RILP-like protein 1

Overview
NameRILP-like protein 1
Smed IDSMED30009226
Length (bp)1669
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RILP-like protein 1 (SMED30009226) t-SNE clustered cells

Violin plots show distribution of expression levels for RILP-like protein 1 (SMED30009226) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RILP-like protein 1 (SMED30009226) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RILP-like protein 1 (SMED30009226) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009226

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30009226SMESG000009316.1 dd_Smed_v4_4713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009226SMESG000009316.1 dd_Smed_v4_4713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30009226SMESG000009316.1 dd_Smed_v4_4713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009226SMESG000009316.1 dd_Smed_v6_4713_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30009226SMESG000009316.1 dd_Smed_v6_4713_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30009226SMESG000009316.1 Contig3528GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RILP-like protein 1 vs. Ensembl Human
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:HGNC Symbol;Acc:HGNC:26814])

HSP 1 Score: 159.844 bits (403), Expect = 6.259e-43
Identity = 129/372 (34.68%), Postives = 202/372 (54.30%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G +FER+IDQ G +A++ LMPKV+ VLE LE    R+   A ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L+S I +LQE+NK+L         N    ++  ++E F   +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K               + G    N E       + E  +     S+ + V     +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++L  F
Sbjct:   24 VMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHV-APELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQL-------MTNLSHKDVNFSEEEF--QKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGK-----------LRERLQGEHSQNGEEEPETEPVGEESI-----SDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHP--RTSPQP--ESGIKRLFSF 359          
BLAST of RILP-like protein 1 vs. Ensembl Human
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:HGNC Symbol;Acc:HGNC:26814])

HSP 1 Score: 157.147 bits (396), Expect = 3.235e-42
Identity = 129/370 (34.86%), Postives = 200/370 (54.05%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKLL 1288
            V+DVYD+A+ +G +FER+IDQ G +A++ LMPKV+ VLE LE    R+   A ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L+S I +LQE+NK+L   L     N  E E +         +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K               + G    N E       + E  +     S+ + V     +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++L+
Sbjct:   24 VMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHV-APELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQ---------KHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGK-----------LRERLQGEHSQNGEEEPETEPVGEESI-----SDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHP--RTSPQP--ESGIKRLI 357          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 146.362 bits (368), Expect = 1.599e-38
Identity = 115/407 (28.26%), Postives = 204/407 (50.12%), Query Frame = 2
Query:  182 RVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDL--QLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNA--------------------------------GDEEPQVQGPVNREPEEKMSPKPL--KESGIQKLLKF 1294
            +VVDVYD+AA IG DFE++ID +G + V G+MPKVI  LE LE  A   + E ++I+ L   V++LE E   R Q+  ++E++LEQ+E+T+  +  +L  M++ L  +N+ L   +  +  +++            S   +++   D+++++ LKE++ +Q  EI+ L+K++      ++ +Q   ++L + N EL RK+   +KQ   ++EEK ++  +LE  E+ +I  ++++ V  +D   K                                  + QL +Q             +N + RFTLSEL+ V+ E+N LK +++E+EEEL  +K                                  GD+ P V GP+ +EP+EK+ P     K+SG++K ++F
Sbjct:    7 KVVDVYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHAD------------SPVSTSMREADLKMLLELKEMSSQQKDEIKALQKDVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRLEKTEESNI--ELKKLVKETDRACK----------------------------------DMQLANQ-------------DNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLP-VYGPMPKEPDEKLHPWKYERKDSGVRKFIQF 351          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 146.747 bits (369), Expect = 1.610e-38
Identity = 116/411 (28.22%), Postives = 205/411 (49.88%), Query Frame = 2
Query:  170 TKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDL--QLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNA--------------------------------GDEEPQVQGPVNREPEEKMSPKPL--KESGIQKLLKF 1294
            +K   VVDVYD+AA IG DFE++ID +G + V G+MPKVI  LE LE  A   + E ++I+ L   V++LE E   R Q+  ++E++LEQ+E+T+  +  +L  M++ L  +N+ L   +  +  +++            S   +++   D+++++ LKE++ +Q  EI+ L+K++      ++ +Q   ++L + N EL RK+   +KQ   ++EEK ++  +LE  E+ +I  ++++ V  +D   K                                  + QL +Q             +N + RFTLSEL+ V+ E+N LK +++E+EEEL  +K                                  GD+ P V GP+ +EP+EK+ P     K+SG++K ++F
Sbjct:   12 SKQITVVDVYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHAD------------SPVSTSMREADLKMLLELKEMSSQQKDEIKALQKDVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRLEKTEESNI--ELKKLVKETDRACK----------------------------------DMQLANQ-------------DNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLP-VYGPMPKEPDEKLHPWKYERKDSGVRKFIQF 360          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 146.747 bits (369), Expect = 1.610e-38
Identity = 116/411 (28.22%), Postives = 205/411 (49.88%), Query Frame = 2
Query:  170 TKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDL--QLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNA--------------------------------GDEEPQVQGPVNREPEEKMSPKPL--KESGIQKLLKF 1294
            +K   VVDVYD+AA IG DFE++ID +G + V G+MPKVI  LE LE  A   + E ++I+ L   V++LE E   R Q+  ++E++LEQ+E+T+  +  +L  M++ L  +N+ L   +  +  +++            S   +++   D+++++ LKE++ +Q  EI+ L+K++      ++ +Q   ++L + N EL RK+   +KQ   ++EEK ++  +LE  E+ +I  ++++ V  +D   K                                  + QL +Q             +N + RFTLSEL+ V+ E+N LK +++E+EEEL  +K                                  GD+ P V GP+ +EP+EK+ P     K+SG++K ++F
Sbjct:   12 SKQITVVDVYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHAD------------SPVSTSMREADLKMLLELKEMSSQQKDEIKALQKDVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRLEKTEESNI--ELKKLVKETDRACK----------------------------------DMQLANQ-------------DNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLP-VYGPMPKEPDEKLHPWKYERKDSGVRKFIQF 360          
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Match: rilp-1 (RILP (Rab7-Interacting Lysosomal Protein) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFB9])

HSP 1 Score: 146.747 bits (369), Expect = 1.610e-38
Identity = 116/411 (28.22%), Postives = 205/411 (49.88%), Query Frame = 2
Query:  170 TKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDL--QLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNA--------------------------------GDEEPQVQGPVNREPEEKMSPKPL--KESGIQKLLKF 1294
            +K   VVDVYD+AA IG DFE++ID +G + V G+MPKVI  LE LE  A   + E ++I+ L   V++LE E   R Q+  ++E++LEQ+E+T+  +  +L  M++ L  +N+ L   +  +  +++            S   +++   D+++++ LKE++ +Q  EI+ L+K++      ++ +Q   ++L + N EL RK+   +KQ   ++EEK ++  +LE  E+ +I  ++++ V  +D   K                                  + QL +Q             +N + RFTLSEL+ V+ E+N LK +++E+EEEL  +K                                  GD+ P V GP+ +EP+EK+ P     K+SG++K ++F
Sbjct:   12 SKQITVVDVYDLAASIGNDFEKLIDNYGNECVRGIMPKVISALETLEAMAAGNDRENEEIMRLSKAVERLEQEKHQRNQQHLKFEEELEQVEKTYRKDIDDLQQMVKSLVNENRNLSTTVSSLPNHAD------------SPVSTSMREADLKMLLELKEMSSQQKDEIKALQKDVDTYQCQVENLQNSIEKLIRQNEELLRKNASLQKQGRMIVEEKMEVVRRLEKTEESNI--ELKKLVKETDRACK----------------------------------DMQLANQ-------------DNNEPRFTLSELREVIKEKNILKGRVMELEEELDNFKPGAKKEIMRLDDDDDFDRNPLQPDTSSAQSLGVDGDDLP-VYGPMPKEPDEKLHPWKYERKDSGVRKFIQF 360          
BLAST of RILP-like protein 1 vs. Ensembl Fly
Match: Rilpl (gene:FBgn0024985 transcript:FBtr0070225)

HSP 1 Score: 150.214 bits (378), Expect = 1.904e-39
Identity = 90/236 (38.14%), Postives = 148/236 (62.71%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETE---LKITKEVF-LSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQ 880
            VVDVYD+A++IGK++ERI+D+FGTDAVSGLMPK+I  LE LE  A + E E   I  L+  V +LE E L +A+ R R++K+LE IEE W  ET EL+ ++  LQ++NKRL ++ Q +  +S ++      +T+ +  ++  +   +  D Q++ RLKE   +Q  E++  ++EL  K  +L+ +  Q++RL     + RR+H + + Q   L EE++D   +L ++   I ++R+
Sbjct:   22 VVDVYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLELLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVDLVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKEQIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERADFLAQLQDQSREINQLRK 257          
BLAST of RILP-like protein 1 vs. Ensembl Fly
Match: Rilpl (gene:FBgn0024985 transcript:FBtr0332291)

HSP 1 Score: 150.214 bits (378), Expect = 1.976e-39
Identity = 90/236 (38.14%), Postives = 148/236 (62.71%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETE---LKITKEVF-LSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQ 880
            VVDVYD+A++IGK++ERI+D+FGTDAVSGLMPK+I  LE LE  A + E E   I  L+  V +LE E L +A+ R R++K+LE IEE W  ET EL+ ++  LQ++NKRL ++ Q +  +S ++      +T+ +  ++  +   +  D Q++ RLKE   +Q  E++  ++EL  K  +L+ +  Q++RL     + RR+H + + Q   L EE++D   +L ++   I ++R+
Sbjct:   22 VVDVYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLELLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVDLVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKEQIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERADFLAQLQDQSREINQLRK 257          
BLAST of RILP-like protein 1 vs. Ensembl Fly
Match: Rilpl (gene:FBgn0024985 transcript:FBtr0332292)

HSP 1 Score: 149.058 bits (375), Expect = 9.517e-39
Identity = 90/236 (38.14%), Postives = 148/236 (62.71%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETE---LKITKEVF-LSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQ 880
            VVDVYD+A++IGK++ERI+D+FGTDAVSGLMPK+I  LE LE  A + E E   I  L+  V +LE E L +A+ R R++K+LE IEE W  ET EL+ ++  LQ++NKRL ++ Q +  +S ++      +T+ +  ++  +   +  D Q++ RLKE   +Q  E++  ++EL  K  +L+ +  Q++RL     + RR+H + + Q   L EE++D   +L ++   I ++R+
Sbjct:   22 VVDVYDLASDIGKEYERIMDRFGTDAVSGLMPKIINTLELLEALATKNERENATIQELRDKVAQLESEKLEKAEFRRRFDKELELIEEQWRSETNELVDLVSSLQDENKRLVKQTQDLQSSSAQSSGLGASLTESIISMTNHELHSALSDTQVLQRLKEQIYKQRDELKHRERELQDKYSELEHLNIQAERLKASERDTRRRHKLMQAQVKTLCEERADFLAQLQDQSREINQLRK 257          
BLAST of RILP-like protein 1 vs. Ensembl Zebrafish
Match: rilp (Rab interacting lysosomal protein [Source:ZFIN;Acc:ZDB-GENE-100408-4])

HSP 1 Score: 114.39 bits (285), Expect = 7.843e-27
Identity = 92/333 (27.63%), Postives = 162/333 (48.65%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYK 1183
            V DVY++A  +G + E++ID +G  +V GL+ +++ VLE LE +A R ++       L    + L+L+   +   +   E         WH   K+L + +E LQ    +L EE Q++      T ++ T       ++     ++ ++M++LKE+ D+Q  E+R   +E++    +++A+Q+Q +RL K+NAELR K  +   Q    +E K+DL+ +LCEK+  I+++                                  N +L  S    +       I+   KM+    + N+   FT  E++ +L ERNELK+ L  V+EELA Y+
Sbjct:   32 VDDVYEIAKVVGAEVEKLIDSYGKSSVEGLVSRIVKVLELLESFAARNQSHKCKEEELLKAFETLQLQQQKKRHVKECEESSSSAESRDWHQTEKKLKNNLEVLQSQVHQLKEENQELL-----TRIQCT-----HSKEDRTQRQEREVMLKLKEVVDKQRDELRAKVQEISSMSKEVEALQEQQERLMKINAELRHKQNIIHTQMKSAVERKADLEADLCEKQKEIQRL----------------------------------NSQLERSSVHTAAETSSSAIDLTDKMIIDLKDPNRPC-FTKQEVRDMLFERNELKANLFLVKEELAYYQ 319          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: tnip3 (TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:XB-GENE-1008480])

HSP 1 Score: 152.525 bits (384), Expect = 9.413e-41
Identity = 123/371 (33.15%), Postives = 206/371 (55.53%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKN-AGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G++FER+IDQ+G + +  LMPKV+ VLE LE    R      ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L++ I +LQE+NK+L         N  + ++ +T+E F   +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+  L  KE     MR  +                       + G    N E  ++   L+E  ++     E + ++    ++ + RFTL EL+ VL ERNELK+K+  ++EELA YK+   DEE ++  P +    +  +P P +ESGI++L  F
Sbjct:   16 VMDVYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINP-EMEELRLELDRLRLERMDRIEKEKKHQKELELVEDVWRGEAQDLLNQIAQLQEENKQL-------VSNLSQKDINLTEEEF--QKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEI-----------------GKLRDKLKGEQHTNGEEIKTET-LNEESIL-----ETEKLSLDLKDSNRPRFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADEEHKL--PQSSPVIDSKAPIP-QESGIKRLFSF 350          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: tnip3 (TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:XB-GENE-1008480])

HSP 1 Score: 149.828 bits (377), Expect = 2.119e-39
Identity = 122/369 (33.06%), Postives = 206/369 (55.83%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKN-AGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLL 1288
            V+DVYD+A+ +G++FER+IDQ+G + +  LMPKV+ VLE LE    R      ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L++ I +LQE+NK+L         N  + ++ +T+E F   +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+  L  KE     MR  +                       + G    N E  ++   L+E  ++     E + ++    ++ + RFTL EL+ VL ERNELK+K+  ++EELA YK+   DEE ++  P +    +  +P P +ESGI++L+
Sbjct:   16 VMDVYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINP-EMEELRLELDRLRLERMDRIEKEKKHQKELELVEDVWRGEAQDLLNQIAQLQEENKQL-------VSNLSQKDINLTEEEF--QKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEI-----------------GKLRDKLKGEQHTNGEEIKT-ETLNEESIL-----ETEKLSLDLKDSNRPRFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADEEHKL--PQSSPVIDSKAPIP-QESGIKRLI 348          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: tnip3 (TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:XB-GENE-1008480])

HSP 1 Score: 145.976 bits (367), Expect = 3.782e-38
Identity = 122/371 (32.88%), Postives = 203/371 (54.72%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKN-AGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G++FER+IDQ+G + +  LMPKV+ VLE LE    R      ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L++ I +LQE+NK+L         N  + ++ +T+E F   +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+  L  KE     MR  +                       + G    N E  ++   L+E  ++     E + ++    ++ + RFTL EL+ VL ERNELK+K+  ++EELA YK+   DEE ++  P +    +  +P P +ESG   L  F
Sbjct:   16 VMDVYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINP-EMEELRLELDRLRLERMDRIEKEKKHQKELELVEDVWRGEAQDLLNQIAQLQEENKQL-------VSNLSQKDINLTEEEF--QKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEI-----------------GKLRDKLKGEQHTNGEEIKTET-LNEESIL-----ETEKLSLDLKDSNRPRFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADEEHKL--PQSSPVIDSKAPIP-QESGCVTLYFF 350          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: rilp (Rab interacting lysosomal protein [Source:NCBI gene;Acc:100127814])

HSP 1 Score: 88.9669 bits (219), Expect = 1.813e-18
Identity = 90/335 (26.87%), Postives = 151/335 (45.07%), Query Frame = 2
Query:  179 FRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYK 1183
              V DVY +A  +G + + + +Q+G DAVSG++P+V+ VLE LE Y      E         T ++L +  + R Q  +R E     ++E              +L E  K+ H    ++ + +EE +  + +      ++   + E+  LM++LK++ D Q  +IR L  E  Q+  D +A+Q+Q DR  K+N +LR K  V + Q    L+ K++L+  L EK             SD+L+K             + +   IP +                  +N+         + + Q  FT  E+K +L ER+ELK+ L  V EEL  Y+
Sbjct:   12 LSVQDVYSMAVCLGSELQTLTEQYGPDAVSGVVPQVVRVLELLESYVGGSGRERS------CTEEELLIRAVHRLQLSSREEPSPADLQE--------------QLLEAQKKEHVLQNRLSQLTEENQELLGQLAERKSKEDCAAREERDLMLQLKKVVDMQRDQIRALTHETTQRNKDAEALQEQLDRFMKMNEDLRHKMSVLQAQLKSSLQRKTELEALLQEKRK----------ESDALSK------------TIVVAPGIPDS-----------------NMNTSLCATVKEDSRSSQPCFTKEEVKQILQERHELKTNLFLVNEELQYYQ 287          
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Match: rilp (Rab interacting lysosomal protein [Source:NCBI gene;Acc:100127814])

HSP 1 Score: 58.151 bits (139), Expect = 1.785e-8
Identity = 55/191 (28.80%), Postives = 87/191 (45.55%), Query Frame = 2
Query:  611 SNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYK 1183
            + E+  LM++LK++ D Q  +IR L  E  Q+  D +A+Q+Q DR  K+N +LR K  V + Q    L+ K++L+  L EK             SD+L+K             + +   IP +                  +N+         + + Q  FT  E+K +L ER+ELK+ L  V EEL  Y+
Sbjct:  113 AREERDLMLQLKKVVDMQRDQIRALTHETTQRNKDAEALQEQLDRFMKMNEDLRHKMSVLQAQLKSSLQRKTELEALLQEKRK----------ESDALSK------------TIVVAPGIPDS-----------------NMNTSLCATVKEDSRSSQPCFTKEEVKQILQERHELKTNLFLVNEELQYYQ 264          
BLAST of RILP-like protein 1 vs. Ensembl Mouse
Match: Rilpl1 (Rab interacting lysosomal protein-like 1 [Source:MGI Symbol;Acc:MGI:1922945])

HSP 1 Score: 170.244 bits (430), Expect = 6.327e-47
Identity = 128/372 (34.41%), Postives = 205/372 (55.11%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G +FER+IDQ G ++++ LMPKV+ VLE LE    R+   A ++  L+  + +L +E + R ++  +++K+LE +E+ W  E ++L+S I +LQE+NK+L         N    ++  ++E F   +Q  +S  + Q+M RLKE+ D+Q  E+R   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K               + G   H+Q   E  A +      ++  S+ +       +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++L  F
Sbjct:   24 VMDVYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSRHHV-APELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQL-------MTNLNHKDVGFSEEEF--QKQEGMSERERQVMKRLKEVVDKQRDELRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGK-----------LRERLQGE--HSQNGEEEEAEIQPQPDGEESISDAEKAALDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHP--RTSPQP--ESGIKRLFSF 362          
BLAST of RILP-like protein 1 vs. Ensembl Mouse
Match: Rilpl1 (Rab interacting lysosomal protein-like 1 [Source:MGI Symbol;Acc:MGI:1922945])

HSP 1 Score: 62.7734 bits (151), Expect = 7.970e-11
Identity = 63/190 (33.16%), Postives = 93/190 (48.95%), Query Frame = 2
Query:  725 MQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKLL 1288
            +QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K               + G   H+Q   E  A +      ++  S+ +       +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++LL
Sbjct:    1 LQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGKLRER-----------LQGE--HSQNGEEEEAEIQPQPDGEESISDAEKAALDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHP--RTSPQP--ESGIKRLL 167          
BLAST of RILP-like protein 1 vs. Ensembl Mouse
Match: Rilp (Rab interacting lysosomal protein [Source:MGI Symbol;Acc:MGI:2144271])

HSP 1 Score: 56.6102 bits (135), Expect = 4.027e-8
Identity = 57/202 (28.22%), Postives = 93/202 (46.04%), Query Frame = 2
Query:  194 VYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQ 799
            VY +A  +G + + +  +FG DA +GL+P V+  LE LE+ A      A D  +LQ + Q+ E+E                                + +L+E+N+RL +EL                    SG Q     E+  L+ +LKE+TDRQ  E+R   ++L ++  + +A+Q+Q  RL  +N+ELR K    + Q
Sbjct:   27 VYHLAGALGTELQGLARRFGPDAAAGLVPLVVRALELLEKAAV---GPAPD--SLQVSAQQAEVE--------------------------------LRRLREENQRLRQELG-------------------SGPQ-----EERALLRQLKEVTDRQRDELRAHNRDLQRRSQETEALQEQLQRLLLINSELRHKLAAVQTQ 167          
BLAST of RILP-like protein 1 vs. Ensembl Mouse
Match: Rilpl1 (Rab interacting lysosomal protein-like 1 [Source:MGI Symbol;Acc:MGI:1922945])

HSP 1 Score: 50.8322 bits (120), Expect = 9.104e-7
Identity = 35/73 (47.95%), Postives = 46/73 (63.01%), Query Frame = 2
Query: 1073 NNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKL 1285
            +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++L
Sbjct:   70 DPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHP--RTSPQP--ESGIKRL 138          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|D3ZUQ0|RIPL1_RAT (RILP-like protein 1 OS=Rattus norvegicus OX=10116 GN=Rilpl1 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 6.554e-47
Identity = 130/372 (34.95%), Postives = 200/372 (53.76%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G +FER+IDQ G +A++ LMPKV+ VLE LE    R+   A ++  L+  + +L +E + R ++  +++K+LE +E+ W  E ++L+S I +LQE+NK+L   L        E EL+         +   +S  + Q+M RLKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K           +       IP   +  ES++   +A L                +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++L  F
Sbjct:   24 VMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHV-APELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLNHKDVGFSEEELQ---------KHEGMSERERQVMKRLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGKLRERLQGEHSQNGEEEEAEIPPQPDGEESISDAEKAAL-------------DLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHP--RTSPQP--ESGIKRLFSF 362          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9JJC6|RIPL1_MOUSE (RILP-like protein 1 OS=Mus musculus OX=10090 GN=Rilpl1 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 4.426e-46
Identity = 128/372 (34.41%), Postives = 205/372 (55.11%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G +FER+IDQ G ++++ LMPKV+ VLE LE    R+   A ++  L+  + +L +E + R ++  +++K+LE +E+ W  E ++L+S I +LQE+NK+L         N    ++  ++E F   +Q  +S  + Q+M RLKE+ D+Q  E+R   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K               + G   H+Q   E  A +      ++  S+ +       +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++L  F
Sbjct:   24 VMDVYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSRHHV-APELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQL-------MTNLNHKDVGFSEEEF--QKQEGMSERERQVMKRLKEVVDKQRDELRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGK-----------LRERLQGE--HSQNGEEEEAEIQPQPDGEESISDAEKAALDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHP--RTSPQP--ESGIKRLFSF 362          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|Q17QG3|RIPL1_BOVIN (RILP-like protein 1 OS=Bos taurus OX=9913 GN=RILPL1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.866e-45
Identity = 133/372 (35.75%), Postives = 210/372 (56.45%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAG-DEEPQV-QGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G +FER+IDQ G +A++ L+PKV+ VLE LE    R+   A ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L+S I +LQE+NK+L         N    ++  ++E F   +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K               + G +  N E  E +A L   + +    SE + V     +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   +EE Q+ Q P    P  +MSP+P  ESGI++L  F
Sbjct:   24 VMDVYDIASLVGHEFERVIDQHGCEAIARLIPKVVRVLEILEVLVSRHHV-APELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQL-------MTNLSHKDVSFSEEEF--QKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGK-----------LRERLQGELNQNGE-EEPVAELGGEECV----SEAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENQIPQPPPIAHP--RMSPQP--ESGIKRLFSF 359          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|Q5EBL4|RIPL1_HUMAN (RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.006e-42
Identity = 129/372 (34.68%), Postives = 202/372 (54.30%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQ--VQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G +FER+IDQ G +A++ LMPKV+ VLE LE    R+   A ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L+S I +LQE+NK+L         N    ++  ++E F   +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+ +L  KE  +  +R        L K               + G    N E       + E  +     S+ + V     +  + RFTL EL+ VL ERNELKSK+  ++EELA YK+   EE     Q P    P  + SP+P  ESGI++L  F
Sbjct:   24 VMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHV-APELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQL-------MTNLSHKDVNFSEEEF--QKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRA------ELGK-----------LRERLQGEHSQNGEEEPETEPVGEESI-----SDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHP--RTSPQP--ESGIKRLFSF 359          
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Match: sp|A0PJP4|RIPL1_XENTR (RILP-like protein 1 OS=Xenopus tropicalis OX=8364 GN=rilpl1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.048e-40
Identity = 123/371 (33.15%), Postives = 206/371 (55.53%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKN-AGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKF 1294
            V+DVYD+A+ +G++FER+IDQ+G + +  LMPKV+ VLE LE    R      ++  L+  + +L LE + R ++  +++K+LE +E+ W  E ++L++ I +LQE+NK+L         N  + ++ +T+E F   +   +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR +  V + Q   L+E+K +L+  L  KE     MR  +                       + G    N E  ++   L+E  ++     E + ++    ++ + RFTL EL+ VL ERNELK+K+  ++EELA YK+   DEE ++  P +    +  +P P +ESGI++L  F
Sbjct:   16 VMDVYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINP-EMEELRLELDRLRLERMDRIEKEKKHQKELELVEDVWRGEAQDLLNQIAQLQEENKQL-------VSNLSQKDINLTEEEF--QKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEI-----------------GKLRDKLKGEQHTNGEEIKTET-LNEESIL-----ETEKLSLDLKDSNRPRFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADEEHKL--PQSSPVIDSKAPIP-QESGIKRLFSF 350          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A267FKF1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024830g1 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 6.377e-107
Identity = 179/386 (46.37%), Postives = 261/386 (67.62%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVF------------LSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAES--MARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKFRR 1300
            V DVYD A+ IGKDFE IID++G DAV+GLMPKVI VLEELE+ A R+ETE+K++V+LQ  V +LE E ++R  +R+R+E++LEQIEE W  ET+ELM ++ +LQEDN+RL +ELQ   E  E   ++  ++              L  +QS+    ++Q++++LK   + Q  +IR L++ELAQ+  D++A+Q QSDRLA++NAE+RR+HCVSK+Q+  LLE K+DL++ L  KE ++++M+ CVV                           P     AE+  M  ++E QLI+++NSEGKM+   S+ N+  RFT++EL+ VLMERNELK+KLIEVEEEL+VY+ AGD++  VQGP+N+EP+EK+ P    + GI++   FRR
Sbjct:    9 VADVYDAASAIGKDFELIIDRYGVDAVAGLMPKVISVLEELEDLATRHETESKELVDLQRVVDRLETEKVSRQGDRSRFERELEQIEELWRNETQELMDVVSRLQEDNRRLQQELQTAKEGGESATVQQQQQQQQQTLQQQQAGGGLLKKQSSKETAELQVLVKLKATVEAQRDQIRSLQRELAQRQADVEALQSQSDRLARMNAEIRRRHCVSKRQAQHLLESKADLEVRLQAKEQLLREMKDCVVG--------------------------PEAGAGAEANLMTSMTEEQLIEKLNSEGKMIIDRSDPNR-PRFTITELREVLMERNELKTKLIEVEEELSVYRQAGDDDAPVQGPINKEPDEKLYPDKSTDIGIKQF--FRR 365          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A267G642 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026493g1 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 7.663e-107
Identity = 180/383 (47.00%), Postives = 262/383 (68.41%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVF---------LSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAES--MARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKFRR 1300
            V DVYD A+ IGKDFE IID++G DAV+GLMPKVI VLEELE+ A R+ETE+K++V+LQ  V +LE E ++R  +R+R+E++LEQIEE W  ET+ELM ++ +LQEDN+RL +ELQ   E  E T ++  ++           L  +QS+    ++Q++++LK   + Q  +IR L++ELAQ+  D++A+Q QSDRLA++NAE+RR+HCVSK+Q+  LLE K+DL++ L  KE ++++M+ CVV                           P     AE+  M  ++E QLI+++NSEGKM+   S+ N+  RFT++EL+ VLMERNELK+KLIEVEEEL+VY+ AGD++  VQGP+N+EP+EK+ P    + GI++   FRR
Sbjct:    9 VADVYDAASAIGKDFELIIDRYGVDAVAGLMPKVISVLEELEDLATRHETESKELVDLQRVVDRLETEKVSRQGDRSRFERELEQIEELWRNETQELMDVVSRLQEDNRRLQQELQTAKEGGESTTVQQQQQQTLQQQQAGGSLLKKQSSKETAELQVLVKLKATVEAQRDQIRSLQRELAQRQADVEALQSQSDRLARMNAEIRRRHCVSKRQAQHLLESKADLEVRLQAKEQLLREMKDCVVG--------------------------PEAGAGAEANLMTSMTEEQLIEKLNSEGKMIIDRSDPNR-PRFTITELREVLMERNELKTKLIEVEEELSVYRQAGDDDAPVQGPINKEPDEKLYPDKSTDIGIKQF--FRR 362          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A4S2MBL7 (Uncharacterized protein (Fragment) OS=Opisthorchis felineus OX=147828 GN=CRM22_001230 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 1.588e-106
Identity = 186/375 (49.60%), Postives = 257/375 (68.53%), Query Frame = 2
Query:  170 TKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQ--CVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLL 1288
            T    V+DVYD+AA IGK+FE IID+ G D+VS LMPKVI VLEELE++A R+++E +++V LQ  V++LELE   RA +RTR EK+ EQ+EETW  ET+EL+ +I++L+E+N +L E ++      E+ E K     F   Q++T + E+IQLM+RLKE+ DRQ  E+R L ++LAQ+ +DLDAMQQQ+ RLAKLNA LRR+H VSKKQ+DQLL EK DL++ L  KE +I++MR   C   +D       +  ++            PH        A L+E+QLI+++N+E KM+T  S+ NK  RFT+ EL+ +L ERNELKS+LIEVEEEL+VY+ AGD EP VQGP+NREP +K   +  + SGI +  
Sbjct:   42 TPTITVLDVYDIAASIGKEFEAIIDRHGPDSVSSLMPKVINVLEELEDFASRFDSEGRELVTLQLAVRRLELEKCERANDRTRSEKEFEQLEETWQKETRELIQLIDRLKEENAQLREAVR------EQRESKDAPSDF--RQRTTGAIEEIQLMLRLKEVIDRQKIELRGLSRQLAQRNVDLDAMQQQATRLAKLNAVLRRRHYVSKKQTDQLLSEKHDLEMTLRAKEELIQQMRDHVCQSPTDRAADRSLTCGMTASLIKELASPGTPH--------APLTESQLIERLNTEDKMITNGSDPNK-PRFTVQELRDLLTERNELKSRLIEVEEELSVYRRAGDSEPPVQGPINREPSDKAFGRVERSSGIAQFF 399          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A4V3SGX1 (Uncharacterized protein (Fragment) OS=Opisthorchis felineus OX=147828 GN=CRM22_001230 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 5.061e-103
Identity = 187/389 (48.07%), Postives = 258/389 (66.32%), Query Frame = 2
Query:  170 TKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQ--CVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAG---------------DEEPQVQGPVNREPEEKMSPKPLKESGIQKL 1285
            T    V+DVYD+AA IGK+FE IID+ G D+VS LMPKVI VLEELE++A R+++E +++V LQ  V++LELE   RA +RTR EK+ EQ+EETW  ET+EL+ +I++L+E+N +L E ++      E+ E K     F   Q++T + E+IQLM+RLKE+ DRQ  E+R L ++LAQ+ +DLDAMQQQ+ RLAKLNA LRR+H VSKKQ+DQLL EK DL++ L  KE +I++MR   C   +D       +  ++            PH        A L+E+QLI+++N+E KM+T  S+ NK  RFT+ EL+ +L ERNELKS+LIEVEEEL+VY+ AG               D EP VQGP+NREP +K   +  + SGI +L
Sbjct:   42 TPTITVLDVYDIAASIGKEFEAIIDRHGPDSVSSLMPKVINVLEELEDFASRFDSEGRELVTLQLAVRRLELEKCERANDRTRSEKEFEQLEETWQKETRELIQLIDRLKEENAQLREAVR------EQRESKDAPSDF--RQRTTGAIEEIQLMLRLKEVIDRQKIELRGLSRQLAQRNVDLDAMQQQATRLAKLNAVLRRRHYVSKKQTDQLLSEKHDLEMTLRAKEELIQQMRDHVCQSPTDRAADRSLTCGMTASLIKELASPGTPH--------APLTESQLIERLNTEDKMITNGSDPNK-PRFTVQELRDLLTERNELKSRLIEVEEELSVYRRAGSRSSIQNSIPPASRWDSEPPVQGPINREPSDKAFGRVERSSGIAQL 413          
BLAST of RILP-like protein 1 vs. TrEMBL
Match: A0A4S2MBR7 (Uncharacterized protein (Fragment) OS=Opisthorchis felineus OX=147828 GN=CRM22_001230 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.270e-102
Identity = 186/390 (47.69%), Postives = 257/390 (65.90%), Query Frame = 2
Query:  170 TKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQ--CVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAG---------------DEEPQVQGPVNREPEEKMSPKPLKESGIQKLL 1288
            T    V+DVYD+AA IGK+FE IID+ G D+VS LMPKVI VLEELE++A R+++E +++V LQ  V++LELE   RA +RTR EK+ EQ+EETW  ET+EL+ +I++L+E+N +L E ++      E+ E K     F   Q++T + E+IQLM+RLKE+ DRQ  E+R L ++LAQ+ +DLDAMQQQ+ RLAKLNA LRR+H VSKKQ+DQLL EK DL++ L  KE +I++MR   C   +D       +  ++            PH        A L+E+QLI+++N+E KM+T  S+ NK  RFT+ EL+ +L ERNELKS+LIEVEEEL+VY+ AG               D EP VQGP+NREP +K   +  + SGI +  
Sbjct:   42 TPTITVLDVYDIAASIGKEFEAIIDRHGPDSVSSLMPKVINVLEELEDFASRFDSEGRELVTLQLAVRRLELEKCERANDRTRSEKEFEQLEETWQKETRELIQLIDRLKEENAQLREAVR------EQRESKDAPSDF--RQRTTGAIEEIQLMLRLKEVIDRQKIELRGLSRQLAQRNVDLDAMQQQATRLAKLNAVLRRRHYVSKKQTDQLLSEKHDLEMTLRAKEELIQQMRDHVCQSPTDRAADRSLTCGMTASLIKELASPGTPH--------APLTESQLIERLNTEDKMITNGSDPNK-PRFTVQELRDLLTERNELKSRLIEVEEELSVYRRAGSRSSIQNSIPPASRWDSEPPVQGPINREPSDKAFGRVERSSGIAQFF 414          
BLAST of RILP-like protein 1 vs. Ensembl Cavefish
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:NCBI gene;Acc:103045747])

HSP 1 Score: 167.548 bits (423), Expect = 3.224e-46
Identity = 135/384 (35.16%), Postives = 206/384 (53.65%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQ--LIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPL---KESGIQKLLKF-----RRSS 1306
            V+DVYD+AA +G++FERIIDQ+G +A+S LMPKV+ VLE LE    R    + +   L+  + KL LE + R ++  ++ K+LE +E+ W  E ++L+S I +LQE+NK L   L    ++   TE  I +       Q  +S  + Q+M +LKE+ D+Q  EIR   +EL  K  D++A+QQQ +RL K+N +LR K  +   Q   L+E+K +L+     ++  +  +RQ V                       + G    + E  E  A  S AQ  L D+   E  +     N   + RFTL EL+ VL ERNELK+K+  ++EE+A YK+  +E+ +  GP   +P   + P+      ESGI++L  F     RRSS
Sbjct:   19 VMDVYDIAAVVGQEFERIIDQYGCEALSRLMPKVVRVLEILEVLVSRNSI-SPETEELRLELDKLRLERMDRMEKERKHMKELELVEDVWRGEAQDLLSQIAQLQEENKTLLNNLS--VKDCSMTEEDIQR-------QEGMSERERQVMKKLKEVVDKQRDEIRAKDRELTLKNEDIEALQQQQNRLMKINHDLRHKITMVDAQGKALIEQKVELEAFAQARQQELGNLRQEVAR-----------------LRERLQGE-NTSSEAEEPAAPPSPAQEALCDE---EAGLDPKDPN---RPRFTLQELRDVLHERNELKAKVFMLQEEIAYYKS--EEQEEEAGPPTPDPSPTLRPRSRTGQPESGIKRLFNFFSRDKRRSS 366          
BLAST of RILP-like protein 1 vs. Ensembl Cavefish
Match: rilp (RILP-like protein 1 [Source:NCBI gene;Acc:103044209])

HSP 1 Score: 118.627 bits (296), Expect = 1.676e-28
Identity = 96/343 (27.99%), Postives = 166/343 (48.40%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEA-------KDIVNLQATVQKLELENLARAQERTRYE---KDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYK 1183
            V DVY++A  +G + E++ID +G  +V GL+PK++ VLE LE +A R +T         K    LQ   QK   +  AR  E +      KD +Q E+ W  + +EL + + +LQEDN+ L   L K                     +     ++ ++M++LKE+ D+Q  E+R   +E +    +++A+Q+Q DR  K+N ELR K  + + Q    +E ++D++ +LCEK+  I+++                                    +L ++   ++ +     I+   KM+   ++ N+   FT  E++ +L ERNELK+ L  V+EELA Y+
Sbjct:   26 VDDVYEIAKLVGSEVEKLIDHYGKASVEGLVPKIVKVLELLESFAARNQTLRCKEEELLKAFETLQVQQQK---KRTARESEESNNNADLKDWQQKEQKWRLKVEELQAQVLQLQEDNQELLGSLSK---------------------EDRTQRQEREVMLKLKEVVDKQRDELRAKVQETSSMSKEVEALQEQLDRFMKMNGELRHKQSMMQAQLKSSVERRADMEADLCEKQKEIERL----------------------------------TTQLEKASTHIAASTNNPTIDLTNKMIIDLNDPNRPC-FTKQEVRDMLFERNELKANLFLVQEELAYYQ 309          
BLAST of RILP-like protein 1 vs. Ensembl Sea Lamprey
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:HGNC Symbol;Acc:HGNC:26814])

HSP 1 Score: 141.739 bits (356), Expect = 3.943e-38
Identity = 111/337 (32.94%), Postives = 185/337 (54.90%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQF--GTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCV--VHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYK 1183
             +DVYD+AA +G+ FER +     G +AV  LM  VI VLE LE  A R   + +    L+  ++  + E +  +   +R++++LE +E  W    +E++  + +LQE+N++L   L++   ++ +TE++ T       Q   ++ ++  +MI+LKE+ D+Q  EIR   ++++QK  D++A+QQQ  RL K+N ELR K  V + Q   L+E+K +L+ +L  +E  I ++R+    V S  L + E               G + H+    E       ++L+D     GK+V    + N+  RFTL EL+ VL ERNELK+KL  ++EEL  YK
Sbjct:   21 ALDVYDIAALLGRGFERALAAGTEGGEAVHELMAPVIRVLEMLEALAVRNGADTES-TTLREQLESAKRETITLSARDSRHKQELELVETYWREREEEMLGCMTELQEENRKLDSALRRRDTDNADTEVEET-------QAEGLTEKERDVMIKLKEVVDKQRDEIRAKDRDISQKNEDVEALQQQLSRLIKINNELRHKLAVMEAQGKSLIEQKVELEADLQSREQEIGRLRETAASVASAFLEQSECQ------------EGAVAHHPGTGEDKG----SRLMD-----GKLVVDLKDPNR-PRFTLQELREVLQERNELKAKLFLLQEELVYYK 327          
BLAST of RILP-like protein 1 vs. Ensembl Nematostella
Match: EDO39686 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9D5])

HSP 1 Score: 123.25 bits (308), Expect = 8.386e-31
Identity = 117/401 (29.18%), Postives = 187/401 (46.63%), Query Frame = 2
Query:  167 MTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLE--------------LCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMAR-LSEAQLIDQ-------INSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLK-FRR 1300
            M       DVY+ A+ IG+D E+IIDQ+G +AV  LMPKV+ VLEELE      E E  +   L+   ++L LE    A +R + +++L   +     E   L +M+ KL+E+NK+L  E Q           K+T   ++S         D ++M R+KE  D Q   IR    E+  +  D+DAM++Q DRL  +N  LRR     + +   L +EK++LQ E              L E E +   +       D  N+       +        H    +N    E +A  + E ++++           EG+M      +  + R+T +EL+ +L ERN+LK ++  +++ELA Y+   ++E Q   P  + P+    P   +ESGI K+   F R
Sbjct:    1 MALDLSTADVYEQASVIGQDIEKIIDQYGHEAVLDLMPKVVRVLEELEILVSERENEKLEFAELKMENERLYLEIKKEASQRRKLDEELYSTQ--IDGEANNLKTMVAKLKEENKKLRMEYQASMNE------KLTA-TYVSAPG------DAEVMRRMKETIDSQREAIRLRNTEIDNQRSDIDAMEEQIDRLTNINESLRRNLSAKQTRIRMLAKEKAELQAEFKAFKLDLGKENIGLSESEELTGDIHDSYEQEDDGNELTELHQRNNS------HKEEENNNGTHEKVASEVHEWEILENGENEEKVEWEEGRMDKSAPLDPNRPRYTKAELQEILNERNQLKEEVFFLKDELAYYRPKNEDEEQT--PTAKSPKTSKKPSRREESGISKIFSIFNR 378          
BLAST of RILP-like protein 1 vs. Ensembl Medaka
Match: RILPL1 (Rab interacting lysosomal protein like 1 [Source:NCBI gene;Acc:101169547])

HSP 1 Score: 158.303 bits (399), Expect = 8.004e-43
Identity = 129/384 (33.59%), Postives = 197/384 (51.30%), Query Frame = 2
Query:  185 VVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRY---ETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPE--EKMSPKPLKESGIQKLLKF-----RRSS 1306
            V+DVYD+AA +G++FERIIDQ+G +A+S LMPKV+ VLE LE    R    ETE      L+  + +L +E L R ++  R+ ++LE++E+ W  E ++L+S I +LQE+NK L   +  + +   E +L+         +   ++  + Q+M++LKE+ D+Q  EIR   +EL  K  D++A+QQQ  RL K+N +LR K  V + Q   L+ +K +L+     +   +  +RQ V                       + G  P    L E                 G +     N   + RFTL EL+ VL ERNELK+K+  ++EEL  YK+   EE  V    +  PE   +    P +ESGI++L  F     RRSS
Sbjct:   23 VMDVYDMAAVVGQEFERIIDQYGCEALSRLMPKVVRVLEILEVMVSRRMSPETE-----ELRLELDRLRMERLERLEKEKRHRQELERVEDVWRGEAQDLLSQIAQLQEENKALLSNM-SINDTMNEEDLQ---------RHEGMTEREKQVMVKLKEVVDKQRDEIRAKDRELTLKNEDVEALQQQQSRLMKINHDLRHKTSVVEAQGKALIGQKVELEAAAQAQAQEVCALRQEVAR-----------------LRERLQGGPPA---LCE--------------EDSGGLDLRDPN---RPRFTLQELRDVLHERNELKAKVFLLQEELTYYKSDEAEEEIVTPSPSPSPELRNRSRSSPPQESGIKRLFSFFSRDKRRSS 354          
BLAST of RILP-like protein 1 vs. Ensembl Medaka
Match: rilp (RILP-like protein 1 [Source:NCBI gene;Acc:101172996])

HSP 1 Score: 68.5514 bits (166), Expect = 6.277e-12
Identity = 53/197 (26.90%), Postives = 100/197 (50.76%), Query Frame = 2
Query:  593 GQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYK 1183
             Q+  +  ++ ++M++LK++ D+Q  E+R   +E A    +++A+Q+Q +R  K+N ELR K  V + Q    +E K+D++ +L EK  +I+K++  + +++S+     S                    +  +  AR S+               G + + +Q  FT  EL+ ++ ERNELK+ L  V+EEL  Y+
Sbjct:  147 AQEDRVQRQEREVMLKLKQVVDKQRDELRAKVQENATISKEVEALQEQLERFMKMNGELRHKQNVLQAQLTSAVERKTDMEADLKEKHKVIEKLQAQLNNTNSITSSSPS--------------------QTPQESARKSK---------------GDTKDPEQPCFTKKELRDIIFERNELKTNLFLVQEELNYYQ 308          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000009316.1 (SMESG000009316.1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 421/421 (100.00%), Postives = 421/421 (100.00%), Query Frame = 2
Query:   62 MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKFRRSSVPVRHN 1324
            MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKFRRSSVPVRHN
Sbjct:    1 MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLKFRRSSVPVRHN 421          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000009316.1 (SMESG000009316.1)

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 407/410 (99.27%), Postives = 408/410 (99.51%), Query Frame = 2
Query:   62 MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLK 1291
            MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQK  +
Sbjct:    1 MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKFFQ 410          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000009316.1 (SMESG000009316.1)

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 396/410 (96.59%), Postives = 398/410 (97.07%), Query Frame = 2
Query:   62 MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLK 1291
            MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITK          +SNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQK  +
Sbjct:    1 MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITK----------VSNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKFFQ 400          
BLAST of RILP-like protein 1 vs. Planmine SMEST
Match: SMESG000002944.1 (SMESG000002944.1)

HSP 1 Score: 177.563 bits (449), Expect = 8.095e-51
Identity = 121/366 (33.06%), Postives = 199/366 (54.37%), Query Frame = 2
Query:  194 VYDVAAEIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNKRLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDRQTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQLLEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKXXXXXXXXXXXXXXXIHGRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELKGVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPLKESGIQKLLK 1291
            VY++A E+  D + + +     A++ L+ K++ VLEELE ++Q YE + K+I NL+  ++++E E + + QER  YEKDLE++EE+WH E+ ELM  +EKLQE+N  +   L++  +       K   + F   QQ  I N    + ++LKE  D+Q  EI+ LKKE+AQ+C+D DAMQQQ   L+ +NAE+   HC +K  S +L+EEK +++ ++                   +NK                           +S+   ++   ID+     K+     +N     F+  E++  L +   LKS++IE E  L +Y+++  EE +VQGP+N+EP +KMSP   ++SGI+K  +
Sbjct:    7 VYEIAYELENDLKNLSESLDKIAITPLIHKIVNVLEELERHSQLYEMKRKEIDNLKVAIKRIEDEAVNKEQERLFYEKDLEKLEESWHAESLELMKTMEKLQEENNDMKTLLEQANKKP-----KFNSKRF--SQQLEIQN----VQLKLKETIDKQVEEIKLLKKEIAQRCIDFDAMQQQCLNLSNINAEICENHCNNKIMSKRLIEEKVNIEAQIL------------------INK---------------------------KSIQHSNDDVFIDECLKTDKI---SQSNVPDINFSWEEVQEYLQDCRRLKSEVIEKEGRLLIYRHSVIEEDEVQGPINKEPVDKMSPSYCQQSGIRKYFQ 313          
The following BLAST results are available for this feature:
BLAST of RILP-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RILPL16.259e-4334.68Rab interacting lysosomal protein like 1 [Source:H... [more]
RILPL13.235e-4234.86Rab interacting lysosomal protein like 1 [Source:H... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rilp-11.599e-3828.26RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
rilp-11.610e-3828.22RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
rilp-11.610e-3828.22RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
rilp-11.610e-3828.22RILP (Rab7-Interacting Lysosomal Protein) homolog ... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rilpl1.904e-3938.14gene:FBgn0024985 transcript:FBtr0070225[more]
Rilpl1.976e-3938.14gene:FBgn0024985 transcript:FBtr0332291[more]
Rilpl9.517e-3938.14gene:FBgn0024985 transcript:FBtr0332292[more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rilp7.843e-2727.63Rab interacting lysosomal protein [Source:ZFIN;Acc... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnip39.413e-4133.15TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:... [more]
tnip32.119e-3933.06TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:... [more]
tnip33.782e-3832.88TNFAIP3 interacting protein 3 [Source:Xenbase;Acc:... [more]
rilp1.813e-1826.87Rab interacting lysosomal protein [Source:NCBI gen... [more]
rilp1.785e-828.80Rab interacting lysosomal protein [Source:NCBI gen... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rilpl16.327e-4734.41Rab interacting lysosomal protein-like 1 [Source:M... [more]
Rilpl17.970e-1133.16Rab interacting lysosomal protein-like 1 [Source:M... [more]
Rilp4.027e-828.22Rab interacting lysosomal protein [Source:MGI Symb... [more]
Rilpl19.104e-747.95Rab interacting lysosomal protein-like 1 [Source:M... [more]
back to top
BLAST of RILP-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3ZUQ0|RIPL1_RAT6.554e-4734.95RILP-like protein 1 OS=Rattus norvegicus OX=10116 ... [more]
sp|Q9JJC6|RIPL1_MOUSE4.426e-4634.41RILP-like protein 1 OS=Mus musculus OX=10090 GN=Ri... [more]
sp|Q17QG3|RIPL1_BOVIN5.866e-4535.75RILP-like protein 1 OS=Bos taurus OX=9913 GN=RILPL... [more]
sp|Q5EBL4|RIPL1_HUMAN3.006e-4234.68RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RIL... [more]
sp|A0PJP4|RIPL1_XENTR8.048e-4033.15RILP-like protein 1 OS=Xenopus tropicalis OX=8364 ... [more]
back to top
BLAST of RILP-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FKF16.377e-10746.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G6427.663e-10747.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4S2MBL71.588e-10649.60Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4V3SGX15.061e-10348.07Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4S2MBR71.270e-10247.69Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RILPL13.224e-4635.16Rab interacting lysosomal protein like 1 [Source:N... [more]
rilp1.676e-2827.99RILP-like protein 1 [Source:NCBI gene;Acc:10304420... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RILPL13.943e-3832.94Rab interacting lysosomal protein like 1 [Source:H... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RILP-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO396868.386e-3129.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RILP-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RILPL18.004e-4333.59Rab interacting lysosomal protein like 1 [Source:N... [more]
rilp6.277e-1226.90RILP-like protein 1 [Source:NCBI gene;Acc:10117299... [more]
back to top
BLAST of RILP-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000009316.10.000e+0100.00SMESG000009316.1[more]
SMESG000009316.10.000e+099.27SMESG000009316.1[more]
SMESG000009316.10.000e+096.59SMESG000009316.1[more]
SMESG000002944.18.095e-5133.06SMESG000002944.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009226 ID=SMED30009226|Name=RILP-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1669bp
GGTTATTTAAATCTAAATCTGGAAGAGGTCATTTTAACAAATGCGTTTAA
TTATAAATTAAATGTATAAGAGTTCGTTTGATAGACGAAGCAGCTTAGAT
AGTATTGGACAAAACATTTTCGATTTTCCAAAATATTCTACGAACTTATC
GGGTCCGTATTATTTGATGACAAAACCATTTCGAGTTGTCGATGTCTATG
ACGTAGCAGCAGAAATCGGAAAAGATTTTGAAAGAATAATTGATCAATTC
GGAACAGATGCCGTATCGGGTCTGATGCCAAAAGTTATTGGTGTTCTTGA
GGAATTAGAAGAATATGCTCAACGATATGAAACAGAAGCCAAAGATATTG
TGAATCTTCAGGCCACTGTTCAAAAACTTGAATTAGAGAATTTAGCTCGT
GCTCAGGAACGCACTCGCTATGAAAAAGATTTGGAACAAATAGAAGAAAC
TTGGCACTGCGAAACAAAAGAATTAATGAGTATGATTGAGAAATTACAAG
AAGACAATAAACGACTTCACGAAGAATTACAAAAAGTCTTCGAAAATTCA
GAAGAAACCGAACTCAAAATTACAAAAGAAGTTTTCCTGTCAGGCCAACA
ATCGACAATCTCCAATGAAGACATACAACTTATGATTCGCCTGAAAGAAA
TTACTGATCGGCAGACTCATGAGATTCGAGAATTGAAAAAGGAATTGGCT
CAAAAGTGTTTAGATTTAGATGCGATGCAACAACAAAGTGATCGACTAGC
TAAATTAAATGCAGAGTTGCGTCGCAAACATTGCGTCAGTAAAAAACAGT
CTGACCAGTTACTGGAAGAAAAAAGTGATCTACAATTAGAGCTGTGTGAA
AAAGAGCATATTATTAAAAAGATGCGACAATGTGTTGTCCATTCTGATTC
ACTCAACAAAGATGAGAACAGTGATTTGGTTAGCGAAGACGATTCGGATG
TTAGTATCCATGGACGCATTCCACATAATCAAGAACTAGCTGAATCTATG
GCTAGACTTTCTGAAGCTCAGTTAATTGATCAAATAAATTCCGAAGGAAA
GATGGTCACTGGGCATTCAAATAACAACAAACAAACCCGATTTACATTAT
CAGAACTGAAAGGAGTATTAATGGAACGAAATGAGTTGAAATCCAAATTA
ATTGAAGTCGAAGAAGAACTAGCAGTGTATAAAAATGCTGGAGACGAAGA
GCCACAAGTTCAAGGACCAGTTAATCGGGAACCAGAGGAAAAAATGTCCC
CAAAACCTCTCAAAGAATCTGGAATTCAGAAATTATTAAAATTCCGCCGA
TCAAGTGTTCCAGTACGGCATAATTGATCAAAAACTGATTTGTATTACAC
TTCGCTGTGATCACTATCATTCCTCATTCAATCCATCAGATTCTATGTGA
ATTTATCCTCAGTGGTTTGAATTTTTTTTCCGTTTTGATATTCAGATTCG
TTTTTATGTCATGTTGATGTTTCAAGGATTCTCTTGAATTTGTATTTATG
TATCGCCGTGTTATTTAAGTAGCACTTTTGTCGCTACTCCATTAGTCTTG
GAAATTAATATAGTGTATTCAGTTGTTTGTATTTGTCAAAGTTCATAGAT
TAAATAGTTTCACTAAAACAAAGTTTCGAAGTTTTATCTGTCAGTAGTAA
ACTTGTCTGGTGACGCACG
back to top

protein sequence of SMED30009226-orf-1

>SMED30009226-orf-1 ID=SMED30009226-orf-1|Name=SMED30009226-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=422bp
MYKSSFDRRSSLDSIGQNIFDFPKYSTNLSGPYYLMTKPFRVVDVYDVAA
EIGKDFERIIDQFGTDAVSGLMPKVIGVLEELEEYAQRYETEAKDIVNLQ
ATVQKLELENLARAQERTRYEKDLEQIEETWHCETKELMSMIEKLQEDNK
RLHEELQKVFENSEETELKITKEVFLSGQQSTISNEDIQLMIRLKEITDR
QTHEIRELKKELAQKCLDLDAMQQQSDRLAKLNAELRRKHCVSKKQSDQL
LEEKSDLQLELCEKEHIIKKMRQCVVHSDSLNKDENSDLVSEDDSDVSIH
GRIPHNQELAESMARLSEAQLIDQINSEGKMVTGHSNNNKQTRFTLSELK
GVLMERNELKSKLIEVEEELAVYKNAGDEEPQVQGPVNREPEEKMSPKPL
KESGIQKLLKFRRSSVPVRHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0051959dynein light intermediate chain binding
GO:0031267small GTPase binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR034743RH1
IPR034744RH2
IPR021563RILP_dimer
IPR019143JNK/Rab-associated_protein-1_N
Vocabulary: cellular component
TermDefinition
GO:0036064ciliary basal body
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 191..239
NoneNo IPR availableCOILSCoilCoilcoord: 349..376
NoneNo IPR availableCOILSCoilCoilcoord: 79..109
NoneNo IPR availableCOILSCoilCoilcoord: 135..169
NoneNo IPR availableGENE3DG3DSA:1.20.58.1770coord: 36..127
e-value: 2.8E-8
score: 35.4
NoneNo IPR availableGENE3DG3DSA:1.10.3390.20coord: 346..385
e-value: 1.9E-5
score: 26.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 375..404
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 385..404
NoneNo IPR availablePANTHERPTHR21502:SF6RILP-LIKE PROTEIN 1coord: 41..411
NoneNo IPR availablePANTHERPTHR21502ZINC FINGER PROTEIN DZIP1coord: 41..411
NoneNo IPR availableCDDcd14445RILP-likecoord: 42..116
e-value: 1.74091E-26
score: 99.9756
NoneNo IPR availableSUPERFAMILYSSF161256RILP dimerisation regioncoord: 345..410
IPR019143JNK/Rab-associated protein-1, N-terminalPFAMPF09744Jnk-SapK_ap_Ncoord: 45..201
e-value: 1.1E-34
score: 119.9
IPR021563Rab interacting lysosomal protein, dimerization domainPFAMPF11461RILPcoord: 345..398
e-value: 1.9E-13
score: 50.4
IPR034743RH1 domainPROSITEPS51776RH1coord: 28..116
score: 18.946
IPR034744RH2 domainPROSITEPS51777RH2coord: 341..408
score: 18.798