ptf-2 protein

Overview
Nameptf-2 protein (AGZ94917.1)
Smed IDSMED30009229
Length (bp)866
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ptf-2 protein (SMED30009229) t-SNE clustered cells

Violin plots show distribution of expression levels for ptf-2 protein (SMED30009229) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ptf-2 protein (SMED30009229) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ptf-2 protein (SMED30009229) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009229

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009229h1SMcG0008214 SmedASXL_003065SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30009229h1SMcG0008214 dd_Smed_v4_29462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009229h1SMcG0008214 dd_Smed_v4_29462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009229h1SMcG0008214 dd_Smed_v4_29462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009229h1SMcG0008214 dd_Smed_v6_29462_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30009229h1SMcG0008214 KF487102smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30009229h1SMcG0008214 OX_Smed_1.0.12285ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ptf-2 protein vs. Ensembl Human
Match: PTF1A (pancreas associated transcription factor 1a [Source:HGNC Symbol;Acc:HGNC:23734])

HSP 1 Score: 117.087 bits (292), Expect = 3.852e-30
Identity = 68/143 (47.55%), Postives = 87/143 (60.84%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCG-------SLEPIDCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL+++D                 G     +  S  QK+I+  +   S      D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  165 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIR---TAKVWTPE 304          
BLAST of ptf-2 protein vs. Ensembl Human
Match: FERD3L (Fer3 like bHLH transcription factor [Source:HGNC Symbol;Acc:HGNC:16660])

HSP 1 Score: 79.337 bits (194), Expect = 1.580e-17
Identity = 37/57 (64.91%), Postives = 48/57 (84.21%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKS 517
            RQAANIRER+RM ++NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL++S
Sbjct:  103 RQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLES 159          
BLAST of ptf-2 protein vs. Ensembl Human
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 66.6254 bits (161), Expect = 3.750e-13
Identity = 33/58 (56.90%), Postives = 44/58 (75.86%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            R  AN+RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD
Sbjct:   43 RVMANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQSD 99          
BLAST of ptf-2 protein vs. Ensembl Human
Match: TWIST2 (twist family bHLH transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:20670])

HSP 1 Score: 65.855 bits (159), Expect = 1.177e-12
Identity = 32/55 (58.18%), Postives = 43/55 (78.18%), Query Frame = 2
Query:  356 ANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            AN+RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD
Sbjct:   71 ANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQSD 124          
BLAST of ptf-2 protein vs. Ensembl Human
Match: TWIST2 (twist family bHLH transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:20670])

HSP 1 Score: 65.855 bits (159), Expect = 1.177e-12
Identity = 32/55 (58.18%), Postives = 43/55 (78.18%), Query Frame = 2
Query:  356 ANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            AN+RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD
Sbjct:   71 ANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQSD 124          
BLAST of ptf-2 protein vs. Ensembl Celegans
Match: hlh-13 (Helix-loop-helix protein 13 [Source:UniProtKB/Swiss-Prot;Acc:Q20561])

HSP 1 Score: 75.485 bits (184), Expect = 1.260e-16
Identity = 36/57 (63.16%), Postives = 46/57 (80.70%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKS 517
            RQ A+IRER+RM SIN AF  LR +IPT PYEKRLSK+DTL LAI+YI  L +++++
Sbjct:   43 RQTASIRERKRMCSINVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVLRT 99          
BLAST of ptf-2 protein vs. Ensembl Celegans
Match: hlh-15 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q18590])

HSP 1 Score: 58.9214 bits (141), Expect = 3.387e-11
Identity = 26/50 (52.00%), Postives = 37/50 (74.00%), Query Frame = 2
Query:  365 RERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIK 514
            RER R++S N AF  LR  +PT+P EK+LSK++ LR +I+YI FL  L++
Sbjct:   40 RERIRVESFNMAFSQLRALLPTLPVEKKLSKIEILRFSIAYISFLDNLLQ 89          
BLAST of ptf-2 protein vs. Ensembl Celegans
Match: hlh-8 (Twist-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q11094])

HSP 1 Score: 58.151 bits (139), Expect = 3.421e-10
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDC 523
            R  AN RER+R + +N+AF  LR  IP+MP +K +SK+ TLR+A  YI FL E+ K+ C
Sbjct:   22 RACANRRERQRTKELNDAFTLLRKLIPSMPSDK-MSKIHTLRIATDYISFLDEMQKNGC 79          
BLAST of ptf-2 protein vs. Ensembl Celegans
Match: hlh-6 (Helix-loop-helix protein 6 [Source:UniProtKB/Swiss-Prot;Acc:Q10007])

HSP 1 Score: 57.7658 bits (138), Expect = 1.367e-9
Identity = 29/54 (53.70%), Postives = 40/54 (74.07%), Query Frame = 2
Query:  359 NIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            N RER R++++N+ +E LR H+P    EKR+SKVDTLRLAI YI  L  L++S+
Sbjct:  179 NERERCRVRNVNDGYERLRKHLPVHFDEKRISKVDTLRLAIRYIKHLDNLLRSE 232          
BLAST of ptf-2 protein vs. Ensembl Celegans
Match: ngn-1 (NeuroGeNin [Source:UniProtKB/TrEMBL;Acc:Q95XG7])

HSP 1 Score: 55.0694 bits (131), Expect = 5.011e-9
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFL 499
            R  AN RERRRM S+N+A E LR  +P +P E +++K++TLR A  YI  L
Sbjct:   64 RDKANARERRRMNSLNDALEHLRGILPALPDEPKMTKIETLRKAQEYIASL 114          
BLAST of ptf-2 protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0081567)

HSP 1 Score: 122.865 bits (307), Expect = 2.574e-33
Identity = 74/133 (55.64%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAI-RSAECSIEQKIILSLKHHNSKDFRADVICGHSLSW--RNDREP-TNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSINEAFEGLR HIPT+PYEKRLSKVDTL+LAISYI FL E++K D    EP    G ++ R+ +    +KIIL       KD    V   HSLSW  + DR P + ++ RT     WTPE
Sbjct:   83 RQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEP----GLSLQRNYQKEPPKKIIL-------KDRTGGVA--HSLSWYRKGDRYPGSKLYART-----WTPE 197          
BLAST of ptf-2 protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0334670)

HSP 1 Score: 122.479 bits (306), Expect = 4.518e-33
Identity = 74/133 (55.64%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAI-RSAECSIEQKIILSLKHHNSKDFRADVICGHSLSW--RNDREP-TNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSINEAFEGLR HIPT+PYEKRLSKVDTL+LAISYI FL E++K D    EP    G ++ R+ +    +KIIL       KD    V   HSLSW  + DR P + ++ RT     WTPE
Sbjct:   88 RQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEP----GLSLQRNYQKEPPKKIIL-------KDRTGGV--AHSLSWYRKGDRYPGSKLYART-----WTPE 202          
BLAST of ptf-2 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0301709)

HSP 1 Score: 88.1965 bits (217), Expect = 4.056e-20
Identity = 41/67 (61.19%), Postives = 55/67 (82.09%), Query Frame = 2
Query:  347 RQAANIRERRRMQS-INEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPID 544
            RQAAN+RER+R+QS IN AF+ LR H+PT PYEKRLSK+DTLRLAI+YI  L+E++++D   L  ++
Sbjct:  149 RQAANVRERKRIQSSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVE 215          
BLAST of ptf-2 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0344012)

HSP 1 Score: 88.1965 bits (217), Expect = 4.372e-20
Identity = 41/67 (61.19%), Postives = 55/67 (82.09%), Query Frame = 2
Query:  347 RQAANIRERRRMQS-INEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPID 544
            RQAAN+RER+R+QS IN AF+ LR H+PT PYEKRLSK+DTLRLAI+YI  L+E++++D   L  ++
Sbjct:  149 RQAANVRERKRIQSSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVE 215          
BLAST of ptf-2 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0344010)

HSP 1 Score: 86.2705 bits (212), Expect = 2.402e-19
Identity = 41/72 (56.94%), Postives = 55/72 (76.39%), Query Frame = 2
Query:  347 RQAANIRERRRMQ------SINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPID 544
            RQAAN+RER+R+Q      SIN AF+ LR H+PT PYEKRLSK+DTLRLAI+YI  L+E++++D   L  ++
Sbjct:  149 RQAANVRERKRIQRSAPTGSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVE 220          
BLAST of ptf-2 protein vs. Ensembl Zebrafish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:368662])

HSP 1 Score: 122.865 bits (307), Expect = 4.860e-33
Identity = 68/136 (50.00%), Postives = 87/136 (63.97%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLK-----HHNSKDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL++SD     P         S   +  +K+I+  +       N  D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  117 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDMPIRNP--------HSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSLSWTDEKQLKDQNIIR---TAKVWTPE 241          
BLAST of ptf-2 protein vs. Ensembl Zebrafish
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 97.8265 bits (242), Expect = 1.066e-24
Identity = 50/100 (50.00%), Postives = 62/100 (62.00%), Query Frame = 2
Query:  287 HEVTXXXXXXXXXXXXXXXXRQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPID-CSGNAIRSAECSI 583
            HE+T                R AANIRER+RM SIN AFE LRCH+PT PYEKRLSK+DTLRLAI+YI  L+E++ S C     +D C  N  ++   +I
Sbjct:   47 HEMTQQQQRCLATHHPYKVQRHAANIRERKRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLREILLSGCDPKSYVDECMKNGYKNQTNAI 146          
BLAST of ptf-2 protein vs. Ensembl Zebrafish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 78.1814 bits (191), Expect = 3.385e-18
Identity = 35/56 (62.50%), Postives = 47/56 (83.93%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIK 514
            RQAANIRER+RM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ ++++
Sbjct:   26 RQAANIRERKRMFSLNEAFDRLRRRVPTFAYEKRLSRIETLRLAIVYIAFMTDILE 81          
BLAST of ptf-2 protein vs. Ensembl Zebrafish
Match: si:ch211-246m6.4 (si:ch211-246m6.4 [Source:ZFIN;Acc:ZDB-GENE-050208-498])

HSP 1 Score: 67.781 bits (164), Expect = 3.606e-13
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQE--LIKSDCGSLEP 538
            RQAAN RER R  S+N AF  LR  IPT P +++LSK++TLRLA SYI  L    L+  DC   +P
Sbjct:   85 RQAANARERDRTHSVNTAFTSLRTLIPTEPADRKLSKIETLRLASSYISHLANVLLLGEDCRDGQP 150          
BLAST of ptf-2 protein vs. Ensembl Zebrafish
Match: scxa (scleraxis bHLH transcription factor a [Source:ZFIN;Acc:ZDB-GENE-060503-414])

HSP 1 Score: 67.3958 bits (163), Expect = 5.022e-13
Identity = 35/71 (49.30%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQE--LIKSDCGSLEPIDCSG 553
            R AAN RER R  S+N AF  LR  IPT P +++LSK++TLRLA SYI  L    L+   CG  +P    G
Sbjct:   81 RNAANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEACGDGQPCHSGG 151          
BLAST of ptf-2 protein vs. Ensembl Xenopus
Match: PTF1A (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:100494161])

HSP 1 Score: 122.094 bits (305), Expect = 5.105e-32
Identity = 68/136 (50.00%), Postives = 88/136 (64.71%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL++SD     P   SG+          +K+I+  +   S      D+    + GHSLSW ++++    N+ +    A++WTPE
Sbjct:  171 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQSDLPLRNPNTDSGHQ--------PKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLRDQNVVR---TAKVWTPE 295          
BLAST of ptf-2 protein vs. Ensembl Xenopus
Match: ENSXETT00000031930.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:55646956:55647657:1 gene:ENSXETG00000008961.1 transcript:ENSXETT00000031930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 1.601e-20
Identity = 44/75 (58.67%), Postives = 54/75 (72.00%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSA 571
            RQAANIRERRRM SIN AFE LR  +PT PYEKRLSK+DTLRLAI+YI  L +++ S    ++P       +R+A
Sbjct:   85 RQAANIRERRRMLSINSAFEELRGRVPTFPYEKRLSKIDTLRLAIAYIALLSDILSS---GMDPKTYVEEFVRTA 156          
BLAST of ptf-2 protein vs. Ensembl Xenopus
Match: ferd3l (Fer3-like bHLH transcription factor [Source:NCBI gene;Acc:100124312])

HSP 1 Score: 79.337 bits (194), Expect = 5.581e-18
Identity = 36/57 (63.16%), Postives = 48/57 (84.21%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKS 517
            RQAANIRER+RM ++NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ E++K+
Sbjct:   67 RQAANIRERKRMFNLNEAFDLLRKKVPTFAYEKRLSRIETLRLAIVYISFMTEMLKN 123          
BLAST of ptf-2 protein vs. Ensembl Xenopus
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:549260])

HSP 1 Score: 67.3958 bits (163), Expect = 3.961e-13
Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELI 511
            RQAAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA SYI  L  ++
Sbjct:   64 RQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVL 118          
BLAST of ptf-2 protein vs. Ensembl Xenopus
Match: hnrnpc (heterogeneous nuclear ribonucleoprotein C (C1/C2) [Source:Xenbase;Acc:XB-GENE-489141])

HSP 1 Score: 66.6254 bits (161), Expect = 8.388e-13
Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELI 511
            RQAAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA SYI  L  ++
Sbjct:   64 RQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVL 118          
BLAST of ptf-2 protein vs. Ensembl Mouse
Match: Ptf1a (pancreas specific transcription factor, 1a [Source:MGI Symbol;Acc:MGI:1328312])

HSP 1 Score: 116.316 bits (290), Expect = 6.243e-30
Identity = 67/143 (46.85%), Postives = 88/143 (61.54%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCG-------SLEPIDCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL+++D                S +    +  +  QK+I+  +   S      D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  162 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIR---TAKVWTPE 301          
BLAST of ptf-2 protein vs. Ensembl Mouse
Match: Ferd3l (Fer3 like bHLH transcription factor [Source:MGI Symbol;Acc:MGI:2150010])

HSP 1 Score: 79.337 bits (194), Expect = 1.147e-17
Identity = 37/57 (64.91%), Postives = 48/57 (84.21%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKS 517
            RQAANIRER+RM ++NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL++S
Sbjct:  105 RQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQS 161          
BLAST of ptf-2 protein vs. Ensembl Mouse
Match: Tcf15 (transcription factor 15 [Source:MGI Symbol;Acc:MGI:104664])

HSP 1 Score: 67.0106 bits (162), Expect = 7.677e-13
Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELI 511
            RQAAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA SYI  L  ++
Sbjct:   72 RQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVL 126          
BLAST of ptf-2 protein vs. Ensembl Mouse
Match: Twist2 (twist basic helix-loop-helix transcription factor 2 [Source:MGI Symbol;Acc:MGI:104685])

HSP 1 Score: 65.855 bits (159), Expect = 8.081e-13
Identity = 32/55 (58.18%), Postives = 43/55 (78.18%), Query Frame = 2
Query:  356 ANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            AN+RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD
Sbjct:   71 ANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQSD 124          
BLAST of ptf-2 protein vs. Ensembl Mouse
Match: Twist2 (twist basic helix-loop-helix transcription factor 2 [Source:MGI Symbol;Acc:MGI:104685])

HSP 1 Score: 65.855 bits (159), Expect = 8.081e-13
Identity = 32/55 (58.18%), Postives = 43/55 (78.18%), Query Frame = 2
Query:  356 ANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            AN+RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD
Sbjct:   71 ANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQSD 124          
BLAST of ptf-2 protein vs. UniProt/SwissProt
Match: sp|Q4ZHW1|PTF1A_XENLA (Pancreas transcription factor 1 subunit alpha OS=Xenopus laevis OX=8355 GN=ptf1a PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.214e-32
Identity = 68/136 (50.00%), Postives = 88/136 (64.71%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL E+++SD     P   SGN  +        K+I+  +   S      D+    + GHSLSW ++++    N+ +    A++WTPE
Sbjct:  121 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSEMVQSDLPLRNPNSDSGNQPK--------KVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLRDQNVVR---TAKVWTPE 245          
BLAST of ptf-2 protein vs. UniProt/SwissProt
Match: sp|Q7ZSX3|PTF1A_DANRE (Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.669e-32
Identity = 68/136 (50.00%), Postives = 87/136 (63.97%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLK-----HHNSKDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL++SD     P         S   +  +K+I+  +       N  D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  117 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDMPIRNP--------HSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSLSWTDEKQLKDQNIIR---TAKVWTPE 241          
BLAST of ptf-2 protein vs. UniProt/SwissProt
Match: sp|Q7RTS3|PTF1A_HUMAN (Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.850e-29
Identity = 68/143 (47.55%), Postives = 87/143 (60.84%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCG-------SLEPIDCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL+++D                 G     +  S  QK+I+  +   S      D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  165 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIR---TAKVWTPE 304          
BLAST of ptf-2 protein vs. UniProt/SwissProt
Match: sp|Q9QX98|PTF1A_MOUSE (Pancreas transcription factor 1 subunit alpha OS=Mus musculus OX=10090 GN=Ptf1a PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.367e-29
Identity = 67/143 (46.85%), Postives = 88/143 (61.54%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCG-------SLEPIDCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL+++D                S +    +  +  QK+I+  +   S      D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  162 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIR---TAKVWTPE 301          
BLAST of ptf-2 protein vs. UniProt/SwissProt
Match: sp|Q64305|PTF1A_RAT (Pancreas transcription factor 1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Ptf1a PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 6.574e-29
Identity = 70/155 (45.16%), Postives = 89/155 (57.42%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPI-------------------DCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL+++D     P+                   D  GN          QK+I+  +   S      D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  164 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADL----PLRGSGTGGCGGPGGSRHLGGDSPGNQA--------QKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWADEKQLKEQNIIR---TAKVWTPE 303          
BLAST of ptf-2 protein vs. TrEMBL
Match: U5YQ65 (Ptf-2 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=ptf-2 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 6.068e-110
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVLLKGM 754
            RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVLLKGM
Sbjct:   68 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVLLKGM 203          

HSP 2 Score: 141.354 bits (355), Expect = 6.068e-110
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 3
Query:  147 DGAFRIPVTLEMSNNYYHNDQPSFVTQFSASSPSTINGSDLKSYRFNTKSHRSLYRKNRNYQRKLAE 347
            DGAFRIPVTLEMSNNYYHNDQPSFVTQFSASSPSTINGSDLKSYRFNTKSHRSLYRKNRNYQRKLAE
Sbjct:    1 DGAFRIPVTLEMSNNYYHNDQPSFVTQFSASSPSTINGSDLKSYRFNTKSHRSLYRKNRNYQRKLAE 67          
BLAST of ptf-2 protein vs. TrEMBL
Match: K1Q6J0 (Pancreas transcription factor 1 subunit alpha OS=Crassostrea gigas OX=29159 GN=CGI_10017809 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.531e-35
Identity = 73/136 (53.68%), Postives = 93/136 (68.38%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVI-------CGHSLSWRNDREPTNIFKRTFKAEIWTPE 733
            R+AAN+RER+RMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YIGFL EL+KS+ G       + N+ ++A     +K+I++  H+ +   RAD I        GHSLSWR+++ P     RT  A+ W PE
Sbjct:   63 REAANLRERKRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYIGFLSELVKSNAG-------TANSNQTAYKEKHRKVIINC-HYTT---RADDIARGWLPLAGHSLSWRDEKNPGLGPNRTMFAKTWVPE 187          
BLAST of ptf-2 protein vs. TrEMBL
Match: A0A3M6UMA4 (BHLH domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00018593 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.960e-34
Identity = 65/129 (50.39%), Postives = 86/129 (66.67%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPE 733
            R AAN+RER+RMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YIGFL E+I SD            A++       +K+++  +   ++++    + GHSLSW + ++P  +     KA+IWTPE
Sbjct:   46 RHAANLRERKRMQSINEAFEGLRHHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMISSDM-------SHSQALQPTSSEQPRKVMICHRGFGTQEYGLPPLTGHSLSWTDSKKP-KLSSSIMKAKIWTPE 166          
BLAST of ptf-2 protein vs. TrEMBL
Match: A0A2B4S7X4 (Pancreas transcription factor 1 subunit alpha OS=Stylophora pistillata OX=50429 GN=ptf1a PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.513e-34
Identity = 65/129 (50.39%), Postives = 86/129 (66.67%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPE 733
            R AAN+RER+RMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YIGFL E+I SD            A++       +K+++  +   ++++    + GHSLSW + ++P  +     KA+IWTPE
Sbjct:   46 RHAANLRERKRMQSINEAFEGLRHHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMISSDM-------SHSQALQPTSSEQPRKVMICHRGFGTQEYGLPPLTGHSLSWTDSKKP-KLSSSIMKAKIWTPE 166          
BLAST of ptf-2 protein vs. TrEMBL
Match: A0A210QNY9 (Pancreas transcription factor 1 subunit alpha OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19371 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 6.960e-33
Identity = 67/134 (50.00%), Postives = 91/134 (67.91%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDC-SGNAIRSAECSIEQKIILSLKHHNSKD----FRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPE 733
            R+AAN RER+RMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL +L+++D  + + +D  SG   R        K+++     ++ D    +    + GHSLSWR+++ P++  K+   A+IWTPE
Sbjct:   67 REAANQRERKRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLRLAIGYISFLSDLVQADSDNQDRLDLNSGLQTR--------KVVIHYHTSSTVDESEMYGLPPLTGHSLSWRDEKTPSSGRKKIMAAKIWTPE 192          
BLAST of ptf-2 protein vs. Ensembl Cavefish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:103046795])

HSP 1 Score: 124.02 bits (310), Expect = 7.692e-34
Identity = 71/136 (52.21%), Postives = 89/136 (65.44%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLK-----HHNSKDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL++SD     PI  S     S   +  +KII+  +       N  D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:   94 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDA----PIRSSS----SEALNPPKKIIICHRVTRPPSPNDPDYGLPPLAGHSLSWTDEKQLKDQNIIR---TAKVWTPE 218          
BLAST of ptf-2 protein vs. Ensembl Cavefish
Match: si:dkey-34f9.3 (neurogenic differentiation factor 1-like [Source:NCBI gene;Acc:107197807])

HSP 1 Score: 97.4413 bits (241), Expect = 6.474e-24
Identity = 47/80 (58.75%), Postives = 58/80 (72.50%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPID-CSGNAIRSAECSI 583
            R AANIRER+RM SIN AFE LRCH+PT PYEKRLSK+DTLRLAI+YI  L+E++ S C     +D C  N  ++   +I
Sbjct:  122 RHAANIRERKRMLSINSAFEQLRCHVPTFPYEKRLSKIDTLRLAIAYIALLREILMSGCDPKSYVDECMKNGYKNQTNAI 201          
BLAST of ptf-2 protein vs. Ensembl Cavefish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 80.1073 bits (196), Expect = 3.702e-19
Identity = 37/54 (68.52%), Postives = 45/54 (83.33%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQEL 508
            RQAANIRER+RM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ EL
Sbjct:   17 RQAANIRERKRMFSLNEAFDELRKKVPTFAYEKRLSRIETLRLAIVYISFMTEL 70          
BLAST of ptf-2 protein vs. Ensembl Cavefish
Match: ENSAMXT00000026383.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8506334:8511562:-1 gene:ENSAMXG00000025657.2 transcript:ENSAMXT00000026383.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 8.712e-14
Identity = 35/68 (51.47%), Postives = 46/68 (67.65%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCS 550
            R  AN+RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD        CS
Sbjct:   63 RVLANVRERQRTQSLNEAFASLRKMIPTLPSDK-LSKIQTLKLASRYIDFLYQVLQSDATESRSYACS 129          
BLAST of ptf-2 protein vs. Ensembl Cavefish
Match: scxa (scleraxis bHLH transcription factor a [Source:ZFIN;Acc:ZDB-GENE-060503-414])

HSP 1 Score: 67.0106 bits (162), Expect = 4.706e-13
Identity = 35/71 (49.30%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQE--LIKSDCGSLEPIDCSG 553
            R AAN RER R  S+N AF  LR  IPT P +++LSK++TLRLA SYI  L    L+   CG  +P    G
Sbjct:   80 RNAANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLVGEGCGDGQPCHSGG 150          
BLAST of ptf-2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004072.1 (pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 gene:ENSPMAG00000003727.1 transcript:ENSPMAT00000004072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 3.120e-29
Identity = 69/142 (48.59%), Postives = 88/142 (61.97%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDC-SGNAIRSAECSIEQKIILSLKHHNSKDFRADV----------ICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN RERRRMQSIN AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL+ S+     P+   +G  +     S ++KII+   H  S+   A +          + GHSLSW ++R+    ++ +    A +WTPE
Sbjct:  133 RQAANQRERRRMQSINAAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYISFLGELVHSE----RPLRAQAGQPL----LSQQKKIIIC--HRASRSPSAALSPGLSSGLIPLAGHSLSWTDERQRRERHVVR---TARVWTPE 261          
BLAST of ptf-2 protein vs. Ensembl Sea Lamprey
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 94.3597 bits (233), Expect = 1.791e-24
Identity = 43/66 (65.15%), Postives = 52/66 (78.79%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPID 544
            R AAN+RERRRM SIN AFE LRCH+PT PYEKRLSK+DTLRLAI+YI  L++++ SD      +D
Sbjct:   35 RTAANVRERRRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLRDILLSDTDPKAYVD 100          
BLAST of ptf-2 protein vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 66.6254 bits (161), Expect = 2.312e-14
Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCS 550
            R  AN+RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD    +   CS
Sbjct:   10 RVLANVRERQRTQSLNEAFASLRKIIPTLPSDK-LSKIQTLKLASRYIDFLYQVLQSDEMDNKMTSCS 76          
BLAST of ptf-2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011442.1 (pep scaffold:Pmarinus_7.0:GL478554:30221:30385:-1 gene:ENSPMAG00000010415.1 transcript:ENSPMAT00000011442.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 6.424e-13
Identity = 30/52 (57.69%), Postives = 40/52 (76.92%), Query Frame = 2
Query:  365 RERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            RER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD
Sbjct:    1 RERQRTQSLNEAFSSLRQIIPTLPSDK-LSKIQTLKLATRYIDFLYQVLQSD 51          
BLAST of ptf-2 protein vs. Ensembl Sea Lamprey
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:558148])

HSP 1 Score: 64.3142 bits (155), Expect = 9.083e-13
Identity = 33/85 (38.82%), Postives = 55/85 (64.71%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDC---GSLEPIDCSGNAIRSAECSIEQK 592
            R AAN RER RM+ +++AF  L+  +P +P + +LSK+DTLRLA SYIG L++++  +    G + P++ +   + +A+   E K
Sbjct:   98 RNAANARERARMRVLSKAFSRLKTTLPWVPADTKLSKLDTLRLASSYIGHLRQILADETYQNGFVHPVNLTWPFLAAAKGDSELK 182          
BLAST of ptf-2 protein vs. Ensembl Nematostella
Match: EDO43849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI0])

HSP 1 Score: 101.679 bits (252), Expect = 6.508e-28
Identity = 47/55 (85.45%), Postives = 51/55 (92.73%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELI 511
            R AAN+RER+RMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YIGFL E+I
Sbjct:    4 RHAANLRERKRMQSINEAFEGLRKHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMI 58          
BLAST of ptf-2 protein vs. Ensembl Nematostella
Match: EDO42924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ0])

HSP 1 Score: 66.6254 bits (161), Expect = 1.186e-14
Identity = 32/59 (54.24%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDC 523
            RQAAN RER R  S+N AF  LR  IPT P +++LSK++TLRLA SYI  L  ++ S  
Sbjct:    3 RQAANARERNRTHSVNAAFNALRLLIPTEPSDRKLSKIETLRLASSYIAHLSTILISGT 61          
BLAST of ptf-2 protein vs. Ensembl Nematostella
Match: EDO46240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW6])

HSP 1 Score: 62.3882 bits (150), Expect = 6.918e-12
Identity = 33/62 (53.23%), Postives = 44/62 (70.97%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIP--TMPYEKRLSKVDTLRLAISYIGFLQELIKSDCG 526
            RQ AN RER RM+SI++A   LR H+P   +  +K+LSK+ TLRLAI YI  L E+++SD G
Sbjct:   39 RQTANARERNRMRSISDALLHLRYHLPQTVVAKDKKLSKIQTLRLAIRYISDLFEILQSDDG 100          
BLAST of ptf-2 protein vs. Ensembl Nematostella
Match: TWIST (Predicted protein; Twist family bHLH transcription factor [Source:UniProtKB/TrEMBL;Acc:Q6S5G7])

HSP 1 Score: 60.4622 bits (145), Expect = 1.299e-11
Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSD 520
            R  AN+RER+R Q++NEAF  LR  IPT+P +K LSK+ TLRLA  YI FL +++ ++
Sbjct:   38 RAIANVRERQRTQALNEAFNKLRKIIPTLPSDK-LSKIQTLRLASRYIDFLCQVLGNN 94          
BLAST of ptf-2 protein vs. Ensembl Nematostella
Match: EDO42907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S063])

HSP 1 Score: 58.151 bits (139), Expect = 1.617e-11
Identity = 29/55 (52.73%), Postives = 37/55 (67.27%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELI 511
            R+ AN RER R+Q +N AFE LR  IP    EK+ SK+DT+RLA  YI  L +L+
Sbjct:    5 RRTANERERNRVQQVNAAFETLRNKIPLRALEKKPSKIDTIRLATRYIQDLTQLL 59          
BLAST of ptf-2 protein vs. Ensembl Medaka
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:101160350])

HSP 1 Score: 121.709 bits (304), Expect = 1.144e-32
Identity = 70/136 (51.47%), Postives = 89/136 (65.44%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNS-----KDFRADVICGHSLSWRNDRE--PTNIFKRTFKAEIWTPE 733
            RQAAN+RERRRMQSIN+AFEGLR HIPT+PYEKRLSKVDTLRLAI YI FL EL++SD     PI  S     S   +  +K+I+  +   S      D+    + GHSLSW ++++    NI +    A++WTPE
Sbjct:  120 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDL----PIRNSN----SDAHAQPKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWSDEKQLREQNIIR---TAKVWTPE 244          
BLAST of ptf-2 protein vs. Ensembl Medaka
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 91.6633 bits (226), Expect = 5.261e-22
Identity = 42/59 (71.19%), Postives = 49/59 (83.05%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDC 523
            R AANIRER+RM SIN AFE LRCH+PT PYEKRLSK+DTLRLAI+YI  L+E++ S  
Sbjct:  126 RHAANIRERKRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLREILLSGA 184          
BLAST of ptf-2 protein vs. Ensembl Medaka
Match: ferd3l (Fer3 like bHLH transcription factor [Source:NCBI gene;Acc:101167882])

HSP 1 Score: 80.1073 bits (196), Expect = 4.848e-19
Identity = 36/56 (64.29%), Postives = 47/56 (83.93%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIK 514
            RQAAN+RERRRM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ +L++
Sbjct:   16 RQAANVRERRRMFSLNEAFDELRRKVPTFAYEKRLSRIETLRLAIVYISFMTDLLE 71          
BLAST of ptf-2 protein vs. Ensembl Medaka
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:101172734])

HSP 1 Score: 66.6254 bits (161), Expect = 5.609e-13
Identity = 34/70 (48.57%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGN 556
            R AAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA SYI  L  ++ +  G  +   C G 
Sbjct:   64 RSAANARERGRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLTGDGCADGQPCLGG 133          
BLAST of ptf-2 protein vs. Ensembl Medaka
Match: ENSORLT00000005014.2 (twist family bHLH transcription factor 1 [Source:NCBI gene;Acc:101173479])

HSP 1 Score: 65.855 bits (159), Expect = 1.007e-12
Identity = 36/68 (52.94%), Postives = 46/68 (67.65%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCS 550
            R  ANIRER+R QS+NEAF  LR  IPT+P +K LSK+ TL+LA  YI FL ++++SD        CS
Sbjct:   92 RVMANIRERQRTQSLNEAFTSLRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQSDELDARGTSCS 158          
BLAST of ptf-2 protein vs. Planmine SMEST
Match: SMESG000000956.1 (SMESG000000956.1)

HSP 1 Score: 302.753 bits (774), Expect = 1.042e-133
Identity = 143/143 (100.00%), Postives = 143/143 (100.00%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVLLKGMNQDCLFT 775
            RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVLLKGMNQDCLFT
Sbjct:  104 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVLLKGMNQDCLFT 246          

HSP 2 Score: 142.51 bits (358), Expect = 1.042e-133
Identity = 68/70 (97.14%), Postives = 68/70 (97.14%), Query Frame = 3
Query:  138 IIVDGAFRIPVTLEMSNNYYHNDQPSFVTQFSASSPSTINGSDLKSYRFNTKSHRSLYRKNRNYQRKLAE 347
            I  DGAFRIPVTLEMSNNYYHNDQPSFVTQFSASSPSTINGSDLKSYRFNTKSHRSLYRKNRNYQRKLAE
Sbjct:   34 IETDGAFRIPVTLEMSNNYYHNDQPSFVTQFSASSPSTINGSDLKSYRFNTKSHRSLYRKNRNYQRKLAE 103          

HSP 3 Score: 72.7886 bits (177), Expect = 1.042e-133
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 1
Query:    1 YFNKQIIDNSLECQSRHETSSSMWLMRNNTSIET 102
            YFNKQIIDNSLECQSRHETSSSMWLMRNNTSIET
Sbjct:    3 YFNKQIIDNSLECQSRHETSSSMWLMRNNTSIET 36          
BLAST of ptf-2 protein vs. Planmine SMEST
Match: SMESG000079648.1 (SMESG000079648.1)

HSP 1 Score: 138.658 bits (348), Expect = 1.369e-39
Identity = 71/132 (53.79%), Postives = 91/132 (68.94%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVL 742
            RQAAN+RERRRMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YI FLQ+L+K++   ++  D   +   S +  +  + + S K  + K+    ++  HSLSWRN REP      T  A+IW PE++L
Sbjct:  104 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTES-RIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEIL--IVTTHSLSWRNIREPKIGPNNTLAAKIWRPEILL 232          
BLAST of ptf-2 protein vs. Planmine SMEST
Match: SMESG000044960.1 (SMESG000044960.1)

HSP 1 Score: 98.5969 bits (244), Expect = 7.577e-25
Identity = 45/60 (75.00%), Postives = 52/60 (86.67%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCG 526
            RQAAN+RER+RMQSIN+AFE LR HIPTMPYEKRLSKVDTLR+AI YI FL  +++ D G
Sbjct:   48 RQAANMRERKRMQSINDAFEKLRVHIPTMPYEKRLSKVDTLRMAIGYINFLGGIMQVDQG 107          
BLAST of ptf-2 protein vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.853e-18
Identity = 37/55 (67.27%), Postives = 47/55 (85.45%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELI 511
            R+AANIRERRRM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI+YI F+ EL+
Sbjct:  139 RRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 193          
BLAST of ptf-2 protein vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.954e-18
Identity = 37/55 (67.27%), Postives = 47/55 (85.45%), Query Frame = 2
Query:  347 RQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELI 511
            R+AANIRERRRM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI+YI F+ EL+
Sbjct:  146 RRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 200          
The following BLAST results are available for this feature:
BLAST of ptf-2 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTF1A3.852e-3047.55pancreas associated transcription factor 1a [Sourc... [more]
FERD3L1.580e-1764.91Fer3 like bHLH transcription factor [Source:HGNC S... [more]
TWIST13.750e-1356.90twist family bHLH transcription factor 1 [Source:H... [more]
TWIST21.177e-1258.18twist family bHLH transcription factor 2 [Source:H... [more]
TWIST21.177e-1258.18twist family bHLH transcription factor 2 [Source:H... [more]
back to top
BLAST of ptf-2 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hlh-131.260e-1663.16Helix-loop-helix protein 13 [Source:UniProtKB/Swi... [more]
hlh-153.387e-1152.00Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q18... [more]
hlh-83.421e-1050.85Twist-related protein [Source:UniProtKB/Swiss-Pro... [more]
hlh-61.367e-953.70Helix-loop-helix protein 6 [Source:UniProtKB/Swis... [more]
ngn-15.011e-950.98NeuroGeNin [Source:UniProtKB/TrEMBL;Acc:Q95XG7][more]
back to top
BLAST of ptf-2 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fer12.574e-3355.64gene:FBgn0037475 transcript:FBtr0081567[more]
Fer14.518e-3355.64gene:FBgn0037475 transcript:FBtr0334670[more]
Fer24.056e-2061.19gene:FBgn0038402 transcript:FBtr0301709[more]
Fer24.372e-2061.19gene:FBgn0038402 transcript:FBtr0344012[more]
Fer22.402e-1956.94gene:FBgn0038402 transcript:FBtr0344010[more]
back to top
BLAST of ptf-2 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptf1a4.860e-3350.00pancreas associated transcription factor 1a [Sourc... [more]
si:dkey-34f9.31.066e-2450.00si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ferd3l3.385e-1862.50Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
si:ch211-246m6.43.606e-1353.03si:ch211-246m6.4 [Source:ZFIN;Acc:ZDB-GENE-050208-... [more]
scxa5.022e-1349.30scleraxis bHLH transcription factor a [Source:ZFIN... [more]
back to top
BLAST of ptf-2 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTF1A5.105e-3250.00pancreas associated transcription factor 1a [Sourc... [more]
ENSXETT00000031930.11.601e-2058.67pep primary_assembly:Xenopus_tropicalis_v9.1:9:556... [more]
ferd3l5.581e-1863.16Fer3-like bHLH transcription factor [Source:NCBI g... [more]
tcf153.961e-1358.18transcription factor 15 [Source:NCBI gene;Acc:5492... [more]
hnrnpc8.388e-1358.18heterogeneous nuclear ribonucleoprotein C (C1/C2) ... [more]
back to top
BLAST of ptf-2 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptf1a6.243e-3046.85pancreas specific transcription factor, 1a [Source... [more]
Ferd3l1.147e-1764.91Fer3 like bHLH transcription factor [Source:MGI Sy... [more]
Tcf157.677e-1358.18transcription factor 15 [Source:MGI Symbol;Acc:MGI... [more]
Twist28.081e-1358.18twist basic helix-loop-helix transcription factor ... [more]
Twist28.081e-1358.18twist basic helix-loop-helix transcription factor ... [more]
back to top
BLAST of ptf-2 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4ZHW1|PTF1A_XENLA1.214e-3250.00Pancreas transcription factor 1 subunit alpha OS=X... [more]
sp|Q7ZSX3|PTF1A_DANRE3.669e-3250.00Pancreas transcription factor 1 subunit alpha OS=D... [more]
sp|Q7RTS3|PTF1A_HUMAN1.850e-2947.55Pancreas transcription factor 1 subunit alpha OS=H... [more]
sp|Q9QX98|PTF1A_MOUSE4.367e-2946.85Pancreas transcription factor 1 subunit alpha OS=M... [more]
sp|Q64305|PTF1A_RAT6.574e-2945.16Pancreas transcription factor 1 subunit alpha OS=R... [more]
back to top
BLAST of ptf-2 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5YQ656.068e-110100.00Ptf-2 protein (Fragment) OS=Schmidtea mediterranea... [more]
K1Q6J03.531e-3553.68Pancreas transcription factor 1 subunit alpha OS=C... [more]
A0A3M6UMA42.960e-3450.39BHLH domain-containing protein OS=Pocillopora dami... [more]
A0A2B4S7X43.513e-3450.39Pancreas transcription factor 1 subunit alpha OS=S... [more]
A0A210QNY96.960e-3350.00Pancreas transcription factor 1 subunit alpha OS=M... [more]
back to top
BLAST of ptf-2 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptf1a7.692e-3452.21pancreas associated transcription factor 1a [Sourc... [more]
si:dkey-34f9.36.474e-2458.75neurogenic differentiation factor 1-like [Source:N... [more]
ferd3l3.702e-1968.52Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
ENSAMXT00000026383.28.712e-1451.47pep primary_assembly:Astyanax_mexicanus-2.0:13:850... [more]
scxa4.706e-1349.30scleraxis bHLH transcription factor a [Source:ZFIN... [more]
back to top
BLAST of ptf-2 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004072.13.120e-2948.59pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 ge... [more]
si:dkey-34f9.31.791e-2465.15si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
TWIST12.312e-1451.47twist family bHLH transcription factor 1 [Source:H... [more]
ENSPMAT00000011442.16.424e-1357.69pep scaffold:Pmarinus_7.0:GL478554:30221:30385:-1 ... [more]
tcf219.083e-1338.82transcription factor 21 [Source:NCBI gene;Acc:5581... [more]
back to top
BLAST of ptf-2 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ptf-2 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438496.508e-2885.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429241.186e-1454.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462406.918e-1253.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
TWIST1.299e-1153.45Predicted protein; Twist family bHLH transcription... [more]
EDO429071.617e-1152.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ptf-2 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptf1a1.144e-3251.47pancreas associated transcription factor 1a [Sourc... [more]
si:dkey-34f9.35.261e-2271.19si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ferd3l4.848e-1964.29Fer3 like bHLH transcription factor [Source:NCBI g... [more]
tcf155.609e-1348.57transcription factor 15 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000005014.21.007e-1252.94twist family bHLH transcription factor 1 [Source:N... [more]
back to top
BLAST of ptf-2 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000956.11.042e-133100.00SMESG000000956.1[more]
SMESG000079648.11.369e-3953.79SMESG000079648.1[more]
SMESG000044960.17.577e-2575.00SMESG000044960.1[more]
SMESG000029000.12.853e-1867.27SMESG000029000.1[more]
SMESG000029000.12.954e-1867.27SMESG000029000.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009229
GenBankAGZ94917.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009229 ID=SMED30009229|Name=ptf-2 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=866bp
TATTTCAATAAGCAAATCATTGATAACTCTTTGGAATGCCAATCACGGCA
TGAAACCTCATCAAGCATGTGGTTAATGAGGAATAATACGTCAATTGAAA
CTGGTACGACAACTTTTGTTTTAAACTTTCCATAGAAATCATTGTAGATG
GAGCCTTTCGGATTCCAGTTACACTGGAAATGTCAAATAATTATTACCAC
AATGATCAACCATCATTCGTCACCCAATTTTCAGCGAGTTCCCCATCGAC
AATCAATGGCAGCGATTTGAAATCTTATCGATTTAACACGAAGTCACATC
GATCTCTTTATCGAAAAAATAGAAATTATCAAAGAAAGTTAGCTGAAGAC
AAGCAGCTAATATCAGAGAAAGGAGACGAATGCAGTCAATAAATGAAGCA
TTTGAAGGACTACGCTGCCATATACCTACAATGCCTTATGAGAAAAGATT
ATCAAAAGTTGACACGTTACGTTTAGCAATTAGTTACATTGGATTTTTAC
AAGAACTTATTAAATCGGATTGTGGGTCCTTAGAACCGATTGACTGCTCT
GGAAACGCGATCAGATCCGCTGAATGTAGTATTGAACAGAAAATTATTTT
GTCACTAAAGCATCACAACTCCAAAGATTTCAGAGCAGATGTTATTTGCG
GACACAGTTTAAGTTGGCGGAACGATAGAGAACCGACAAATATTTTCAAG
CGAACATTTAAAGCCGAAATTTGGACTCCAGAAGTCGTGTTGTTGAAAGG
AATGAATCAAGACTGTCTGTTTACAAATAGAAATAATCGTCGAATAAAAT
GAAAATACAAAGTCAAAAATTTTGATTAAAAATGTCAACTGATGATTTTG
ATACGAAAATAAATTA
back to top

protein sequence of SMED30009229-orf-1

>SMED30009229-orf-1 ID=SMED30009229-orf-1|Name=SMED30009229-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGS
LEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDR
EPTNIFKRTFKAEIWTPEVVLLKGMNQDCLFTNRNNRRIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity