKLYPL++SL IQYR PD+   GP   TDI V PKGIPE+VV+QRQL K+IE FE  MI DLRK ++RQTD V+KERNREEGNLPL+LWK+PAMKE +SVKRP +A++F+ ELM + + N      +DT   TK+ LN+ LQ +AISV+  Q+ESYENY+MYYEN LK+QH LLYA+EREIE +K+ L Q EL T V VQFQ+++QAH+LLLEV ALRAK+AE+ + +L+ E  +R  VR+E++  ++ LF ++FEQK++ID YR++LH  TL+RI EVR EA+ EM ++KE+SGA+ +A+DELAERNL+LS+E+ +LHQ+NI L+QMMSR++ + +W  T ++C F+K I+ +E+ R++ K+ VT + + SEQ+V+++ EE+ +L+ +L++TEK LND+RK LDKEM +K++K+HAAERKAATDKQMA+VKQMHIDQLM+EI EKN+ +  M  +L+ + KS K  ADKSVREVD LRK LREERK+K+SA  KVDDL+SQ+YEFE A++           +G+N   ++   ++      +    G + ++ +++        RP+TY D++ +   PY   HY  FR++     QLR+R+A Q+L N   + H    +T+
Sbjct:  368 FSEQAPQPPAMMHAAVVGANAPLQPTKANLDLASSGGGIVTNDKVAAPPMHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPRRHEYLVKLTMELRSGTVVDDLLKASANFLKMKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDVFGKASA---DTDEPGKRQDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEVDNHDDFYFHEEGRIHVRDQVGFWIVYDAALEDFNKLEQDLLLLATAFIQRDRQSRMSSNTKKKGVN-QEAQSSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVEKPEFGLPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDQSVQQLYELFTPNHPMQEIVLEKRFYDFLRYEVETLKPLGGSYTAQLQRDVRGRIRQSDDFICFCTHLVSRNMESVSSKLFSSYFVEDAIQMCELSNQHLSAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYTMH------APKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALE--RSKHQLNADYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVTEDFFVIGYAFEKKN-PEDDLDVQVTDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTATRGALPTAAEVAANIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIATELREIQYQINRLPDPTDPEQVIQMLDLRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKALFPWRSLMNRCGPFLLFCFGPSTIEYNIHLCMAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVADKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVESINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLLRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHLEQNAR----NDTYIITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEDINLKTEAKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIGLQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYS-----------SGQNRPGVNLPTVAPKGEATAG---GARKLSAEIQ--------RPVTYEDLVAKKSGPYTSKHYLRFRQETTRVPQLRERLAQQILRNGSGQTHMHFLRTH 2446          

HSP 2 Score: 253.447 bits (646), Expect = 1.759e-63
Identity = 121/245 (49.39%), Postives = 176/245 (71.84%), Query Frame = 3
Query:   45 LKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRII-QWFP---------IAHRKEFSATIVDCVEIKLSDDQSKSERSFT 749
            LK  ED LRS+I+EL++QIEEN+L++GIPSKGMSS+Y+PKDPD+FRR+RKLILQRTLQV + +PI +QAE+M  EL +C  RE+TEK++P+L+HQYF+DRI +++  K+ +LLRWKRYC +TA +E+I  EY  RL+++ +EYLD+SSR HRLA+ REG L+N++ GV+++  +D  IYLR+ +  LQSL      N+++ + +P         +A R    A   +   + L+  Q   ER  +
Sbjct:    8 LKTQEDGLRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPKPITLQAELMMQELDACSQREFTEKTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSQLQSLSY---ANQLLNKQYPYILCEDVTNVAPRGGSEAGGTEAATVNLTKTQGAVEREMS 249          
BLAST of Transmembrane protein vs. TrEMBL
Match: A0A074ZYC6 (DUF4549 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02675 PE=4 SV=1)

HSP 1 Score: 1934.07 bits (5009), Expect = 0.000e+0
Identity = 1031/2180 (47.29%), Postives = 1451/2180 (66.56%), Query Frame = 3
Query:  765 FNDEAPLPPPLVAATFV-STKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNN--GVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGAN-SNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTG---KTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENV-----------------------DVNDSIEHSLSSQ-FVIQIAQGA---EEGIEINRP----RDYDGGVMSQ-------LSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEV--------------ALVPVDNLGNQPSSDDKNKKLNI--ITH------------------------------------PIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQL----------------------------------G------------KMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTN 6875
            F+++AP PP ++ A  V +  PL+PT+ NL LA++GGG+VT++K    PLH+NDL  LR HL+ +C+ YGI+M++  I+SSADEMEL+A +NRKF+  F+ QE+M  FKTYD   S SE+WGLD++ + V KP+NWLPY+KL+P+ H  +VK    LR+   +D+LL+A+A F+ + + ++VQD+LRHHA+LVQHPP++HSA+V+SHRQG + +EIFKKIY N ++F  ++    D+    +  D+Y+F Q MQMLGLDD+   KDDPSSVQGAYLSYLHLRHLK+RD+ RTC+S+LNYFRS+ERT+ INDQGLS+N+  GV   S  NHR G+   GH+GGG  I  HGYLFN+P+EF+I E +FMQFAEV+NHDDFYFHE+GRIHVRDQ G WI+YD A+ DF KLE DLLL+A+ FI +++  R +S  K+K    +E+QS D DI +YAH +VDRFGVL+DIW N  A  + K+K++D+YME Y +  +RD RR ++Q M NLMY++PR+D+  +YFV AYR EC ILR + +I R +LN QI NQREY+K I     +FGLP P++E+  IAV++DE++L  +Y LEFH SLS    +  +++   +++     P     EI+LEK+ Y+ ++ E++++  LG SYT Q+QRDLFS +F+E+ I + +L++++L  I +RN+RGDK++R++ L+NE GRL +++TLR RL+D  WE EVL+KIY   A ++G+D+FHL++RP+QFEAAK KEGA+  +P +YI+ +QDDDS +DKF PSALPLAI+E+DE  +GKFSF+G+ ++MEMLE++GVEN++ +LK+Q  HKNAL A V L    RPS YT+          T     + + TGAN  +++     Q GPTPLAL+  R+      D HPEAFFSIQLEKSP RDR  N +IK+  G G     S VE EK+KR+ +  +  DF  R Q  SLR+QII  Y+SI+ +L+ VPTV+E FF  G AFEKKN PED++  +  DPR LR R RR+LS +G+K  N WFIPHF E+LF++R  DD   T+ L+ +  +    HDILH+L+ ++RL ISSAKI+ E + + +                       +V  +I  + S++ FV Q++         + ++ P       D  V  +       ++TEL EI +QI+ L DPT+ + VI++L  RR+V FL+F+ C+   L ETFLA  NV+A+K V  N  FP  EL++VQR    +  +NVPEPLEARD +A+ L+P+RS++N+ GP+L+       I+ NI L +AGL  VDRPTVHGE +++NLCLEDVL  G++PE++AG  + +   EN+  +  K  +  ++E+              A  P    G    ++     +N   ITH                                    P+  Y L++ ++IL KR+ LLK  WG R+LG+E+I NP+ F  F  IYK EKLYPL++SL IQYR PD+   GP   TDI V PKGIPE+VV+QRQL                                  G            K+IE FE  MI DLRK ++RQTD V+KERNREEGNLPL+LWK+PAMKE +SVKRP +A++F+ ELM + + N      +DT   TK+ LN+ LQ +AISV+  Q+ESYENY+MYYEN LK+QH LLYA+EREIE +K+ L Q EL T V VQFQ+++QAH+LLLEV ALRAK+AE+ + +L+ E  +R  VR+E++  ++ LF ++FEQK++ID YR++LH  TL+RI EVR EA+ EM ++KE+SGA+ +A+DELAERNL+LS+E+ +LHQ+NI L+QMMSR++ + +W  T ++C F+K I+ +E+ R++ K+ VT + + SEQ+V+++ EE+ +L+ +L++TEK LND+RK LDKEM +K++K+HAAERKAATDKQMA+VKQMHIDQLM+EI EKN+ +  M  +L+ + KS K  ADKSVREVD LRK LREERK+K+SA  KVDDL+SQ+YEFE A++           +G+N   ++   ++      +    G +      K+S +  RP    Y D++ +   PY   HY  FR++     QLR+R+A Q+L N   + H    +T+
Sbjct:  368 FSEQAPQPPAMMHAAVVGANAPLQPTKANLDLASSGGGIVTNDKVAAPPLHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPRRHEYLVKLTMELRSGTVVDDLLKASANFLKMKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDVFGKASA---DTDEPGKRQDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEVDNHDDFYFHEEGRIHVRDQVGFWIVYDAALEDFNKLEQDLLLLATAFIQRDRQSRMSSNTKKKGVN-QEAQSSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVEKPEFGLPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDQSVQQLYELFTPNHPMQEIVLEKRFYDFLRYEVETLKPLGGSYTAQLQRDLFSSYFVEDAIQMCELSNQHLAAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYTMH------APKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALE--RSKHQLNADYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVTEDFFVIGYAFEKKN-PEDDLDVQVTDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTATRGALPTAAEVAANIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIATELREIQYQINRLPDPTDPEQVIQMLDLRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKALFPWRSLMNRCGPFLLFCFGPSTIEYNIHLCMAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVAGTTNPANATGTSINTMNITHSSETQGQKSSTHGGAGGTGPLTTTPDKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVESINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLLRQTDLVIKERNREEGNLPLELWKRPLLKLIEAFEFYMIADLRKLLLRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHLEQNAR----NDTYIITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEDINLKTEAKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIGLQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYS-----------SGQNRPGVNLPTVAPKGEATAG---GAR------KLSAEIQRP----YEDLVAKKSGPYTSKHYLRFRQETTRVPQLRERLAQQILRNGSGQTHMHFLRTH 2506          

HSP 2 Score: 253.832 bits (647), Expect = 1.407e-63
Identity = 121/245 (49.39%), Postives = 176/245 (71.84%), Query Frame = 3
Query:   45 LKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRII-QWFP---------IAHRKEFSATIVDCVEIKLSDDQSKSERSFT 749
            LK  ED LRS+I+EL++QIEEN+L++GIPSKGMSS+Y+PKDPD+FRR+RKLILQRTLQV + +PI +QAE+M  EL +C  RE+TEK++P+L+HQYF+DRI +++  K+ +LLRWKRYC +TA +E+I  EY  RL+++ +EYLD+SSR HRLA+ REG L+N++ GV+++  +D  IYLR+ +  LQSL      N+++ + +P         +A R    A   +   + L+  Q   ER  +
Sbjct:    8 LKTQEDGLRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPKPITLQAELMMQELDACSQREFTEKTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSQLQSLSY---ANQLLNKQYPYILCEDVTNVAPRGGSEAGGTEAATVNLTKTQGAVEREMS 249          
BLAST of Transmembrane protein vs. TrEMBL
Match: A0A068Y2V3 (DUF4549 domain-containing protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000393900 PE=4 SV=1)

HSP 1 Score: 1848.17 bits (4786), Expect = 0.000e+0
Identity = 984/2136 (46.07%), Postives = 1412/2136 (66.10%), Query Frame = 3
Query:  765 FNDEAPLPPPLVAATFVSTK-PLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDR-SYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKT------SGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTE-------LKAENVDV-------NDSIEH---------SLSSQFVIQIAQGAEEGIEIN-RP--------------------------RDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENV-LLLGXXXXXXXXXEVALVPVDNLG--------------------NQPSSDDKNK---------------------KLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKT 6872
            F++ AP PP +  A    +  PL PT  N+  AA+GGG+V +E+   LPLHTNDL ++R HL ++   YGI +++  I+S+ADEMEL+A +NR F+  F  QE+M  FKTYD   SGSE+WGLD+ +  + KP+NWL +IKLKPK +  +VK +  LR    +DE+LR+ A F+ +   +RVQDALRHHA+LVQHPP++H+A+V+SHRQG+++SEIF+KI+ + EL++ +   ++ +S        Y+FN  MQMLGLD+  + KDDPSSVQG YLS+LHLRHLK+RD+QRTC+S+LNYFRS+ERT+ INDQGLSL     +R S QNHR+G  +PGHQGG  N+  H YLF+TPR+FRI E++FMQFA+VENHDDFY+H+D RIHVRDQ G+WI+YD A+ DF +LE DL+L+A+ FI K+K +RSAS FKRK Q   E+   +F+I  YAH EVDRFGVL+D+WTN  A  E KK+++D+YMEAY +  +R+ RR ++Q MV+LMY++PRI++   YFV AYR EC ILR++  + +  LN QI  QREY   +G    + G P+P++    I+ N+D+  L   Y LE   SL++  ++ E+++           PT +  E++LEK+ YE++  E+ +++  G+SYT  +QRDLF+  ++E+   ++ L  E   +I   NTRGDK+ RK  L+N  G++ +++ LR RL+   WE+EVLAKIY R AI++GYDEFHL+LRP+QFEAAK KEG + AK  LYI+ IQDDDS +DKF PSALPLAI+E+DE  +GKFSF+G+ +V E+ + +GVENL+++LK QL HKNAL A + L     PS Y+    +L +       +++  T+ A   ++    AQ GPTPLAL+  RA      D HPEAFFS+QLEK+ CRDR MN++ +K   T K+      S +E EK+KRDL+  + DD+  R QQ +LR QII  Y S+I VL+ VP + E+FF  G  +EKK   +D+    + DPRKLRKR RR+LS +G++F NLWFIPHF E+LF++RQ DDE  T  L+++  +    HDI+H+LV F+RL IS +++S E       + +E V           S+E+         + SS   + +A   E   EIN +P                            +DGG MS L+ EL EI  QI+ L DP +   V+ LL+ RR   FL  + C+S  L ETFLAT N +A++ +    +FP  E++N  + +  +  + +PEPLE +D+RA +LYP+ S +N  GP+ I +  W  I+ NI+L +AGL  VD+PTVHGE +SL L LEDVL  G++ E+ AG+ L + ++EN+  LLG++F  K K+     PV N                      ++P + D                        KL+I+  PI  Y L++ Y+IL KR+ L+K  WG R+LGLE+I+    F  F ++Y+ E+L+PL++SL IQY+ P++   GPF +TD+ ++PKGIPE+V+ QRQL K+IE FE+ MIGD+RK ++RQ D V+KERNREEGNLPL+LWKKPAMKE+++V+RP +    V E+++N      +  +  T+TF  EHLNK +QN+ I V+ MQ+E+YENYAMYYEN LK+QH LLYARERE+  +++QL QKEL T ++VQFQ+++QAH+LLLEV ALRAK+AE  + ++  E  +R++VR+E+++ ++ LF+++FEQK +ID YR +LH  TLKRI EVR EAA+EM ++KEKSGAK +A+DELAERNL+LS+E+ ++HQ+NIHL+QM+SR+KS+  W    + C F+K +  +E  R+K K  V  + M SEQ+V+ + EE+ +L+  L+ST KEL+DLR+ LDKE+K+K++K++ AERKAAT+KQ+A +KQMHI++L+ +I  KN +IA ++  L  + K+ + V +K++R++D L+K L +ERK+K+ A  KVDDL+SQVYE+E AFAI    TP    TG N+  ++         G    + G       +K +  K       Y D+L+R+ +PY P HY D RR  V   +L++ +A ++L    P  HE+L + 
Sbjct:  410 FSEHAPQPPGMFMAQLGGSGIPLPPTTTNIQYAASGGGLVINERYHGLPLHTNDLANIRPHLTIFVKAYGININIQTIRSAADEMELFAVINRNFRRLFLEQEEMLTFKTYDATSSGSERWGLDSPSHAMKKPSNWLSFIKLKPKRNADLVKSMMELRCVGNVDEVLRSLAAFLKINKPERVQDALRHHAMLVQHPPIVHAASVVSHRQGMSLSEIFRKIFSSPELYDETTVKESKASG----RSTYDFNSAMQMLGLDEQTDAKDDPSSVQGGYLSFLHLRHLKMRDVQRTCISVLNYFRSIERTLTINDQGLSLGGRGAERTSPQNHRAGPELPGHQGGSNNLVGHSYLFSTPRDFRIKESEFMQFADVENHDDFYYHKDCRIHVRDQVGYWIVYDCALDDFNELERDLMLLATHFIQKDKAMRSASNFKRK-QTANETNKNEFNIANYAHREVDRFGVLYDLWTNECAFQEAKKELMDVYMEAYQHVCSRESRRRLAQVMVDLMYQRPRIELNCTYFVLAYRYECAILRLKTAVMKHCLNAQIQQQREYFIKLGTTGSEDGYPIPLITHYPISPNSDQPALTPCYLLELQPSLAMAANLAEAMQQAVNVTFDMLNPTRMIDELVLEKRFYEVLHYEVLNLEPPGLSYTQALQRDLFASSYVEDAKQMSNLLRERYFSIQDTNTRGDKQQRKAFLLNHLGQMLDVVVLRHRLITCLWETEVLAKIYLRTAIEMGYDEFHLFLRPLQFEAAKYKEGVDEAKLPLYITAIQDDDSVVDKFIPSALPLAIHELDETHVGKFSFRGKVTVAELCDERGVENLLVILKTQLTHKNALIAALMLAFNATPSFYS---SNLSSRAKKGRSTDQEGTSLA--EYTGLSGAQMGPTPLALE--RAFHMTFMDFHPEAFFSVQLEKTACRDRVMNLFARKTEATAKSKNRAKNSSIESEKLKRDLISQFCDDYSRRAQQTALRGQIIALYASLITVLRKVPNICEEFFTIGTMYEKKG-LDDDAEMAKTDPRKLRKRVRRVLSLDGTRFYNLWFIPHFLEVLFVFRQLDDEAATRALRSMCRVASALHDIVHYLVAFARLGISGSRLSAEQRDQIYAMASETVKTMVHELHPTSSMEYANRLAANAAANSSTAKLVVAGTTEYLAEINEQPAAMVTPEGLTLPNGQSLLIDQAVEEISSFDGGPMSNLAQELHEIQTQINMLPDPQDPDQVVNLLNARREYMFLLLDVCLSSVLSETFLATGNEEAYRELVDGSRFPLGEMSNRCQPSLEALEMPIPEPLEPQDERACKLYPWLSFLNSAGPFTIQYPRWTRIEYNIRLCMAGLRHVDKPTVHGELLSLMLALEDVLETGDVLEASAGQPLPVEEYENLHYLLGRRFRNKRKEVAQSAPVANAATPSGGGAGASGGSAGVGGGADEPEAKDDEPGESIAAVSHPARTETATNVEVKLSIVETPIAAYALIKKYLILRKRVELMKREWGKRRLGLESIDTAAAFKQFTQVYRRERLFPLLRSLSIQYKQPEIFALGPFQETDVQISPKGIPEMVLLQRQLVKLIEAFENYMIGDVRKMLVRQIDLVIKERNREEGNLPLELWKKPAMKESLTVQRPAL----VDEVLENLLDGAREDTVKKTITFDTEHLNKFIQNVTIGVMRMQREAYENYAMYYENLLKNQHMLLYAREREVASLREQLKQKELETEINVQFQMSEQAHNLLLEVTALRAKLAENADQTVHSEAKVRDQVRREFSAAMRKLFALSFEQKARIDEYRNHLHAVTLKRISEVRDEAALEMERIKEKSGAKSSAEDELAERNLRLSREINNIHQKNIHLQQMVSRLKSMSTWKENTLHCVFEKQMKAVEDQRNKSKTQVNRLGMLSEQRVRNLSEEMTKLRENLSSTHKELDDLRRQLDKELKDKVEKRNIAERKAATEKQIANIKQMHIEKLLGDIAGKNEHIAELNEQLAVHEKTKRQVIEKAMRDIDNLKKRLADERKLKKIAIHKVDDLLSQVYEYETAFAI--NQTPAQ--TG-NTAIVATHLGGTDQKGSGGAKFG------GIKSACRKYNSSITAYDDLLKRFKVPYTPQHYLDHRRKMVMVPRLQQHMAHEILNEQPPATHEELVEA 2517          

HSP 2 Score: 220.32 bits (560), Expect = 2.505e-53
Identity = 99/211 (46.92%), Postives = 149/211 (70.62%), Query Frame = 3
Query:   45 LKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEF 677
            L+I E+ L+S+  +LK+QIEEN++++GIPSKGMSS Y+P+DP+HFRR+RKLILQRTLQVT    + VQA+ M  +  +C   E+   ++P L+ QYFLDR+ E++++K+  +LRWKRYC  T  +E +Y +Y + ++ + +EYL+ SSR HRL+T  E  L+  + G++E+  DD +IY R +I  LQS     Q  ++I+WFP  HR+ F
Sbjct:    8 LRIQEEGLKSDFQDLKAQIEENEIIHGIPSKGMSSFYIPRDPEHFRRRRKLILQRTLQVTSPMELVVQADQMVADQETCKKGEFNASTIPPLLLQYFLDRMSEIVSAKHLLMLRWKRYCSGTMKVEKVYKDYLQVIERLTEEYLECSSRAHRLSTADEALLAGNDGGLEEVEFDDFLIYWRAIIIKLQSQTYFKQLIQLIKWFPYGHREGF 218          
BLAST of Transmembrane protein vs. Ensembl Cavefish
Match: ENSAMXT00000000633.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24590039:24605479:-1 gene:ENSAMXG00000000603.2 transcript:ENSAMXT00000000633.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 375.17 bits (962), Expect = 5.989e-108
Identity = 303/1136 (26.67%), Postives = 549/1136 (48.33%), Query Frame = 3
Query: 3330 ACNPTDLRSEKSTTTGANSNFSVPISAQ-AGPTP-----LALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKK--FSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFE--KKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTN-VQRATTISFRLNVPEPLEARDQRARELYPYRSII--NQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVL-----AEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITH-PIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTP-----------------INGVTGKNSDSISCSQISRPSTG 6629
            AC  T    +K+   GA    SV   A+ +  +P     L L + R DS   +D    AF SIQLEK+  RD  +N ++KK     T  ++  EV ++KR ++  +   F   + Q  +RSQII    S+  +L  +P +S+  F  G+A E  K  D E    +   DPR  + R R++LS +G   LNLWFIPH+TE+LF+++  +++   + L++ + IV   HDI+ +LV  + L   + K S       +D +D                      E+    D+ G     +  EL +I  Q+  L +P   + V   L  RR V FL+F+  +   + E FL++  + A+++VS NM      L++ ++R+ +   +L +P+PL++    ++ ++P+RS +  + L P   + D    I+  +QL L+GL+D  R   +G  + ++LCL+D+L     A     + +A   + + + +N LL   +             V+++  +P      K++    H PIQ     + +++L K+L + K+ W  ++LG+E I +   FN F+ IY+ E  YP M++L  Q    +  ++        F  P G  E+ VK  QL  ++E+ E  M+  +++RI ++   VM ER R +  LP +LWKK +MK   S++RP I E+FV +LM   D   E+      + F+  HL KC+  L  +V+  +  S+  Y+ +YE  L+ Q QLLY RE++++D++   LQ       D   + A+   S++ EV  LRA+V ++ E+     Q I  E R+ Y+S++  LFS   +QK ++D Y   +     + +  VR E   ++ K++ K    +T D +     L   + L  L+ +N  L  ++ +++    W     +   Q+ + + ++     K     V+M S++   I+ +EL+ +K  +   + E    ++ + K+ ++  D KH + ++  + +++   +   ++QL  ++ ++++ I  +S  L +  +  +     S +++  ++  L  ER +K  AF +VD L  Q++  E A +    N+                  +NG T   S+        RP T 
Sbjct:   14 ACQIT----QKNAVLGALKQTSVSFWAEYSNKSPKAAECLTLRASRGDSCA-RDRLAGAFVSIQLEKTHLRDEMLNSFVKKKELMSTLMSNPEEVFRIKRKMITEFCQKFSLVMSQCCVRSQIIALCYSLTSLLDQLPDISQTHFVIGEAGEIQKGADEEKGFQH---DPRTFQVRPRQLLSADGKTLLNLWFIPHYTEVLFMFKTLEEKACCQALQHTLMIVSALHDIVFYLVSLASL--GNPKRS-------LDSSD----------------------ELKLTADWGGS--ESIRAELWDIQQQVDSLSEPNSPEVVGRYLQLRREVLFLRFDVAVRCTIREAFLSSGVISAYQSVSDNMSHALSVLSDSLKRSDS---QLPLPQPLDSCSPESQRIFPWRSFLACHGLHPLEPILDILP-IEFTMQLCLSGLNDRSRMEANGAMLGVSLCLDDMLRSDRDAAPLQLQGQADSDITVEN-DNELLHSTED------------VESVSRKP------KEIMPKAHNPIQALTQQKGFLLLWKQLEVFKDSWARQQLGVEQITSVALFNQFSLIYRTEIYYPSMQALAQQME-KEQEYETLLLHNQSFQAPPGATEVDVKTWQLLSLLESTECDMVRAVQRRINKELTLVMSERARHDTALPAELWKKDSMKHCFSLERPQIVENFVQQLM---DGGKER---EGEVVFSMAHLQKCVSELGSAVMSRECSSFLLYSQFYEQLLQQQGQLLYQREQDVKDLEAAHLQAN-----DPYCKAAELCRSVMAEVITLRARVTQLEEEQKCVRQQINLEYRKRYDSLLHQLFSTCIQQKARLDKYHVRMDHDVKQLVSTVRREGVDKIIKLRNK--LSITKDGDSVNSKLSEKEILEDLYLENSQLSGLLYKLRVFHRWRQVVGQAKLQRELLQCQQSEISCKLEALAVKMTSQEGEMIIKQELEAVKAAMMQCKTEYEHTKQQIVKQTQQLQDVKHRSVQEVRSQQELESFRMQSVEQLQEDMEQRDTQIRALSAQLEKTSRESELQQHHSHKQIKKVQNQLNHERSLKLEAFQRVDKLQHQIHSMETALSKHVSNSGCKTASSSRASDRKKSAVVNGFTDSTSEDTDTETALRPKTA 1071          
BLAST of Transmembrane protein vs. Ensembl Cavefish
Match: ccdc162 (coiled-coil domain containing 162 [Source:ZFIN;Acc:ZDB-GENE-131121-612])

HSP 1 Score: 104.76 bits (260), Expect = 1.658e-25
Identity = 53/130 (40.77%), Postives = 89/130 (68.46%), Query Frame = 3
Query:   54 LEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYK 443
            LE  L  ++  L+++IE N+  +G+ +K  S +++PKD  +FR +R+ +LQ+ L    ++P+  QA V++ EL SC  +EYT +S+PLL+HQ+F DR  ++   KY  +LRWKR+C ++ I+E +YP+YK
Sbjct:    8 LEAELSLQLQALRTEIENNE-THGLFTKSYS-VHIPKDVSYFRTERQQVLQKGL----KKPVVSQAGVIQKELESCLGQEYTPESLPLLLHQFFTDRTYQLAQFKYQLMLRWKRFCRHSIILEQLYPQYK 131          
BLAST of Transmembrane protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009936.1 (pep scaffold:Pmarinus_7.0:GL484636:314:10512:1 gene:ENSPMAG00000008988.1 transcript:ENSPMAT00000009936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 4.583e-38
Identity = 87/348 (25.00%), Postives = 180/348 (51.72%), Query Frame = 3
Query: 2190 KILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIG-----DNVQDFGLPLPVVEKLLIAVNADESVL-KNIYFLEFHESLSIICHVTESLEWCFKEILYNCKP---TTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRN----TRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEML 3194
            +++D Y +AY ++ + +ER  ++Q + + ++++PR +  S  F   YR+E   L+    +   ++++Q+   R+Y + +       N  D+GLP  +V    IA+ +  S   + +  LE H SL ++  VT +L     E+     P    + T  + +E+++         + ++  + Y   V R+LF    + +P  + +L    +   ++R+    T G +  R    ++ +  L ++++LR R+ ++  E+ +LA++Y+     +G++E HLYLRP+ F       G    +  ++++   D D+++D+F PS LPLAI+E+DE  + + SF    S+M++L
Sbjct:    1 QLVDCYFQAYEHSLDGEERVALAQIIADTVHQRPRFEQRSIDFAETYRMERACLQTLHQLLVGVMDRQVAAMRDYARSVWRDGERGNTLDYGLPPRIVPTEPIALASTSSAATRPLSLLEVHPSLGLVWRVTHALRLACSELSPPPSPQRLPSGTERLRVEQRVLRAALATWAAAETPELDYGAAVHRELFGEGLLGDPWCVCELGSALVGAGETRHGGEETPGQRAERA---LSSWALLLDVLSLRHRIAESAHETALLARLYKGLVGRMGFEECHLYLRPVPF--EFASHGDGAGEGPVFLTATLDADASLDRFIPSQLPLAISELDEAPVKRLSFHSLDSLMQVL 343          
BLAST of Transmembrane protein vs. Ensembl Nematostella
Match: EDO39453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W2])

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 514/1517 (33.88%), Postives = 825/1517 (54.38%), Query Frame = 3
Query: 1806 YLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGD-FDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIG--DNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDK--RSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGAN-------SNFSVPISAQAGPTPL-ALDSKRAD-SFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKT--SGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNL-----------GNQPSS-------DDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLP-DLAHQGPF-ADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGA-KVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHY---------LTSTEKELNDLRKTL 6218
            Y+ NTP ++R+++  FM+F+E+ENHDDFY  E+GR+HV+DQ G++I YD A+ DF+ LE +LLL+AS FI K+K  R+     + R        GD  DI  Y+H ++DRF VL D+WTN  A LE K+++LD Y EAY + F+  E++ ++Q M N++  +PR D  + Y V  YR EC  LR+  ++ + +L+KQID +REY++ +   D    FGLP  V+ +  IAVN     L+ IY LEFH SL++   + ++L   FK      KP +    I +E++M E++Q E D +   G  +  Q Q+DLFS  F+E+P+ + ++A   +   +++   G K  + ++  L   + R+ E+ITLR RL+ A+ E+ V+ KIY+R+A ++G+DE+H +LR + F+ A+ K  A+       I+ IQ+DDS +D++TP+ LPLAI E+DE  +G FSF+ R   M ++   GV+ L +VL  Q+CHKN + + +   + C   +  +K +   A        EKS  +G +       S  S   S +  P+ L A  +KR D  F +K    E F S+QLEK+  RD+ +N YI+K    G T  S  EV K+KR L++ +  +   R+ Q SL++QI+ Y  S++ ++   PT  +  F  G+  EKK++ +D+ +    DP+  + R RR+LS +G K +NLWFIPH+TE++ ++ +   +     L  ++ +V + HDI  +L   +RL  S+A+             D    S SS  VI    G  EGI                  EL EI  QI+HL +PT+   V E L  RR+  FL+ +  +SH++ +TFL+T N  A+++++ NM F  ++L+N+ R    S  + VP PL ARD   RELYP+RS + + GP+ +M+  W  I +++QL LAGL +VDR  V+GE + ++L LEDVL  G LP+      +  +  E+ +        +     +  P               G  P S       D    KL+  T+P    KL+  ++++  RL +LK  WG RKLG+  I +  ++  F K+YKI+ L  + + +  +  L  + A  G   +D +   TP G  E+ +K +Q+                                              MKE  ++ +P + E+FV +LM    ++D      +T+ FT+EHLNKCL  LA      ++  +E+YAMYYE+ L+HQHQLL+ RE+EI+  + Q+    +AT+VDV  QLAD++H  LLE+ ALRAK+ EMR+  + QE+ +RE++++++ ++VQ LFS  FE K + + +R +L+D   + + +VR +A  +M   +EKSG+ K    D +    LK   ++  + + N +L QM  +MK++ NW  T +   +  ++  +  + D+ K     V+  +E+K  +M +E   L+           L+  EKE   LR+ L
Sbjct:  762 YVHNTPADYRVDQAQFMEFSELENHDDFYSQEEGRVHVQDQRGYYITYDSALDDFKNLETELLLVASHFITKDKEFRNPKPSAKYR--------GDHLDIASYSHQQIDRFAVLLDLWTNEAAYLENKRQLLDCYFEAYQHVFDASEKKNLAQVMTNVVSMRPRFDFTADYLVRIYRAECVNLRLHCNLIKGVLDKQIDEEREYLQKVCREDTSGLFGLPHRVIPQQHIAVNISRPALQYIYMLEFHPSLALAAKIPKALSHVFKTFQNLQKPKSTGEIISMERRMLEVVQKEWDFLQPSGNDFAVQTQKDLFSEVFVEDPLFVCEVAQSLITAEENKKGGGRKSVKEKQQILTRIWSRILEVITLRHRLIMASQETSVVTKIYRRRAKEIGFDEYHAFLRIVSFDFAQTKPEADTDTVS--ITLIQEDDSRIDRYTPAYLPLAIQELDEKHVGNFSFRTREGFMHIVSDSGVDKLGVVLMTQICHKNIIISSLLRMDGCAAVIRAVKAKAATA--------EKSGGSGLSPRSSRDQSLTSRRNSVEESPSHLSAFSTKRLDREFERK--MQEVFVSVQLEKTFLRDKMLNEYIRKKEQLGVTLKSIDEVVKLKRKLIMDFNTNLQKRVTQYSLQAQIVAYTTSLLDLMGDFPTTRDAHFMIGEEDEKKSEEDDDPTP---DPKHFKSRPRRMLSVDGKKLMNLWFIPHYTEVMKMFSKEKIDTRNRALTVMLELVSSMHDICQYLCAHARLGSSTARW-----------RDC--RSWSSG-VIGADWGGTEGI----------------GAELREIQRQINHLENPTDPHEVAEFLVKRRDNLFLEVDISVSHSVRDTFLSTGNEAAYRSITDNMHFALQDLSNLPRPNMYSTHVTVPGPLGARDNLGRELYPWRSFMQRYGPFPMMYWQWYAIGDHMQLCLAGLKEVDRHVVNGEILGVSLLLEDVLQAG-LPD------MFFSKQEDEIGSSTSPRSRPATSSSRRPTSRQSDTSEDGTGVSGKDPKSAETTGYGDIPKGKLSHSTNPKAAVKLINMFLLICSRLEVLKTDWGCRKLGVNEISSTKNYRAFLKLYKIDVLQSVYQQIAAKLGLGQEYAALGVLTSDDEPLATPPGATEMELKIKQV----------------------------------------------MKENSTITKPHLVENFVLDLMAG-HMDD-----GETIEFTREHLNKCLLRLATETNLRERVCFESYAMYYESLLRHQHQLLFMREQEIKQCQDQMEANAVATVVDVHCQLADRSHEQLLEITALRAKIMEMRDSIMNQEKELREKIKKDFANLVQELFSNCFEMKNKFEEFRLFLYDDVHESLNDVRRQALEDM---REKSGSMKAVGTDPV----LKKCDQIRDIQEDNTNLGQMFLKMKTMNNWKKTRLFLRYLDSVDSLRDEADRAKRECLEVKKLAEEKAILMKQEQAALRQIAKKDCKYQALSELEKECQRLRRKL 2159          

HSP 2 Score: 266.159 bits (679), Expect = 2.851e-71
Identity = 199/661 (30.11%), Postives = 320/661 (48.41%), Query Frame = 3
Query:   90 KSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQ----------------------YFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDC------VEIKLSDDQSKSERSFTK------IPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAA----------AGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVS--GSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLS---------------------------------YLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFR 1835
            +++IEE   +     K + S+ +PKD +HFRR+RKL + +TL + + +P+  Q+EVMR E+ +    EY+ KS+PLL+HQ                      +F DRI+ ++  K+ H+LRW R+  ++  IE++YP Y++RL HIM+EY D+  R  RLA  RE  L+ +E  +  +  +D++IY RWL+C++ S+K +    R+I+W P+ H+       ++       VE K S   S++  +  +      I A  N   P+  P   A+     PL  + + L  A           +GGG+ ++E +L LP+H  +L  L   L    + Y ++MD+  I ++ADEM+L+  V R+FK  F+ QEQ+  F  YD  V   G  K           + +NWLP+I L+P+     +K + +L+   +IDELL++ +RF+       +QD+    A + +      S++V       ++ E   K+              +D          ++    +++LGL+D N  K+  S +QGAY+S                                 Y    H+ I+     CL ILNYFRSV+RT+ IND GLSL  G         RS      H GG   IG+H Y+ NTP ++R
Sbjct:   28 QNEIEEGNFLRPGQVKALGSVPLPKDIEHFRRERKLAVSKTLTIREAQPLINQSEVMREEMETSVKSEYSPKSIPLLLHQKRTVELHFQIFAVSSTRQKRQKFFSDRIEHLVQCKHMHMLRWARFNEHSKAIENLYPAYQQRLSHIMEEYHDAFQRARRLAVAREASLAGSESAMGAVTVEDLLIYTRWLVCYMHSVKRMHSFLRVIEWLPVMHKNTIKPQEIEKDESPVEVESKPSGPPSRARGNLKRIMSQVAITAHLNVLRPMAKP--DASLPPPPPLSLSPYQLVSATNPSVAAAAAASGGGLASNEVHLVLPMHETNLPKLMLLLEFLMSCYSVDMDIHQINTNADEMDLFTMVTRRFKKVFSKQEQLRTFPIYDTSVEELGVAKVRSQGALYTFKQTSNWLPFIMLRPEKDSNQIKAMAKLKQQGQIDELLKSHSRFL------HIQDSSNDTAAVWKKIFTYASSSVTRD----DVLEFDTKV--------------SDEDLGGSDQGGFDLGTAVELLGLEDDN-AKNQGSMLQGAYMSFLLLRHLRLRDLQRTVGVEISRISCSRWSHACIYFKACHVTIK---YECLGILNYFRSVQRTMTINDGGLSLEGG-------KQRSSKYQVFHGGGISGIGNHQYVHNTPADYR 651          
BLAST of Transmembrane protein vs. Planmine SMEST
Match: SMESG000002927.1 (SMESG000002927.1)

HSP 1 Score: 4606.97 bits (11948), Expect = 0.000e+0
Identity = 2281/2281 (100.00%), Postives = 2281/2281 (100.00%), Query Frame = 3
Query:   42 GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL 6884
            GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL
Sbjct:    8 GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL 2288          
BLAST of Transmembrane protein vs. Planmine SMEST
Match: SMESG000002927.1 (SMESG000002927.1)

HSP 1 Score: 4536.87 bits (11766), Expect = 0.000e+0
Identity = 2257/2281 (98.95%), Postives = 2257/2281 (98.95%), Query Frame = 3
Query:   42 GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL 6884
            GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPIT                        VGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL
Sbjct:    8 GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPIT------------------------VGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL 2264          
BLAST of Transmembrane protein vs. Planmine SMEST
Match: SMESG000002927.1 (SMESG000002927.1)

HSP 1 Score: 4536.48 bits (11765), Expect = 0.000e+0
Identity = 2254/2281 (98.82%), Postives = 2254/2281 (98.82%), Query Frame = 3
Query:   42 GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL 6884
            GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFV                           STELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL
Sbjct:    8 GLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFNDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFV---------------------------STELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL 2261          
BLAST of Transmembrane protein vs. Planmine SMEST
Match: SMESG000078557.1 (SMESG000078557.1)

HSP 1 Score: 1549.64 bits (4011), Expect = 0.000e+0
Identity = 896/2293 (39.08%), Postives = 1396/2293 (60.88%), Query Frame = 3
Query:   54 LEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATF----NDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIY----MNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYT-PQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLY-TLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLL---LGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDL---------------------NDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLL 6830
            L++ L+ +++ELK+QIEENQL+YG+ +K  SSIY PKDP+ + ++R+L L+R +        K+ A+ ++LE+  C+  EY +KS+ LL++QYF +R++ ++  K + +LR+KRYCIN  + E I   Y  RL  I  EY D  +R +RL   +EGF+ N++QG++E+  DD+ IY++WLI H+ +++ +    +II+W PI +RK  +A   +      +D  +KSE ++  I +T     N E+ L       T  +T+    ++ NLS AA+GGG   DE+NL  PLHTND+++L   LI +C +YGI MDV  I+++ADEMELY+ V+R+FKT FN+QEQM  FK YD I S  E+WG+D+  + +LKPANW P+ K  PK +L   +Y+ +LR +   DE L  A+ F+  +N +  Q  LRHHAL++QH PV+++ AV+++ +G +I++I K IY    +N   F   +   NDSS     HDNY F + +Q+LGLD+S ETKDD S+VQGAYLSYLHLR LKIRD+QRTCLSILNYFRSVERT+VI++   +  +    R  +     SS         N+G+HGYL  T  +F+I+  DFM+  E+ENHDDFY HE+GRIHV+D  G+WI+YDVA+ DFEKLE DL+LI S +I  +K +RS++LF RK+ + E ++  +F I +Y H EVDRFGVL+D+W  HT  +E KKK+ D+ ME YN    +++R+ ++Q+++NLM+ KPRID+ S YF+ +YR E  IL  +  IF+ +L+K+I  +REY+  +    +D   P   +  LLIA N+DE  L+ ++FLEF  SLS +C + + +++    I      T VT  +  E  + + +  EI   + +   +T P + + L     I NP+++ ++  +YLK IDS+NTRG+K+ RKI+ INEF RL E+  +RFRL+    E+E L  IY  QAI LGYD FHL++R + FE A K EGAE  KP LY+S++QDDDS +DK+ P     AI+E+D V  G F+      +++ LESKG+ENL ++LK+Q CHKNA+A+GV LC+ CRPS+Y + KE+ L           +S+     + +++PISAQ+GPTPLALDS RA      D++PEA FS+QLEK P RD+ +N ++KKF      S V++EK KRD +  + + F+DRI   +L++QII YYNSII+ L  VP +  +FFQFG AF       D   N + +P+KL  R R+++ ++G K +N+W+IPHF+EILFLYRQ +D +    L N + +V  FHDI+ ++VGF +   +S ++  ++K + ++   ++    +SQ ++      +E  +++   DY+     QL  E ++++ QI HL +P +++ VI+LL+ RR   F  FE C +  L E FL+T N+  +K +   ++     + NV+    IS  L +P  +   D    +L+P+RS++ + GP  I  D   NI + +QL    +    R  ++ +F +LNL LED+L E    E+        ND E  LL   + KK  K+  + +A   V     + +  ++ K L++  +PIQ Y+ +  ++ + ++L +L++ +  +   ++ I++ + F   +K YK+  L+P+++ L     +P+    GP    D+   PKGIPE+ +    +  +I   E   I  LR +I ++ D V+K+R+ E   +  D+ K P +    S+K P +  D + +      L                      +EK + +D L ++K ++NKCLQ LA ++L + +E+YE++AMY+EN LKHQ QLL  R RE   +K++  +KE +  V+ QF LA++    +LE+N LR KV E +++   +E T+R +    +  +++NL+++ FEQ T+I V R  LH    +RI   R  A  EMNK+KE+SGAK T DDE+A RNL L+K+++     N  L Q ++RMKSLFNW + +  C+++  + +     D+ K  V +V +N++QKV+++  E  RLK  ++ TEKEL++L+ TL+KE+ ++  K+  A+ K  + K+  + KQ  I  LM+++ E N  IATM      ++K++K+V   S  +V+ L   L +ER+ K +AF KVDDLI+QVYEFEA FA+V  NT      G+   +   +++ +  T   +LR  +    PD+ +       R +TY  I++R+ IPY P H+  FRRDRV  H+++ RI ++L+
Sbjct:   12 LDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYLKKRRLKLKRQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAEND-----TDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTR----SDINLS-AASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSSQERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSG---DHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESV---RPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKV---YKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYVSSVQDDDSVVDKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--------ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIVSEFFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMK-INKIYNLPTDTNSQNIVHHLH-CDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQ---ETMTTNPSINNDNEKFLLSKKMHKKEKKEGHQHLATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETI--DMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAEKKEEEKAEGTKENESEDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLKKTTIQKQKQISDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMV--NTQSEASRGRVEKNYK-ARLLQTKTKKVDLRGNY----PDLIL-----HQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLI 2258          
BLAST of Transmembrane protein vs. Planmine SMEST
Match: SMESG000078557.1 (SMESG000078557.1)

HSP 1 Score: 1545.79 bits (4001), Expect = 0.000e+0
Identity = 894/2286 (39.11%), Postives = 1391/2286 (60.85%), Query Frame = 3
Query:   75 EIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATF----NDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIY----MNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRXXXXXXXXXXXXXXXXXXXYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYT-PQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFXXXXXXXXXXXXXXXXYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLY-TLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLL---LGXXXXXXXXXEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDL---------------------NDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLXXXXXXXXXXXHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLL 6830
            +++ELK+QIEENQL+YG+ +K  SSIY PKDP+ + ++R+L L+R +        K+ A+ ++LE+  C+  EY +KS+ LL++QYF +R++ ++  K + +LR+KRYCIN  + E I   Y  RL  I  EY D  +R +RL   +EGF+ N++QG++E+  DD+ IY++WLI H+ +++ +    +II+W PI +RK  +A   +      +D  +KSE ++  I +T     N E+ L       T  +T+    ++ NLS AA+GGG   DE+NL  PLHTND+++L   LI +C +YGI MDV  I+++ADEMELY+ V+R+FKT FN+QEQM  FK YD I S  E+WG+D+  + +LKPANW P+ K  PK +L   +Y+ +LR +   DE L  A+ F+  +N +  Q  LRHHAL++QH PV+++ AV+++ +G +I++I K IY    +N   F   +   NDSS     HDNY F + +Q+LGLD+S ETKDD S+VQGAYLSYLHLR LKIRD+QRTCLSILNYFRSVERT+VI++   +  +    R  +     SS         N+G+HGYL  T  +F+I+  DFM+  E+ENHDDFY HE+GRIHV+D  G+WI+YDVA+ DFEKLE DL+LI S +I  +K +RS++LF RK+ + E ++  +F I +Y H EVDRFGVL+D+W  HT  +E KKK+ D+ ME YN    +++R+ ++Q+++NLM+ KPRID+ S YF+ +YR E  IL  +  IF+ +L+K+I  +REY+  +    +D   P   +  LLIA N+DE  L+ ++FLEF  SLS +C + + +++    I      T VT  +  E  + + +  EI   + +   +T P + + L     I NP+++ ++  +YLK IDS+NTRG+K+ RKI+ INEF RL E+  +RFRL+    E+E L  IY  QAI LGYD FHL++R + FE A K EGAE  KP LY+S++QDDDS +DK+ P     AI+E+D V  G F+      +++ LESKG+ENL ++LK+Q CHKNA+A+GV LC+ CRPS+Y + KE+ L           +S+     + +++PISAQ+GPTPLALDS RA      D++PEA FS+QLEK P RD+ +N ++KKF      S V++EK KRD +  + + F+DRI   +L++QII YYNSII+ L  VP +  +FFQFG AF       D   N + +P+KL  R R+++ ++G K +N+W+IPHF+EILFLYRQ +D +    L N + +V  FHDI+ ++VGF +   +S ++  ++K + ++   ++    +SQ ++      +E  +++   DY+     QL  E ++++ QI HL +P +++ VI+LL+ RR   F  FE C +  L E FL+T N+  +K +   ++     + NV+    IS  L +P  +   D    +L+P+RS++ + GP  I  D   NI + +QL    +    R  ++ +F +LNL LED+L E    E+        ND E  LL   + KK  K+  + +A   V     + +  ++ K L++  +PIQ Y+ +  ++ + ++L +L++ +  +   ++ I++ + F   +K YK+  L+P+++ L     +P+    GP    D+   PKGIPE+ +    +  +I   E   I  LR +I ++ D V+K+R+ E   +  D+ K P +    S+K P +  D + +      L                      +EK + +D L ++K ++NKCLQ LA ++L + +E+YE++AMY+EN LKHQ QLL  R RE   +K++  +KE +  V+ QF LA++    +LE+N LR KV E +++   +E T+R +    +  +++NL+++ FEQ T+I V R  LH    +RI   R  A  EMNK+KE+SGAK T DDE+A RNL L+K+++     N  L Q ++RMKSLFNW + +  C+++  + +     D+ K  V +V +N++QKV+++  E  RLK  ++ TEKEL++L+ TL+KE+ ++  K+  A+ K  + K+  + KQ  I  LM+++ E N  IATM      ++K++K+V   S  +V+ L   L +ER+ K +AF KVDDLI+QVYEFEA FA+V  NT      G+   +   +++ +  T   +LR  +    PD+ +       R +TY  I++R+ IPY P H+  FRRDRV  H+++ RI ++L+
Sbjct:    2 DVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYLKKRRLKLKRQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAEND-----TDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTR----SDINLS-AASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSSQERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSG---DHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESV---RPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKV---YKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYVSSVQDDDSVVDKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--------ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIVSEFFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMK-INKIYNLPTDTNSQNIVHHLH-CDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQ---ETMTTNPSINNDNEKFLLSKKMHKKEKKEGHQHLATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETI--DMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAEKKEEEKAEGTKENESEDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLKKTTIQKQKQISDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMV--NTQSEASRGRVEKNYK-ARLLQTKTKKVDLRGNY----PDLIL-----HQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLI 2241          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch73-242m19.10.000e+028.86si:ch73-242m19.1 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
ccdc1623.385e-2536.15coiled-coil domain containing 162 [Source:ZFIN;Acc... [more]
back to top
BLAST of Transmembrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000038343.14.613e-6526.93pep primary_assembly:Xenopus_tropicalis_v9.1:5:748... [more]
back to top
BLAST of Transmembrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ccdc1620.000e+030.48coiled-coil domain containing 162 [Source:MGI Symb... [more]
Ccdc1621.148e-9834.59coiled-coil domain containing 162 [Source:MGI Symb... [more]
Ccdc1625.208e-8927.36coiled-coil domain containing 162 [Source:MGI Symb... [more]
Ccdc1625.822e-8927.36coiled-coil domain containing 162 [Source:MGI Symb... [more]
Ccdc1627.175e-6727.07coiled-coil domain containing 162 [Source:MGI Symb... [more]
back to top
BLAST of Transmembrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q0VG85|CC162_MOUSE4.073e-8827.36Coiled-coil domain-containing protein 162 OS=Mus m... [more]
back to top
BLAST of Transmembrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LFV11.876e-6848.62DUF4549 domain-containing protein OS=Opisthorchis ... [more]
A0A4V3SDX31.849e-6848.71DUF4549 domain-containing protein OS=Opisthorchis ... [more]
A0A1S8X9701.759e-6348.63DUF4549 domain-containing protein OS=Opisthorchis ... [more]
A0A074ZYC61.407e-6347.29DUF4549 domain-containing protein OS=Opisthorchis ... [more]
A0A068Y2V32.505e-5346.07DUF4549 domain-containing protein OS=Echinococcus ... [more]
back to top
BLAST of Transmembrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000000633.25.989e-10826.67pep primary_assembly:Astyanax_mexicanus-2.0:9:2459... [more]
ccdc1621.658e-2540.77coiled-coil domain containing 162 [Source:ZFIN;Acc... [more]
back to top
BLAST of Transmembrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009936.14.583e-3825.00pep scaffold:Pmarinus_7.0:GL484636:314:10512:1 gen... [more]
back to top
BLAST of Transmembrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO394532.851e-7133.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002927.10.000e+0100.00SMESG000002927.1[more]
SMESG000002927.10.000e+098.95SMESG000002927.1[more]
SMESG000002927.10.000e+098.82SMESG000002927.1[more]
SMESG000078557.10.000e+039.08SMESG000078557.1[more]
SMESG000078557.10.000e+039.11SMESG000078557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009231 ID=SMED30009231|Name=Transmembrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=6957bp
CTATATAAATCTTATATGTAATGGAAGAAAACGAAGAAGAAGGATTAAAA
ATTCTTGAAGATAGTTTAAGAAGTGAAATAATTGAATTAAAAAGCCAGAT
CGAAGAAAACCAACTCGTCTATGGAATCCCAAGTAAAGGAATGAGCTCAA
TTTACGTGCCAAAAGATCCAGATCATTTCCGACGTCAACGCAAATTAATT
TTACAACGAACTCTACAAGTTACAGACGAAAGACCAATTAAAGTACAAGC
AGAAGTGATGCGATTAGAGCTAATCAGTTGTGATTCGAGAGAATATACGG
AGAAATCGGTTCCGTTATTAATTCATCAGTATTTTCTCGATAGAATCCAG
GAAATGTTGGCATCAAAATATGCACATTTGCTTCGTTGGAAACGGTATTG
TATCAATACTGCAATCATCGAGTCGATTTATCCAGAATACAAAGAGAGAC
TGCAACACATTATGGATGAATATCTCGACTCAAGCTCAAGATGTCACCGC
CTGGCAACCTGCCGAGAAGGTTTTCTCAGTAATACCGAGCAAGGCGTTGA
TGAACTAAACACTGACGATATGATAATATATTTGCGATGGCTAATCTGCC
ATTTGCAGTCATTGAAGTTGCTCATTCAAACTAATCGAATTATCCAGTGG
TTTCCAATTGCTCACAGAAAGGAATTTTCTGCTACTATTGTTGATTGTGT
CGAGATCAAATTATCGGATGACCAAAGCAAATCTGAGAGATCATTTACAA
AAATTCCAGCAACATTTAACGATGAGGCACCGTTGCCGCCTCCTTTGGTG
GCAGCTACGTTTGTATCTACAAAACCTCTGAAACCAACTGAATTCAATTT
GAGTTTAGCCGCCGCTGGTGGAGGAATGGTAACAGACGAGAAAAATTTAA
ATCTTCCATTGCATACGAATGATTTGAACCACTTGAGGTCCCATTTGATA
GTATACTGCAATATGTATGGAATAGAGATGGACGTCGTCGGTATCCAATC
ATCTGCTGATGAAATGGAGCTCTACGCATCAGTGAACAGAAAGTTCAAGA
CTCATTTCAATCTGCAGGAGCAAATGAATATATTCAAGACCTACGATTTT
ATTGTGAGTGGATCAGAGAAATGGGGGCTAGATACATACACAAAATGTGT
ATTAAAACCCGCAAACTGGCTACCATATATCAAACTGAAACCAAAAACGC
ATCTGACAGTTGTAAAATATATCACTAGGCTTAGAGCCGATAATAAAATT
GATGAACTGCTGAGGGCTGCTGCAAGATTTATCAGTTTGACTAATTGTGA
TCGAGTCCAGGATGCACTACGCCATCACGCGCTACTCGTGCAGCATCCAC
CTGTTATCCACAGTGCAGCAGTCATATCTCATCGGCAAGGAATCAACATA
TCTGAAATATTTAAGAAGATTTACATGAATCAAGAATTATTCAATCCATC
CAACCCTACAAAAAATGACAGTTCCAGTATTAATGAAACCCATGACAATT
ATGAATTCAATCAAACCATGCAGATGCTTGGTCTCGATGACTCTAATGAA
ACGAAAGATGATCCCAGCAGTGTCCAGGGAGCATATTTGAGTTATCTACA
TCTAAGACATCTGAAAATTCGAGATTTACAACGAACATGCTTATCGATCC
TGAATTATTTCCGGTCAGTAGAGAGGACAATTGTCATCAATGATCAAGGT
TTATCATTGAACAATGGCGTTGGAGATCGAAGTTATCAAAACCACCGATC
AGGTTCATCCATCCCTGGTCATCAAGGCGGAGGAGGAAATATTGGATCAC
ATGGCTATTTGTTCAATACTCCCAGGGAGTTTCGGATCAATGAAAATGAT
TTCATGCAGTTTGCAGAAGTGGAGAATCATGATGATTTTTACTTCCATGA
AGATGGTCGAATTCACGTTCGGGATCAAACTGGCCATTGGATTATTTACG
ATGTTGCCGTATCTGATTTCGAGAAACTCGAACATGATCTGCTACTAATC
GCATCGGTATTTATCGGTAAAAACAAAACCCTTCGAAGTGCGTCTTTGTT
CAAACGAAAAAGACAAAGATTAGAAGAAAGTCAATCTGGAGATTTTGACA
TAGGTCAATATGCCCACCATGAAGTTGATCGGTTTGGTGTGCTGTTTGAC
ATTTGGACCAATCACACGGCTTTGCTGGAGTGCAAGAAAAAGATTCTCGA
CATTTACATGGAGGCCTACAATAACACATTCAATCGAGACGAGAGGCGTT
TGATGTCCCAATCTATGGTGAATCTTATGTACAAGAAGCCGAGGATCGAC
GTCGAGTCGGCATACTTCGTGACGGCTTATCGGCTGGAATGCACAATTTT
ACGCATGCAAGCCGATATATTTCGCACGCTGCTCAATAAACAGATCGATA
ATCAACGGGAATACATCAAAATGATCGGGGATAATGTCCAAGATTTTGGT
CTACCTTTGCCGGTCGTAGAGAAGTTGCTCATAGCTGTCAATGCTGACGA
GTCTGTACTGAAAAATATTTATTTCTTGGAATTTCATGAATCCTTATCGA
TAATATGTCACGTAACTGAGTCCCTGGAATGGTGTTTCAAGGAGATTCTT
TACAACTGCAAACCGACCACAGTTACCCATGAAATCTTGCTGGAGAAGAA
AATGTACGAAATAATGCAAGTGGAAATCGACTCAATGGATAGCCTAGGGG
TGTCATACACCCCTCAAGTTCAGCGTGATTTATTTTCTGGGTTTTTTATT
GAAAATCCAATCATGTTAACTCAACTGGCCGATGAATACTTGAAGAATAT
CGACAGCAGGAATACCCGTGGAGACAAAAGATCGCGAAAAATTAAACTAA
TAAATGAATTTGGCAGACTTTACGAAATAATCACTTTACGTTTTCGATTG
TTAGACGCAACGTGGGAAAGTGAAGTTTTGGCCAAGATTTATCAACGACA
GGCGATTGACTTAGGCTATGATGAGTTCCATTTGTATTTGAGGCCGATTC
AGTTTGAAGCAGCTAAAAAGAAAGAAGGTGCAGAATTGGCGAAACCATTA
TTGTACATCTCTACAATTCAAGACGATGACTCGGCAATGGACAAATTTAC
ACCGTCTGCCCTCCCATTAGCGATCAATGAAGTTGATGAAGTTGGGATGG
GGAAATTTTCCTTCAAAGGTCGCACAAGCGTGATGGAAATGCTAGAATCA
AAAGGAGTTGAAAATCTAATGATCGTCCTGAAAATACAGTTATGCCACAA
GAATGCTCTAGCTGCCGGGGTGTCCCTATGCAATGCATGCAGACCCTCAT
TGTATACATTGAAGGAGAGAGATCTTGATGCCTGCAATCCAACTGATTTA
CGCTCCGAAAAGTCTACGACAACTGGAGCTAATTCGAATTTCAGTGTTCC
CATATCTGCTCAAGCTGGCCCAACTCCTTTAGCGCTTGATTCTAAAAGAG
CTGATTCTTTTAATCAGAAAGATGCGCATCCTGAAGCCTTTTTCTCCATA
CAATTAGAAAAAAGTCCATGTAGAGATCGAGCAATGAATATTTACATTAA
GAAATTTAGTGGAACCGGCAAGACTAGTGGAGTTGAGGTCGAAAAAGTTA
AAAGAGATCTCGTTCTGAGCTACATTGATGATTTTTTTGATCGAATCCAA
CAAGCGTCTTTGCGCTCGCAAATAATTTATTATTACAATTCAATAATCCA
CGTTCTGAAACTGGTACCAACCGTATCGGAAAAATTCTTTCAATTCGGTG
ATGCATTTGAGAAAAAGAATGATCCAGAAGACAATATGAGCAATGAAGAG
ATTGACCCACGAAAACTTCGTAAAAGAGCCAGGCGGATTTTGTCCGAAAA
TGGATCTAAATTTCTTAATCTATGGTTTATCCCACATTTTACCGAGATCT
TGTTTCTTTATCGGCAACGCGATGATGAACGGACGACTGAAAATCTTAAA
AATTTGGTTAACATTGTTGGAAACTTTCATGATATTCTTCATTTCCTAGT
TGGATTTTCGAGGTTACAAATTTCGTCAGCAAAAATCAGCACTGAGTTGA
AGGCAGAAAATGTCGATGTCAACGATTCTATTGAACACAGCTTATCTAGT
CAATTTGTCATTCAAATTGCGCAAGGCGCAGAAGAGGGTATAGAAATAAA
TCGACCCCGTGATTATGATGGTGGGGTCATGTCACAACTAAGTACCGAAC
TGATTGAGATAGATCATCAAATCAGTCATCTGATGGATCCAACTGAGGTG
AAGGCAGTCATTGAATTATTATCTACCAGGAGGAATGTCACGTTTCTGAA
ATTCGAGTACTGCATTAGTCATGCACTTCTTGAAACCTTTCTGGCAACAA
GAAATGTTAAAGCGTTTAAAGCTGTCTCTGCTAATATGAAGTTCCCGTTT
GAAGAGTTGACAAATGTACAACGAGCGACAACGATCTCATTCAGATTGAA
TGTTCCTGAACCATTGGAAGCTCGAGATCAAAGAGCCAGAGAGTTATATC
CGTATAGGTCAATTATCAACCAACTCGGTCCTTACTTGATAATGCATGAT
TTCTGGAAGAACATTCAAGAAAACATTCAACTTGTCTTAGCAGGACTGAG
CGACGTCGATAGACCAACTGTTCACGGTGAATTCGTGTCACTAAATCTTT
GTCTTGAGGATGTTCTGGCCGAGGGAAATCTGCCTGAATCGCGTGCTGGA
AGGAAACTGAATATGAACGATTTTGAAAATGTATTATTACTAGGCAAAAA
GTTCCATAAGAAAGATAAAAAAGAAGTTGCTCTTGTCCCTGTGGATAATT
TAGGAAATCAGCCATCGAGCGATGATAAAAATAAAAAATTAAACATTATA
ACCCACCCAATCCAGTGTTACAAGTTAATGAGGAATTATATTATTCTTTC
CAAACGATTGAATTTGTTGAAGAACTTTTGGGGGGCTCGAAAACTGGGAC
TGGAGGCTATTGAAAATCCTGATGATTTCAATATGTTTAACAAAATCTAC
AAAATTGAAAAACTGTATCCTTTGATGAAAAGTCTATGCATTCAATACCG
TTTGCCAGACCTTGCCCATCAGGGCCCATTTGCAGATACAGACATATTTG
TCACCCCAAAGGGAATTCCAGAAATCGTTGTCAAACAAAGACAATTAGGG
AAAATGATCGAAACCTTTGAGAGCACAATGATCGGGGATTTAAGGAAAAG
AATTATACGCCAGACCGATCAAGTAATGAAAGAAAGAAATCGCGAAGAAG
GAAATTTGCCATTAGATCTATGGAAAAAACCAGCAATGAAAGAAGCAATA
TCTGTAAAGAGACCTGTGATTGCTGAAGATTTTGTAAGTGAGTTGATGCA
GAATACTGATTTGAATGATGAAAAAACCCTAATCAGTGATACTTTGACAT
TCACCAAAGAACATTTAAACAAATGTCTACAGAATTTGGCCATTTCTGTT
TTACATATGCAAAAGGAGTCTTATGAAAATTACGCAATGTATTACGAGAA
TCAGCTGAAACATCAGCATCAGCTGTTATACGCTAGAGAAAGAGAAATTG
AGGATATGAAGCAGCAGTTATTACAAAAAGAATTAGCTACGATAGTTGAC
GTTCAATTTCAGCTTGCTGATCAAGCTCATAGTCTATTATTAGAGGTCAA
TGCATTGCGTGCAAAGGTAGCAGAAATGAGAGAAGATAGCTTACAGCAAG
AACAAACAATTCGCGAAGAAGTTCGGCAAGAGTACAATTCAATGGTACAG
AATCTGTTTTCAGTTGCATTTGAGCAAAAAACTCAAATTGATGTTTATCG
AGAATATCTGCATGATGCGACATTGAAACGAATTCAAGAGGTCAGGACAG
AGGCAGCCATTGAAATGAATAAAGTTAAGGAAAAAAGTGGAGCGAAAGTG
ACTGCAGATGATGAACTGGCGGAAAGAAACCTGAAATTATCAAAAGAATT
GACATCATTGCACCAACAAAACATCCATTTGAAACAAATGATGAGTAGAA
TGAAATCTCTTTTCAACTGGCATCATACCTTTATAAAATGCAATTTCCAA
AAAGCGATTGCAAAAATTGAAAAAGACAGAGATAAATACAAAAACTCAGT
CACCGTGGTGGAAATGAATAGTGAACAGAAAGTCCAGATAATGGGAGAGG
AGCTTGATCGACTTAAACATTACTTGACAAGCACTGAAAAGGAACTAAAT
GATTTAAGGAAAACCTTGGATAAGGAAATGAAAGAGAAAATGGATAAAAA
GCACGCGGCGGAACGTAAAGCGGCGACAGATAAACAGATGGCGTTGGTGA
AACAAATGCATATAGATCAATTGATGTCAGAAATCACAGAGAAGAATAGC
AACATTGCCACTATGAGCAGGGTGCTAAATGAGAACATGAAGTCCCACAA
AACGGTTGCTGATAAATCAGTTCGCGAAGTCGATGCTTTGAGAAAGTCTC
TTCGAGAAGAACGAAAAATGAAGCAGAGTGCGTTTACAAAAGTTGATGAC
TTAATTTCTCAGGTATATGAGTTTGAGGCGGCATTCGCTATAGTCAAGGG
CAACACGCCTATCAATGGGGTCACGGGCAAGAACAGTGATTCTATCAGTT
GTTCGCAAATCAGCAGACCGAGTACAGGAATAAGCAATTTGCGGTCGGGT
TTCAAGCCGATCACTCCAGATATGAAGGTTTCAACAGATAAATCGAGACC
ACGTCCCATTACATATGGAGATATCCTGCGTAGATATCCGATACCGTACG
CTCCTGATCACTACCGAGACTTCCGCAGAGATCGGGTCGGTACCCATCAA
TTACGTAAGAGAATTGCTGATCAGTTGTTAATGAACCTGGAACCAGAAAA
TCACGAACAACTGACCAAAACCAACCGGGCCTTGTAATTTTTAATGCCAA
TAAGATACAGTATTCCGATTTTATTCGATTGTAATTCCCGTTTCAGTCAT
TCAATTA
back to top

protein sequence of SMED30009231-orf-1

>SMED30009231-orf-1 ID=SMED30009231-orf-1|Name=SMED30009231-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2289bp
MEENEEEGLKILEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDP
DHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLL
IHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDE
YLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKL
LIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATFN
DEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTN
DLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQE
QMNIFKTYDFIVSGSEKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKY
ITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAA
VISHRQGINISEIFKKIYMNQELFNPSNPTKNDSSSINETHDNYEFNQTM
QMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSV
ERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNT
PREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDF
EKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHH
EVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMV
NLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIK
MIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTE
SLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYTPQV
QRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRL
YEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKK
KEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKG
RTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLYTLKER
DLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQK
DAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLS
YIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTVSEKFFQFGDAFEKKN
DPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQR
DDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDV
NDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQ
ISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFK
AVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIIN
QLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLA
EGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSS
DDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENP
DDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIP
EIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDL
WKKPAMKEAISVKRPVIAEDFVSELMQNTDLNDEKTLISDTLTFTKEHLN
KCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQL
LQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREE
VRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMN
KVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNW
HHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKH
YLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQ
LMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKM
KQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRP
STGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRD
FRRDRVGTHQLRKRIADQLLMNLEPENHEQLTKTNRAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR029376DUF4549
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process