Pyridoxal kinase

Overview
NamePyridoxal kinase
Smed IDSMED30009225
Length (bp)1250
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyridoxal kinase (SMED30009225) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyridoxal kinase (SMED30009225) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyridoxal kinase (SMED30009225) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyridoxal kinase (SMED30009225) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009225

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30009225h1SMcG0015046 dd_Smed_v4_6613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009225h1SMcG0015046 dd_Smed_v4_6613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30009225h1SMcG0015046 Contig51325uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009225h1SMcG0015046 Contig51325newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30009225h1SMcG0015046 PL06012A1G06smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30009225h1SMcG0015046 Contig4867GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30009225h1SMcG0016893 Contig4867GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pyridoxal kinase vs. Ensembl Human
Match: PDXK (pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819])

HSP 1 Score: 264.618 bits (675), Expect = 1.652e-85
Identity = 131/303 (43.23%), Postives = 197/303 (65.02%), Query Frame = 2
Query:  119 ENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGD----NGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSD------VLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            E  ++LSIQSHV+ GYVGN+    PLQ+LG ++D +NSVQFSNHT Y   KGQVLNS +L++LY+GL+ N +  Y  ++TGY   K+FL  V +IV+++K+ NP  ++ CDPV+GD     G MYVP +LL VY+ KV+ LAD++ PNQ+EAELL+G +I S+ + L+ + + H+ G  T V+TSS++ PS       ++ G   + N  G    +R R++I K+   FVGTGDLF ++ L W+ K PNNL+  C + + ++  VL+RT+   +        P    LEL++V S +D+ +P+
Sbjct:    3 EECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDL-PSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPE 304          
BLAST of Pyridoxal kinase vs. Ensembl Human
Match: PDXK (pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819])

HSP 1 Score: 225.713 bits (574), Expect = 9.232e-71
Identity = 120/303 (39.60%), Postives = 178/303 (58.75%), Query Frame = 2
Query:  119 ENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGD----NGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSD------VLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            E  ++LSIQSHV+ GYVGN+    PLQ+LG ++D +NSVQFSNHT Y   KGQVLNS +L++LY+GL+ N +  Y  ++T                             CDPV+GD     G MYVP +LL VY+ KV+ LAD++ PNQ+EAELL+G +I S+ + L+ + + H+ G  T V+TSS++ PS       ++ G   + N  G    +R R++I K+   FVGTGDLF ++ L W+ K PNNL+  C + + ++  VL+RT+   +        P    LEL++V S +D+ +P+
Sbjct:    3 EECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLT----------------------------VCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDL-PSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPE 276          
BLAST of Pyridoxal kinase vs. Ensembl Human
Match: PDXK (pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819])

HSP 1 Score: 201.83 bits (512), Expect = 1.177e-61
Identity = 103/257 (40.08%), Postives = 161/257 (62.65%), Query Frame = 2
Query:  257 YEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGD----NGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSD------VLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            Y   KGQVLNS +L++LY+GL+ N +  Y  ++TGY   K+FL  V +IV+++K+ NP  ++ CDPV+GD     G MYVP +LL VY+ KV+ LAD++ PNQ+EAELL+G +I S+ + L+ + + H+ G  T V+TSS++ PS       ++ G   + N  G    +R R++I K+   FVGTGDLF ++ L W+ K PNNL+  C + + ++  VL+RT+   +        P    LEL++V S +D+ +P+
Sbjct:    9 YAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDL-PSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPE 264          
BLAST of Pyridoxal kinase vs. Ensembl Human
Match: PDXK (pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819])

HSP 1 Score: 68.5514 bits (166), Expect = 6.749e-14
Identity = 28/46 (60.87%), Postives = 37/46 (80.43%), Query Frame = 2
Query:  119 ENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTK 256
            E  ++LSIQSHV+ GYVGN+    PLQ+LG ++D +NSVQFSNHT+
Sbjct:    3 EECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTE 48          
BLAST of Pyridoxal kinase vs. Ensembl Celegans
Match: pdxk-1 (Putative pyridoxal kinase [Source:UniProtKB/Swiss-Prot;Acc:O01824])

HSP 1 Score: 250.751 bits (639), Expect = 1.437e-80
Identity = 132/295 (44.75%), Postives = 189/295 (64.07%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGP--SDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQSFDRI 1006
            ++LSIQSHVV GY GNKC + PLQ+ G +VDFINSVQFSNH  YE  KGQ L  ++L++LY+GL  N + NY+ ++TGY G+ TFL+++ ++V+D+K+ N N  F CDPVMGDNG+ Y P EL+ VYR  ++ LADV+ PN +E   LTG  I++E D L+A+   H KGVKT VVTS   G   ++ L  + S   +      +R   P++   FVGTGD F SL + W  +   ++ E   RV+ SMQ ++++T + Y  L  + N       EL+L+ S +DL+ P + D+I
Sbjct:   17 RVLSIQSHVVHGYAGNKCSVFPLQLHGFEVDFINSVQFSNHAGYEHVKGQKLTEKELEELYEGLTLNNINNYTHVLTGYCGNVTFLQKIADVVKDLKKKNGNTTFVCDPVMGDNGRYYTPKELMPVYRDLIIPLADVLTPNAFELGELTGSPIETEEDCLRAVNELHAKGVKTVVVTSGVTGAQTNESLRCYASVKGS----HVYRFTFPRLVGQFVGTGDTFTSLLVVWLDELNGDVSEAVKRVLASMQCLIRKT-SSYAQLQVDTNSRAM--CELRLIQSRKDLLWPPTCDQI 304          
BLAST of Pyridoxal kinase vs. Ensembl Celegans
Match: pdxk-1 (Putative pyridoxal kinase [Source:UniProtKB/Swiss-Prot;Acc:O01824])

HSP 1 Score: 251.136 bits (640), Expect = 2.197e-80
Identity = 132/295 (44.75%), Postives = 189/295 (64.07%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGP--SDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQSFDRI 1006
            ++LSIQSHVV GY GNKC + PLQ+ G +VDFINSVQFSNH  YE  KGQ L  ++L++LY+GL  N + NY+ ++TGY G+ TFL+++ ++V+D+K+ N N  F CDPVMGDNG+ Y P EL+ VYR  ++ LADV+ PN +E   LTG  I++E D L+A+   H KGVKT VVTS   G   ++ L  + S   +      +R   P++   FVGTGD F SL + W  +   ++ E   RV+ SMQ ++++T + Y  L  + N       EL+L+ S +DL+ P + D+I
Sbjct:   37 RVLSIQSHVVHGYAGNKCSVFPLQLHGFEVDFINSVQFSNHAGYEHVKGQKLTEKELEELYEGLTLNNINNYTHVLTGYCGNVTFLQKIADVVKDLKKKNGNTTFVCDPVMGDNGRYYTPKELMPVYRDLIIPLADVLTPNAFELGELTGSPIETEEDCLRAVNELHAKGVKTVVVTSGVTGAQTNESLRCYASVKGS----HVYRFTFPRLVGQFVGTGDTFTSLLVVWLDELNGDVSEAVKRVLASMQCLIRKT-SSYAQLQVDTNSRAM--CELRLIQSRKDLLWPPTCDQI 324          
BLAST of Pyridoxal kinase vs. Ensembl Celegans
Match: pdxk-1 (Putative pyridoxal kinase [Source:UniProtKB/Swiss-Prot;Acc:O01824])

HSP 1 Score: 246.128 bits (627), Expect = 1.432e-78
Identity = 133/305 (43.61%), Postives = 191/305 (62.62%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNH----------TKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGP--SDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQSFDRI 1006
            ++LSIQSHVV GY GNKC + PLQ+ G +VDFINSVQFSNH          T+YE  KGQ L  ++L++LY+GL  N + NY+ ++TGY G+ TFL+++ ++V+D+K+ N N  F CDPVMGDNG+ Y P EL+ VYR  ++ LADV+ PN +E   LTG  I++E D L+A+   H KGVKT VVTS   G   ++ L  + S   +      +R   P++   FVGTGD F SL + W  +   ++ E   RV+ SMQ ++++T + Y  L  + N       EL+L+ S +DL+ P + D+I
Sbjct:   17 RVLSIQSHVVHGYAGNKCSVFPLQLHGFEVDFINSVQFSNHAGNIEYLTLPTRYEHVKGQKLTEKELEELYEGLTLNNINNYTHVLTGYCGNVTFLQKIADVVKDLKKKNGNTTFVCDPVMGDNGRYYTPKELMPVYRDLIIPLADVLTPNAFELGELTGSPIETEEDCLRAVNELHAKGVKTVVVTSGVTGAQTNESLRCYASVKGS----HVYRFTFPRLVGQFVGTGDTFTSLLVVWLDELNGDVSEAVKRVLASMQCLIRKT-SSYAQLQVDTNSRAM--CELRLIQSRKDLLWPPTCDQI 314          
BLAST of Pyridoxal kinase vs. Ensembl Celegans
Match: pdxk-1 (Putative pyridoxal kinase [Source:UniProtKB/Swiss-Prot;Acc:O01824])

HSP 1 Score: 246.128 bits (627), Expect = 1.432e-78
Identity = 133/305 (43.61%), Postives = 191/305 (62.62%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNH----------TKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGP--SDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQSFDRI 1006
            ++LSIQSHVV GY GNKC + PLQ+ G +VDFINSVQFSNH          T+YE  KGQ L  ++L++LY+GL  N + NY+ ++TGY G+ TFL+++ ++V+D+K+ N N  F CDPVMGDNG+ Y P EL+ VYR  ++ LADV+ PN +E   LTG  I++E D L+A+   H KGVKT VVTS   G   ++ L  + S   +      +R   P++   FVGTGD F SL + W  +   ++ E   RV+ SMQ ++++T + Y  L  + N       EL+L+ S +DL+ P + D+I
Sbjct:   17 RVLSIQSHVVHGYAGNKCSVFPLQLHGFEVDFINSVQFSNHAGNIEYLTLPTRYEHVKGQKLTEKELEELYEGLTLNNINNYTHVLTGYCGNVTFLQKIADVVKDLKKKNGNTTFVCDPVMGDNGRYYTPKELMPVYRDLIIPLADVLTPNAFELGELTGSPIETEEDCLRAVNELHAKGVKTVVVTSGVTGAQTNESLRCYASVKGS----HVYRFTFPRLVGQFVGTGDTFTSLLVVWLDELNGDVSEAVKRVLASMQCLIRKT-SSYAQLQVDTNSRAM--CELRLIQSRKDLLWPPTCDQI 314          
BLAST of Pyridoxal kinase vs. Ensembl Fly
Match: Pdxk (gene:FBgn0085484 transcript:FBtr0112761)

HSP 1 Score: 257.684 bits (657), Expect = 2.943e-83
Identity = 138/293 (47.10%), Postives = 192/293 (65.53%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCN-YSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKINNDGQPQRFRLEIPKIPYD---FVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHY-EGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            ++LSIQSHVV GYVGNK    PLQ+LG DVD +NSVQFSNHT Y+  KG V N ++L  +++GL+ N L   YS ++TGYIG+  FL +V +I++ +++ NP  ++ CDPVMGDNG++YVP ELL VYR +++ LAD++ PNQ+E ELLT  E++SE  + +A+  FH +G+KT V++SS++G   VL  F+S+ N      R  ++IPK       F GTGDLF SLFL  S     ++  V  + I S+Q V+KRTVA    G N  +   E    ELKLV S  ++  PQ
Sbjct:   11 RVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSNHTGYKTFKGPVSNEKELATIFEGLEENELLPLYSHLLTGYIGNPLFLRQVGHILKKLRQANPGLVYVCDPVMGDNGQLYVPKELLPVYRDEIIPLADIITPNQFEVELLTEKEVRSEAAVWEAMEWFHQRGIKTVVISSSDLGQPGVLRAFLSQQNGP----RLAIDIPKQGGKDLVFTGTGDLFASLFLAHS-HGSKDIANVFEKTIASLQAVIKRTVASLPNGGNGPVKAAER---ELKLVQSKTEIEQPQ 295          
BLAST of Pyridoxal kinase vs. Ensembl Zebrafish
Match: pdxkb (pyridoxal (pyridoxine, vitamin B6) kinase b [Source:ZFIN;Acc:ZDB-GENE-030616-521])

HSP 1 Score: 268.855 bits (686), Expect = 2.394e-87
Identity = 132/294 (44.90%), Postives = 189/294 (64.29%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPS-----DVLFGFVSKINNDG--QPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++LSIQSHVV GYVGNK    PLQ++G +VD INSVQFSNHT Y   KGQVL + +L  LY+G+K N + +Y  ++TGY    +FLE V +IV+++KR NPN ++ CDPV+GD+G MYVP  L  VY++KV+ +AD++ PNQ+EAELLTG  I +E D ++ + L H  G  T V+TSS++ P       V  G    +  DG    QR R+E+PK+   FVGTGDLF ++ L W+  +P +L+  C +    M  V++RT+++   +      P    LEL++V S  D+ +P
Sbjct:    4 RVLSIQSHVVRGYVGNKSASFPLQVMGFEVDSINSVQFSNHTGYAHWKGQVLTADELHVLYEGIKLNNVNHYDYVLTGYNRDTSFLEMVADIVQELKRANPNLVYVCDPVLGDHGSMYVPQNLHPVYKNKVVPVADIITPNQFEAELLTGKNISTEKDAVEVMDLLHKMGPDTVVITSSDLPPRLGDRFLVSLGSQRILMPDGTRTTQRIRIEVPKVDAVFVGTGDLFAAMLLAWTHHYPTDLKTACEKTFSVMHHVIQRTISYAHEMAGPGRRPSPSQLELRMVQSKADIEDP 297          
BLAST of Pyridoxal kinase vs. Ensembl Zebrafish
Match: pdxka (pyridoxal (pyridoxine, vitamin B6) kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8376])

HSP 1 Score: 265.774 bits (678), Expect = 3.077e-86
Identity = 133/295 (45.08%), Postives = 191/295 (64.75%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSD------VLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++LS+QSHVV GYVGNK    PLQ+LG +VD INSVQFSNHT YE  KGQVL + +L  LY+G+K N + +Y  ++TGY    +FL+ V +IV+++KR NP+ ++ CDPV+GDNG MYVP  LL +YR +V+  AD++ PNQ+EAELL+G +I SE D ++ + L H+ G  T V+TSS++ PS       V  G   K+  DG    Q+ R++IP++   FVGTGDLF ++ L W+   P +L+  C +    +  V+KRT+ +   +      P    LEL++V S  D+ NP
Sbjct:    4 RVLSVQSHVVRGYVGNKSATFPLQVLGFEVDTINSVQFSNHTGYEHWKGQVLTADELNVLYEGIKLNDVNHYDYVLTGYTRDYSFLDMVVDIVQELKRANPSLVYVCDPVLGDNGAMYVPENLLPIYRDRVVPAADIITPNQFEAELLSGRKIHSEKDAVEVMNLLHSMGPDTVVITSSDL-PSPLGDQYLVALGSQKKVRTDGSMVTQQIRMDIPRVDAVFVGTGDLFAAMLLAWTHHHP-DLKMACEKTASVLHHVIKRTMTYAHEVAGPNRRPSPAQLELRMVQSKADIENP 296          
BLAST of Pyridoxal kinase vs. Ensembl Zebrafish
Match: pdxka (pyridoxal (pyridoxine, vitamin B6) kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8376])

HSP 1 Score: 206.068 bits (523), Expect = 1.596e-64
Identity = 96/181 (53.04%), Postives = 134/181 (74.03%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNI 670
            ++LS+QSHVV GYVGNK    PLQ+LG +VD INSVQFSNHT YE  KGQVL + +L  LY+G+K N + +Y  ++TGY    +FL+ V +IV+++KR NP+ ++ CDPV+GDNG MYVP  LL +YR +V+  AD++ PNQ+EAELL+G +I SE D ++ + L H+ G  T V+TSS++
Sbjct:    4 RVLSVQSHVVRGYVGNKSATFPLQVLGFEVDTINSVQFSNHTGYEHWKGQVLTADELNVLYEGIKLNDVNHYDYVLTGYTRDYSFLDMVVDIVQELKRANPSLVYVCDPVLGDNGAMYVPENLLPIYRDRVVPAADIITPNQFEAELLSGRKIHSEKDAVEVMNLLHSMGPDTVVITSSDL 184          
BLAST of Pyridoxal kinase vs. Ensembl Zebrafish
Match: pdxka (pyridoxal (pyridoxine, vitamin B6) kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8376])

HSP 1 Score: 143.665 bits (361), Expect = 4.879e-41
Identity = 69/154 (44.81%), Postives = 102/154 (66.23%), Query Frame = 2
Query:  392 VCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSD------VLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPN 829
            V +IV+++KR NP+ ++ CDPV+GDNG MYVP  LL +YR +V+  AD++ PNQ+EAELL+G +I SE D ++ + L H+ G  T V+TSS++ PS       V  G   K+  DG    Q+ R++IP++   FVGTGDLF ++ L W+   P+
Sbjct:    2 VVDIVQELKRANPSLVYVCDPVLGDNGAMYVPENLLPIYRDRVVPAADIITPNQFEAELLSGRKIHSEKDAVEVMNLLHSMGPDTVVITSSDL-PSPLGDQYLVALGSQKKVRTDGSMVTQQIRMDIPRVDAVFVGTGDLFAAMLLAWTHHHPD 154          
BLAST of Pyridoxal kinase vs. Ensembl Xenopus
Match: pdxk (amphinase-4-like [Source:Xenbase;Acc:XB-GENE-5802830])

HSP 1 Score: 149.828 bits (377), Expect = 1.940e-42
Identity = 73/195 (37.44%), Postives = 119/195 (61.03%), Query Frame = 2
Query:  440 FYCDPVMGDN----GKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSD-----VLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            F+CDPV+GD     G MYVP ELL VYR  V+ +A+++ PNQ+EAELLTG++I+++++ ++ +   H+ G  T V+TSS +  S      V  G   K++  G+   QR  LE+P++   FVGTGDLF ++ L W+   PN+ +  C + + +M  +L+RT+   + L      P    LE+++V S +D+ +P+
Sbjct:    8 FFCDPVLGDKWNGEGSMYVPEELLPVYRDLVVPVANIITPNQFEAELLTGLKIRTKMEAVQVMDKLHSLGPDTVVITSSELPASRGADYLVTLGSQRKVDAQGRIHTQRISLELPRVEAVFVGTGDLFAAMLLAWTHHHPNDFKLACEKTVSAMHHILQRTIRSAKALAGPGVKPTYAQLEIRMVQSRKDIESPE 202          
BLAST of Pyridoxal kinase vs. Ensembl Xenopus
Match: pdxk (amphinase-4-like [Source:Xenbase;Acc:XB-GENE-5802830])

HSP 1 Score: 130.954 bits (328), Expect = 2.838e-35
Identity = 64/178 (35.96%), Postives = 108/178 (60.67%), Query Frame = 2
Query:  479 YVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSD-----VLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            YVP ELL VYR  V+ +A+++ PNQ+EAELLTG++I+++++ ++ +   H+ G  T V+TSS +  S      V  G   K++  G+   QR  LE+P++   FVGTGDLF ++ L W+   PN+ +  C + + +M  +L+RT+   + L      P    LE+++V S +D+ +P+
Sbjct:   26 YVPEELLPVYRDLVVPVANIITPNQFEAELLTGLKIRTKMEAVQVMDKLHSLGPDTVVITSSELPASRGADYLVTLGSQRKVDAQGRIHTQRISLELPRVEAVFVGTGDLFAAMLLAWTHHHPNDFKLACEKTVSAMHHILQRTIRSAKALAGPGVKPTYAQLEIRMVQSRKDIESPE 203          
BLAST of Pyridoxal kinase vs. Ensembl Mouse
Match: Pdxk (pyridoxal (pyridoxine, vitamin B6) kinase [Source:MGI Symbol;Acc:MGI:1351869])

HSP 1 Score: 265.003 bits (676), Expect = 8.846e-86
Identity = 134/299 (44.82%), Postives = 191/299 (63.88%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGD----NGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGP---SDVLFGFVS----KINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            ++LSIQSHVV GYVGN+  + PLQ+LG +VD +NSVQFSNHT Y   KGQVL SQ+L +LY+GLK N +  Y  ++TGY   K+FL  V +IV ++K+ N   ++ CDPVMGD     G MYVP +LL VYR KV+ +AD++ PNQ+EAELL+G +I S+ +  + + + H  G  T V+TSS++     SD L    S    K +     QR R+E+ K+   FVGTGDLF ++ L W+ K P+NL+  C + + +MQ VL+RT+   +        P    LEL++V S +D+ +P+
Sbjct:    6 RVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLKSQELHELYEGLKVNDVNKYDYVLTGYTRDKSFLAMVVDIVRELKQQNSRLVYVCDPVMGDKWNGEGSMYVPQDLLPVYRDKVVPVADIITPNQFEAELLSGRKIHSQEEAFEVMDMLHCMGPDTVVITSSDLPSSQGSDYLIALGSQRMRKPDGSTVTQRIRMEMRKVEAVFVGTGDLFAAMLLAWTHKHPDNLKVACEKTVSAMQHVLQRTIRCAKAEAGEGQKPSPAQLELRMVQSKRDIEDPE 304          
BLAST of Pyridoxal kinase vs. UniProt/SwissProt
Match: sp|Q8W1X2|PDXK_ARATH (Pyridoxal kinase OS=Arabidopsis thaliana OX=3702 GN=PK PE=1 SV=2)

HSP 1 Score: 278.1 bits (710), Expect = 3.722e-90
Identity = 138/288 (47.92%), Postives = 191/288 (66.32%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            ++LSIQSH V GYVGNK  + PLQ+LG DVD INSVQFSNHT Y   KGQVLN Q L DL +GL++N L  Y+ ++TGYIGS +FL+ +  ++  ++ +NPN  + CDPVMGD GK+YVP EL+ VYR KV+ LA ++ PNQ+EAE LTG+ I SE D  +A A+ H  G    V+TS  IG   +L G   K     +P++F++ I KIP  F GTGDL  +L LGWS K+P+NL +     + ++Q +L+RT+  Y+    +   P    LE++L+ S +D+ NP+
Sbjct:   17 RVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPINSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANDLLFYTHVLTGYIGSVSFLDTILEVINKLRSVNPNLTYVCDPVMGDEGKLYVPEELVHVYREKVVPLASMLTPNQFEAEKLTGLRINSEEDGREACAILHAAGPSKVVITSITIGGILLLIGSHQK-EKGLKPEQFKILIHKIPAYFTGTGDLMTALLLGWSNKYPDNLDKAAELAVSTLQALLRRTLDDYKRAGYD---PTSSSLEIRLIQSQEDIRNPK 300          
BLAST of Pyridoxal kinase vs. UniProt/SwissProt
Match: sp|P82197|PDXK_SHEEP (Pyridoxal kinase OS=Ovis aries OX=9940 GN=PDXK PE=1 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 4.876e-90
Identity = 142/302 (47.02%), Postives = 198/302 (65.56%), Query Frame = 2
Query:  119 ENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDN----GKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSN-IGP--SDVLFGFVSKINN--DGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            E  ++LSIQSHVV GYVGN+    PLQ+LG +VD +NSVQFSNHT Y   KGQVLNS +L++LYDGLK N +  Y  ++TGY   K+FL  V +IV+++K+ NP  ++ CDPVMGD     G MYVP +LL VYR KV+ +AD++ PNQ+EAELLTG +I S+ + L+ + + H+ G  T V+TSSN + P  SD L    S+     DG    QR R+E+ K+   FVGTGDLF ++ L W+ K PNNL+  C + + +M  VL+RT+   +  +     P    LEL++V S +D+ +P+
Sbjct:    3 EECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRAPDGSVVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPE 304          
BLAST of Pyridoxal kinase vs. UniProt/SwissProt
Match: sp|Q0II59|PDXK_BOVIN (Pyridoxal kinase OS=Bos taurus OX=9913 GN=PDXK PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 7.383e-89
Identity = 140/302 (46.36%), Postives = 198/302 (65.56%), Query Frame = 2
Query:  119 ENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDN----GKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSN-IGP--SDVLFGFVSKINN--DGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            E  ++LSIQSHVV GYVGN+    PLQ+LG +VD +NSVQFSNHT Y   KGQVLNS +L++LYDGLK N +  Y  ++TGY   K+FL  V +IV+++K+ NP  ++ CDPVMGD     G MYVP +LL VYR KV+ +AD++ PNQ+EAELLTG +I ++ + L+ + + H+ G  T V+TSS+ + P  SD L    S+     DG    QR R+E+ K+   FVGTGDLF ++ L W+ K PNNL+  C + + +M  VL+RT+   +  +     P    LEL++V S +D+ +P+
Sbjct:    3 EECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNSVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRDGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHTQEEALEVMDMLHSMGPDTVVITSSDLLSPRGSDYLMALGSQRTRAPDGSMVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPE 304          
BLAST of Pyridoxal kinase vs. UniProt/SwissProt
Match: sp|O46560|PDXK_PIG (Pyridoxal kinase OS=Sus scrofa OX=9823 GN=PDXK PE=1 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.789e-86
Identity = 141/300 (47.00%), Postives = 190/300 (63.33%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGD----NGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPS----DVLFGFVSKINN--DGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            ++LSIQSHVV GYVGN+    PLQ+LG +VD +NSVQFSNHT Y   KGQVLNS +L  LY+GLK N +  Y  ++TGY   K+FL  V +IV ++K+ NP  ++ CDPVMGD     G MYVP +LL VYR KV+ +AD++ PNQ+EAELLTG  I SE + L  + + H  G  T V+TSS++ PS    D L    S+     DG    QR R+EI K+   FVGTGDLF ++ L W+ K PNNL+  C + + +M  VL+RT+   +        P    LEL++V S +D+ +P+
Sbjct:   16 RVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLNSDELHALYEGLKLNNVNQYDYVLTGYTRDKSFLAMVVDIVRELKQQNPRLVYVCDPVMGDKWDGEGSMYVPEDLLPVYREKVVPVADIITPNQFEAELLTGRRIHSEEEALAVMDMLHAMGPDTVVITSSDL-PSPRGKDYLIALGSQRTRSPDGSVATQRIRMEICKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLRRTIQCAKAKAGEGLKPSPAQLELRMVQSKRDIEDPE 314          
BLAST of Pyridoxal kinase vs. UniProt/SwissProt
Match: sp|O35331|PDXK_RAT (Pyridoxal kinase OS=Rattus norvegicus OX=10116 GN=Pdxk PE=1 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.121e-85
Identity = 134/299 (44.82%), Postives = 191/299 (63.88%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDN----GKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGP---SDVLFGFVS----KINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            ++LSIQSHVV GYVGN+  + PLQ+LG +VD +NSVQFSNHT Y   KGQVL SQ+L  LY+GLK+N +  Y  ++TGY   K+FL  V +IV+++K+ N   ++ CDPVMGD     G MYVP +LL VYR KV+ +AD++ PNQ+EAELL+G +I S+ +    + + H  G  T V+TSS++     SD L    S    K +     QR R+E+ K+   FVGTGDLF ++ L W+ K P+NL+  C + + +MQ VL+RT+   +        P    LEL++V S +D+ +P+
Sbjct:    6 RVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLTSQELHALYEGLKANNVNKYDYVLTGYTRDKSFLGMVVDIVQELKQQNSRLVYVCDPVMGDKWNGEGSMYVPQDLLPVYREKVVPMADIITPNQFEAELLSGRKIHSQEEAFAVMDVLHRMGPDTVVITSSDLPSPKGSDYLMALGSQRMRKPDGSTVTQRIRMEMRKVDPVFVGTGDLFAAMLLAWTHKHPDNLKVACEKTVSAMQHVLQRTIRCAKAEAGEGQKPSPAQLELRMVQSRKDIEDPE 304          
BLAST of Pyridoxal kinase vs. TrEMBL
Match: B3RX60 (Phos_pyr_kin domain-containing protein OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_25994 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.218e-103
Identity = 147/287 (51.22%), Postives = 200/287 (69.69%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            K+LSIQSHVV GYVGN+    PLQ+LG DVD INSVQFSNHT+Y   KGQ+LN+ +L DLY+GL+ N L  YS ++TGY+GS++FL  +  ++  +K  NPN ++ CDPVMGDNG MYVP ELL +YR +V+ LAD++ PNQ+EAE+LT ++I  E   ++A+ + H+KG+KT V++SS +G  + L G+ S    DG+ QR +LEIP++   FVGTGDLF SL L W+   P++L   C + I S+Q +LKRT+AH   L      P    LEL+LV S  D+ NP
Sbjct:    5 KVLSIQSHVVHGYVGNRSATFPLQVLGFDVDVINSVQFSNHTEYGKWKGQILNATELWDLYEGLRENNLHEYSHLLTGYVGSESFLHCISRVIRSLKETNPNLIYVCDPVMGDNGIMYVPKELLPIYREEVIPLADIITPNQFEAEILTDVKIVDEKSAIEAMDILHSKGIKTVVISSSELGSGEFLIGYGSVNLGDGKKQRIKLEIPRVEAAFVGTGDLFASLLLAWTSHHPDSLSLACEKTISSIQNILKRTIAHARKLAGEGKSPNSAQLELRLVQSKHDIENP 291          
BLAST of Pyridoxal kinase vs. TrEMBL
Match: A0A2B4R7Y3 (Pyridoxal kinase OS=Stylophora pistillata OX=50429 GN=PDXK PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.819e-103
Identity = 150/287 (52.26%), Postives = 202/287 (70.38%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++LSIQSHVVSGYVGN     PLQ+LG DVD INSVQ SNHT Y+  KGQVL + +LK L+DGLK N+L ++S ++TGY+GSK+FLEEV  +V D+++ NPN +F CDPVMGD GK YVP ELL VYR ++L LAD++ PNQ+EAELLTG++I +E +  KA+ + H++G +T V+TSS +G S  L    S +N  G  +  R+EIPK+   F GTGDLF S+ L W  + P++L   C   + ++Q VLKRT+AH + L    N P    +EL+LV S+ D+ NP
Sbjct:    8 RVLSIQSHVVSGYVGNDSATFPLQVLGFDVDTINSVQLSNHTGYDHVKGQVLVANELKVLFDGLKLNKLHHFSHLLTGYVGSKSFLEEVLQVVHDLRQANPNLVFVCDPVMGDAGKFYVPEELLPVYRDQLLPLADIITPNQFEAELLTGMKITNESEAFKAMKILHDRGTETVVITSSELGDSKTLIALGSSVN--GNKKCIRMEIPKVDAIFTGTGDLFASVLLAWLYRHPDDLARACEATVSTVQAVLKRTLAHAQRLAGEGNKPTAGQIELRLVQSLDDIRNP 292          
BLAST of Pyridoxal kinase vs. TrEMBL
Match: A0A369SC77 (Pyridoxal kinase OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_004304 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 6.646e-103
Identity = 148/292 (50.68%), Postives = 203/292 (69.52%), Query Frame = 2
Query:  113 ILENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            I+ + K+LSIQSHVV GYVGN+    PLQ+LG DVD INSVQFSNHT+Y   KGQ+LN+ +L DLY+GL+ N L  YS ++TGY+GS++FL  +  ++  +K  NPN ++ CDPVMGDNG MYVP ELL +YR +V+ LAD++ PNQ+EAE+LT ++I  E   ++A+ + H+KG+KT V++SS +G  + L G+ S    DG+ QR +LEIP++   FVGTGDLF SL L W+   P++L   C + I S+Q +LKRT+AH   L      P    LEL+LV S  D+ NP
Sbjct:  107 IMGDSKVLSIQSHVVHGYVGNRSATFPLQVLGFDVDVINSVQFSNHTEYGKWKGQILNATELWDLYEGLRENNLHEYSHLLTGYVGSESFLHCISRVIRSLKETNPNLIYVCDPVMGDNGIMYVPKELLPIYREEVIPLADIITPNQFEAEILTDVKIADEKSAIEAMDILHSKGIKTVVISSSELGSGEFLIGYGSVNLGDGRKQRIKLEIPRVEAAFVGTGDLFASLLLAWTSHHPDSLSLACEKTISSIQNILKRTIAHARKLAGEGKSPNSAQLELRLVQSKHDIENP 398          
BLAST of Pyridoxal kinase vs. TrEMBL
Match: A0A3M6V1M7 (Phos_pyr_kin domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00007304 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.052e-102
Identity = 149/287 (51.92%), Postives = 202/287 (70.38%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++LSIQSHVVSGYVGN     PLQ+LG DVD INSVQ SNHT Y+  KGQVL++ +LK L++GLK N+L ++S ++TGY+GSK+FLEEV  +V D+++ NPN +F CDPVMGD GK YVP ELL VYR ++L LAD++ PNQ+EAELLTG++I +E +  KA+ + H +G KT V+TSS +G +  L    S +N  G  +  R+EIPK+   F GTGDLF S+ L W  + P++L   C   + ++Q VLKRT+AH + L    N P    +EL+LV S+ D+ NP
Sbjct:    8 RVLSIQSHVVSGYVGNDSATFPLQVLGFDVDTINSVQLSNHTGYDHVKGQVLDANELKVLFEGLKLNKLHHFSHLLTGYVGSKSFLEEVLQVVHDLRQANPNLVFVCDPVMGDAGKFYVPEELLPVYRDQLLPLADIITPNQFEAELLTGMKITNESEAFKAMKILHERGTKTVVITSSELGDNKTLIALGSSVN--GNKKCIRMEIPKVDAIFTGTGDLFASVLLAWLHRHPDDLAHACEATVSTVQAVLKRTLAHAQRLAGEGNKPTAGQIELRLVQSLDDIRNP 292          
BLAST of Pyridoxal kinase vs. TrEMBL
Match: A0A210QNA2 (Pyridoxal kinase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06743 PE=4 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 7.545e-101
Identity = 148/292 (50.68%), Postives = 206/292 (70.55%), Query Frame = 2
Query:  119 ENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKINNDGQP-QRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            ++ ++LSIQS VVSGYVGNK    PLQ+LG DV  +NSVQFSNHT Y+V KGQVLN+ D+ DLYDGLK N + +++ ++TGYIGSK+FLE+V  I++++++ NPN  + CDPVMGDNGKMYVP+ELL+VY+  +L LAD++ PNQ+EAELLTG+EIK+E D  KA+ + H  G KT V++SS++GP D + G  S I N     +R+R+++P I   FVGTGDLF +  L W ++   NL+    + +  +Q V+ RTV H   L    N P  + +EL+LV S  D+  P+
Sbjct:    5 DDCRVLSIQSSVVSGYVGNKSATFPLQVLGFDVSTVNSVQFSNHTGYKVFKGQVLNAADMDDLYDGLKCNNIHHFTHLLTGYIGSKSFLEKVGEIIQNLRKQNPNLTYVCDPVMGDNGKMYVPTELLEVYKKVILPLADIVTPNQFEAELLTGVEIKTEADAWKAMQILHGMGPKTVVISSSDLGPDDTIVGLASSIKNGSTSMERYRIDMPFIDQTFVGTGDLFAACLLAW-IQKDQNLKVALEKTVSIVQAVITRTVTHAHCLAGKGNKPTPEQMELRLVQSKADIEEPK 295          
BLAST of Pyridoxal kinase vs. Ensembl Cavefish
Match: pdxka (pyridoxal kinase [Source:NCBI gene;Acc:103026838])

HSP 1 Score: 276.559 bits (706), Expect = 1.946e-90
Identity = 139/294 (47.28%), Postives = 192/294 (65.31%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPS-----DVLFGFVSKINNDG--QPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++LSIQSHVV GYVGNK    PLQ+LG +VD INSVQFSNHT YE  KGQVL + +L  LY+G+K N++ +Y  ++TGY    +FLE V +IVE++K  NP+ ++ CDPVMGDNG MYVP  LL VYR KV+ +AD++ PNQ+EAELLTG +I +E D ++A+   H  G  T V+TSS++  S      V  G    +  DG  + Q  R++IPK+   FVGTGDLF ++ L W+   PN+L+  C + +  MQ V+KRT+ + +        P    LEL++V S  D+ +P
Sbjct:    4 RVLSIQSHVVRGYVGNKSATFPLQVLGFEVDSINSVQFSNHTGYEHWKGQVLTADELHVLYEGIKLNKVNHYDYVLTGYTRDVSFLESVVDIVEELKGANPSLVYVCDPVMGDNGAMYVPEALLPVYRDKVVPVADIITPNQFEAELLTGRKISTEKDAVEAMDQLHGMGPDTVVITSSDLLSSLGDQYLVALGSHVTVKADGTKEKQLIRMDIPKVDAVFVGTGDLFAAMLLAWTHHHPNDLKTACEKTVSVMQHVIKRTINYAKEAAGPDRRPNPAQLELRMVQSKGDIEDP 297          
BLAST of Pyridoxal kinase vs. Ensembl Cavefish
Match: pdxkb (pyridoxal kinase-like [Source:NCBI gene;Acc:103021965])

HSP 1 Score: 270.011 bits (689), Expect = 3.380e-87
Identity = 131/294 (44.56%), Postives = 189/294 (64.29%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPS-----DVLFGFVSKINNDG--QPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++LSIQSHVV GYVGNK    PLQ++G +VD INSVQFSNHT Y   KGQVL + +L  LY+G+K N + +Y  ++TGY    +FLE V +I++++KR NP+ ++ CDPV+GD+G MYVP  L  VY+ KV+ +AD++ PNQ+EAELLTG  I +E D ++ + L HN G  T V+TSS++ P       V  G    +  DG    QR R+E+PK+   FVGTGDLF ++ L W+  +P +L+  C +    M  V++RT+++   +      P    LEL++V S  D+ +P
Sbjct:   61 RVLSIQSHVVRGYVGNKSASFPLQVMGFEVDSINSVQFSNHTGYAHWKGQVLTADELHVLYEGIKLNNVNHYDYVLTGYTRDTSFLEMVVDIIQELKRANPSLVYVCDPVLGDHGSMYVPQNLYPVYKDKVVPVADIITPNQFEAELLTGKNISTEKDAVEVMDLLHNMGPDTVVITSSDLPPRLGDRFLVSLGSQRIVMPDGTYSTQRIRIEVPKVDAVFVGTGDLFAAMLLAWTHHYPTDLKTACEKTFSVMHHVIQRTISYAHEMAGPGRRPSPAQLELRMVQSKADIEDP 354          
BLAST of Pyridoxal kinase vs. Ensembl Sea Lamprey
Match: pdxka (pyridoxal (pyridoxine, vitamin B6) kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8376])

HSP 1 Score: 210.305 bits (534), Expect = 2.439e-65
Identity = 111/274 (40.51%), Postives = 166/274 (60.58%), Query Frame = 2
Query:  203 LGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDN----GKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPS---DVLFGFVSKIN--NDG--QPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQ 991
            LG+ ++  N V F +   Y   +GQVL S +LK+LY GL+ N +  Y  ++TGY   K+FLE++  IV+D+K+ N   +  CDPV+GD     G MYVP ELL VYR +V+ LAD++ PNQ+EAELLTG  + +E + L+ + + H  G  T ++TSS+  PS   D+L    S+I    DG    ++ RLEIPK+   FVGTGDLF ++ L W    P+N +  C + + +M  VLKRT++  +   +    P    LE+++V S +D+ NP+
Sbjct:   32 LGSSLNLRNEVYFGDCAGYAHWRGQVLKSDELKELYQGLRLNDITRYDYVLTGYTADKSFLEQLVGIVKDLKKTNSRHIAVCDPVLGDKWNGEGSMYVPEELLPVYRDQVVPLADIITPNQFEAELLTGRTLNTEKEALEVMEVLHAMGPHTVLITSSDFIPSCENDLLVVLGSRITCKPDGTNSKEKIRLEIPKLDAVFVGTGDLFAAMLLAWIHHHPDNFKLACEKAVSAMSHVLKRTLSCAQA-QAGGGKPRVAELEIRMVQSKRDIENPK 304          
BLAST of Pyridoxal kinase vs. Ensembl Yeast
Match: BUD16 (Putative pyridoxal kinase; a key enzyme involved in pyridoxal 5'-phosphate synthesis, the active form of vitamin B6; required for genome integrity; involved in bud-site selection; similarity to yeast BUD17 and human pyridoxal kinase (PDXK) [Source:SGD;Acc:S000000755])

HSP 1 Score: 157.918 bits (398), Expect = 2.005e-45
Identity = 113/312 (36.22%), Postives = 165/312 (52.88%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCK--GQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLS---LADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGP-SDVLFGFVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNN------LREVCSRVIGSMQKVLKRTVAHYEG-----LNSNLNIPECQGLELKLVDS--IQDLMNPQSFDRI 1006
            ++L+ QSHVV GYVGNK    PLQ LG DVD  NSVQFSNHT Y + K  G +    DLK+L  GL  N   +Y ++++GY+ +K  +  +       K  NP  ++  DPVMGD G++YV  +++  YR   LS   L D++ PNQ+E E+L G EIK++  + KAL   H + +   +VTS +     D  F +         P  +R  +P I   F G GDLF +L L    K  +N        +  + V+  +QKVLK T ++  G     + S L + E   +EL+L++S  I + +N    D I
Sbjct:    3 RLLATQSHVVHGYVGNKAATFPLQCLGWDVDCCNSVQFSNHTGYGLDKVFGTITRETDLKELLSGLFDNFSQDYQALLSGYLPNKNSVRCMGTYYAKFKEANPEMIWLMDPVMGDEGQLYVSEDVIPEYRKLALSPKQLVDIITPNQFELEILYGGEIKTKEHLKKALKKLH-QTIPVIIVTSCDCKMFDDKDFIYCVASMEGKTPIVYR--VPFIDSYFTGVGDLFSALLLDRVYKILSNPTTTLKFEDQVNNVLNVIQKVLKITRSYASGKMKAKMGSALEMKE---MELRLIESRDIYETINIHQTDYI 308          
BLAST of Pyridoxal kinase vs. Ensembl Yeast
Match: BUD17 (Putative pyridoxal kinase; a key enzyme in vitamin B6 metabolism; involved in bud-site selection; diploid mutants display a random rather than a bipolar budding pattern; similarity to yeast BUD16 and human pyridoxal kinase (PDXK) [Source:SGD;Acc:S000005310])

HSP 1 Score: 144.05 bits (362), Expect = 3.397e-40
Identity = 94/289 (32.53%), Postives = 155/289 (53.63%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYD-GLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMF-PNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFG---FVSKINNDGQPQRFRLEIPKIPYDFVGTGDLFVSL----FLG----WSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELK 955
            K+LSIQSHV+ GYVGNK    PLQ  G DVD +N+VQFSNH+ Y    G   ++++L D+ + GL  +    Y ++++GY+ +   L++V  IV  +   + N  +  DPV+GDNG++YV  E + VY+  + +    +  PNQ+E ELL G+ I++  D  +A  LFH K  + + +  +++  S+ L      V+  +     + F  EIPKI   F G+GDL  ++     LG      L    +L +V   V   +QK     +A     +S ++I + + ++ +
Sbjct:   10 KVLSIQSHVIHGYVGNKAATFPLQYRGWDVDVLNTVQFSNHSGYAHFTGFKCSTEELVDIVEKGLIGSLRIKYDAVLSGYLPNVQALQKVAGIVGQLCEGSENVKWILDPVLGDNGRLYVDRECVAVYQDILQNFKIFLATPNQFEMELLVGMSIRTLDDAKQAFKLFHKKYPRVSRIVVTSLELSEFLSNDTYVVAGFDCSASEEIFFYEIPKINAKFSGSGDLISAMLTDSLLGDRRCTQLSLSASLGQVLWLVTSILQKTYDLNIAERGPQDSTIDIKDLKLIQCR 298          
BLAST of Pyridoxal kinase vs. Ensembl Nematostella
Match: EDO42065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2M3])

HSP 1 Score: 182.185 bits (461), Expect = 2.610e-56
Identity = 89/153 (58.17%), Postives = 113/153 (73.86%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKM-------YVPSELLDVYRSKVLSLADVMFPNQYEAE 565
            ++LSIQSHVVSGYVGNK    PLQ+LG +VD INSVQ SNHT YE  KGQVLNS +LK+L DGLK N + +YS ++TGY+GSK+FL+EV  ++  ++  NP  ++ CDPVMGDNG         YVP ELL VYR  ++ LAD++ PNQ+EAE
Sbjct:    8 RVLSIQSHVVSGYVGNKSATFPLQVLGFEVDTINSVQLSNHTGYEHFKGQVLNSNELKELCDGLKLNNIDSYSHLLTGYVGSKSFLDEVLQVIHHLRNENPKLIYVCDPVMGDNGHFVSKTVFQYVPEELLPVYRDHLVPLADIVTPNQFEAE 160          
BLAST of Pyridoxal kinase vs. Ensembl Medaka
Match: pdxkb (pyridoxal kinase-like [Source:NCBI gene;Acc:101171384])

HSP 1 Score: 271.552 bits (693), Expect = 1.905e-88
Identity = 134/294 (45.58%), Postives = 188/294 (63.95%), Query Frame = 2
Query:  128 KILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPS-----DVLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++LSIQSHVV GYVGNK    PLQ+LG +VD INSVQFSNHT Y   KGQVL + +L  LY+G+K N + +Y  ++TGY    +FLE V +IV+++KR NPN ++ CDPV+GD+G MYVP  L  VY++KV+ +AD++ PNQ+EAELLTG  I ++ D ++ + L H  G  T V+TSS++ P       V  G    +  DG    QR R+E+PK+   FVGTGDLF ++ L W+   PN+L+  C +    M  V++RT++    L      P    LEL++V S  D+ +P
Sbjct:    4 RVLSIQSHVVRGYVGNKSASFPLQVLGFEVDSINSVQFSNHTGYSHWKGQVLTADELHVLYEGIKLNNVHHYDYVLTGYTRDTSFLEMVVDIVQELKRANPNLVYVCDPVLGDHGSMYVPQNLYPVYKNKVVPVADIITPNQFEAELLTGKNISTQKDAVEVMDLLHAMGPDTVVITSSDLPPRLGDRFLVSLGSQRHVRPDGSRTTQRVRIEVPKVDAVFVGTGDLFAAMLLAWTHHHPNDLKTACEKTFSVMHHVIQRTISFAHELAGPGRRPSPPQLELRMVQSKADIEDP 297          
BLAST of Pyridoxal kinase vs. Ensembl Medaka
Match: pdxka (pyridoxal kinase [Source:NCBI gene;Acc:101155341])

HSP 1 Score: 268.855 bits (686), Expect = 2.145e-87
Identity = 131/298 (43.96%), Postives = 191/298 (64.09%), Query Frame = 2
Query:  116 LENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNI-----GPSDVLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++  ++LSIQSHVV GYVGNK  + PLQ+LG +VD INSVQFSNHT Y   KGQVL +++L  LY+G+K N + +Y  I+TGY    +FLE V +I++++K  NP+ ++ CDPV+GD G MYVP  LL +Y++KV+ LAD++ PNQ+EAELLTG  IK+  D ++ + L H+ G +T V+TS+++     G   V  G       DG    Q+  ++IPK+   FVGTGDLF ++ L W+   P +L+  C + +  M  V++RT+A+          P    LEL++V S  D+ NP
Sbjct:    1 MQERRVLSIQSHVVRGYVGNKSAVFPLQVLGFEVDSINSVQFSNHTGYAHWKGQVLTAEELNVLYEGIKLNNVHHYDYILTGYSRDTSFLETVVDIIKELKTANPDLVYVCDPVLGDQGAMYVPENLLPIYKTKVVPLADILTPNQFEAELLTGRTIKTAADAVQVMDLLHDMGPETVVLTSTDLRSKRGGGFLVALGSQKIKKADGTRVSQKIWMDIPKVDAVFVGTGDLFAAMLLAWTHHHPTDLKTACEKTVSVMHHVIQRTIAYANETAGPGKKPSPAQLELRMVQSKADIENP 298          
BLAST of Pyridoxal kinase vs. Ensembl Medaka
Match: pdxka (pyridoxal kinase [Source:NCBI gene;Acc:101155341])

HSP 1 Score: 226.868 bits (577), Expect = 3.260e-71
Identity = 123/298 (41.28%), Postives = 179/298 (60.07%), Query Frame = 2
Query:  116 LENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNI-----GPSDVLFGFVSKINNDGQ--PQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVIGSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNP 988
            ++  ++LSIQSHVV GYVGNK  + PLQ+LG +VD INSVQFSNHT Y   KGQVL +++L  LY+G+K N + +Y  I+TGY    +FLE V +I++++K  NP+ ++ CDPV+GD G MYVP  LL +Y++KV+ LAD++ PNQ+E + LT   +         + L H+ G +T V+TS+++     G   V  G       DG    Q+  ++IPK+   FVGTGDLF ++ L W+   P +L+ V +  +G      + T A   G       P    LEL++V S  D+ NP
Sbjct:    1 MQERRVLSIQSHVVRGYVGNKSAVFPLQVLGFEVDSINSVQFSNHTGYAHWKGQVLTAEELNVLYEGIKLNNVHHYDYILTGYSRDTSFLETVVDIIKELKTANPDLVYVCDPVLGDQGAMYVPENLLPIYKTKVVPLADILTPNQFERKRLTARRV---------MDLLHDMGPETVVLTSTDLRSKRGGGFLVALGSQKIKKADGTRVSQKIWMDIPKVDAVFVGTGDLFAAMLLAWTHHHPTDLK-VRAAAVGPRGARRRLTTA---GPGKK---PSPAQLELRMVQSKADIENP 282          
BLAST of Pyridoxal kinase vs. Planmine SMEST
Match: SMESG000011589.1 (SMESG000011589.1)

HSP 1 Score: 311.612 bits (797), Expect = 1.100e-106
Identity = 152/152 (100.00%), Postives = 152/152 (100.00%), Query Frame = 2
Query:  110 MILENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAE 565
            MILENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAE
Sbjct:    1 MILENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKYEVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVEDIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYEAE 152          
The following BLAST results are available for this feature:
BLAST of Pyridoxal kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PDXK1.652e-8543.23pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819... [more]
PDXK9.232e-7139.60pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819... [more]
PDXK1.177e-6140.08pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819... [more]
PDXK6.749e-1460.87pyridoxal kinase [Source:HGNC Symbol;Acc:HGNC:8819... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pdxk-11.437e-8044.75Putative pyridoxal kinase [Source:UniProtKB/Swiss... [more]
pdxk-12.197e-8044.75Putative pyridoxal kinase [Source:UniProtKB/Swiss... [more]
pdxk-11.432e-7843.61Putative pyridoxal kinase [Source:UniProtKB/Swiss... [more]
pdxk-11.432e-7843.61Putative pyridoxal kinase [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pdxk2.943e-8347.10gene:FBgn0085484 transcript:FBtr0112761[more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pdxkb2.394e-8744.90pyridoxal (pyridoxine, vitamin B6) kinase b [Sourc... [more]
pdxka3.077e-8645.08pyridoxal (pyridoxine, vitamin B6) kinase a [Sourc... [more]
pdxka1.596e-6453.04pyridoxal (pyridoxine, vitamin B6) kinase a [Sourc... [more]
pdxka4.879e-4144.81pyridoxal (pyridoxine, vitamin B6) kinase a [Sourc... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pdxk1.940e-4237.44amphinase-4-like [Source:Xenbase;Acc:XB-GENE-58028... [more]
pdxk2.838e-3535.96amphinase-4-like [Source:Xenbase;Acc:XB-GENE-58028... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pdxk8.846e-8644.82pyridoxal (pyridoxine, vitamin B6) kinase [Source:... [more]
back to top
BLAST of Pyridoxal kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8W1X2|PDXK_ARATH3.722e-9047.92Pyridoxal kinase OS=Arabidopsis thaliana OX=3702 G... [more]
sp|P82197|PDXK_SHEEP4.876e-9047.02Pyridoxal kinase OS=Ovis aries OX=9940 GN=PDXK PE=... [more]
sp|Q0II59|PDXK_BOVIN7.383e-8946.36Pyridoxal kinase OS=Bos taurus OX=9913 GN=PDXK PE=... [more]
sp|O46560|PDXK_PIG1.789e-8647.00Pyridoxal kinase OS=Sus scrofa OX=9823 GN=PDXK PE=... [more]
sp|O35331|PDXK_RAT2.121e-8544.82Pyridoxal kinase OS=Rattus norvegicus OX=10116 GN=... [more]
back to top
BLAST of Pyridoxal kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B3RX604.218e-10351.22Phos_pyr_kin domain-containing protein OS=Trichopl... [more]
A0A2B4R7Y34.819e-10352.26Pyridoxal kinase OS=Stylophora pistillata OX=50429... [more]
A0A369SC776.646e-10350.68Pyridoxal kinase OS=Trichoplax sp. H2 OX=287889 GN... [more]
A0A3M6V1M71.052e-10251.92Phos_pyr_kin domain-containing protein OS=Pocillop... [more]
A0A210QNA27.545e-10150.68Pyridoxal kinase OS=Mizuhopecten yessoensis OX=657... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pdxka1.946e-9047.28pyridoxal kinase [Source:NCBI gene;Acc:103026838][more]
pdxkb3.380e-8744.56pyridoxal kinase-like [Source:NCBI gene;Acc:103021... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdxka2.439e-6540.51pyridoxal (pyridoxine, vitamin B6) kinase a [Sourc... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BUD162.005e-4536.22Putative pyridoxal kinase; a key enzyme involved i... [more]
BUD173.397e-4032.53Putative pyridoxal kinase; a key enzyme in vitamin... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420652.610e-5658.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pyridoxal kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pdxkb1.905e-8845.58pyridoxal kinase-like [Source:NCBI gene;Acc:101171... [more]
pdxka2.145e-8743.96pyridoxal kinase [Source:NCBI gene;Acc:101155341][more]
pdxka3.260e-7141.28pyridoxal kinase [Source:NCBI gene;Acc:101155341][more]
back to top
BLAST of Pyridoxal kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000011589.11.100e-106100.00SMESG000011589.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009225 ID=SMED30009225|Name=Pyridoxal kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1250bp
TTTAATTTAAAAAAATTCTCGAAGTGTGAGTTTTGAAAGGAATTACTGTT
AAATTTAATATTTAAATAAGAAACTATTTTTATAATAACTTTTTCGGTGG
TTAAGAAAAATGATTTTAGAAAACTTTAAAATTTTATCTATTCAAAGTCA
TGTTGTTTCTGGTTACGTTGGAAACAAGTGCTGCATTTTACCTTTGCAAA
TTTTAGGCAACGATGTTGATTTTATCAATTCGGTACAATTTTCTAATCAT
ACAAAATATGAAGTTTGCAAGGGACAAGTATTAAATTCACAAGATCTGAA
AGATCTCTATGATGGTTTAAAGTCTAATCGTTTGTGTAATTACTCCAGCA
TAATTACTGGATATATTGGATCGAAAACATTTCTAGAGGAAGTATGCAAT
ATTGTTGAGGATATTAAACGGCTCAATCCCAATGCTTTATTCTACTGTGA
TCCAGTTATGGGCGACAATGGGAAAATGTACGTACCGAGTGAACTGCTCG
ATGTCTACAGGAGTAAAGTACTCTCACTGGCAGATGTGATGTTTCCAAAT
CAGTATGAAGCCGAATTATTAACTGGAATTGAAATTAAATCTGAAGTGGA
CATATTGAAAGCCTTGGCCTTGTTTCACAATAAAGGGGTAAAGACAGCTG
TTGTTACTAGTTCCAATATTGGCCCATCGGATGTCTTATTTGGATTTGTC
AGTAAAATTAATAACGATGGACAGCCACAACGTTTTCGATTGGAAATTCC
AAAAATTCCATACGATTTTGTGGGTACTGGAGATTTGTTCGTATCCTTAT
TTTTGGGATGGTCATTGAAATTTCCAAATAATTTACGGGAAGTATGTTCA
AGGGTAATTGGATCTATGCAAAAAGTATTAAAAAGGACTGTAGCTCATTA
CGAAGGTCTAAACTCGAATCTAAATATCCCTGAATGTCAGGGATTGGAAT
TAAAACTAGTCGATTCCATACAAGATCTAATGAATCCACAATCTTTTGAT
AGAATAATCCAGCTCGATTAGTCAGAATATTCGGTCTCATCAATGTCATA
TTTAATTGAAATTCTTTTGAATTCTCTATTTTTATTTATATTGTTTATAT
TTATTAACTAATGAGCAGTGATTCGGCGGTGTTTCCTGTTTGTTGCTGCA
AACATCTATTTGTGACGGAAATGTTGATGGATTTTAATTAATAATTAATA
ATACCCAATTACTTATAGATTTTCTCTTGTAATCTAATCGAATTATTTAC
back to top

protein sequence of SMED30009225-orf-1

>SMED30009225-orf-1 ID=SMED30009225-orf-1|Name=SMED30009225-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MILENFKILSIQSHVVSGYVGNKCCILPLQILGNDVDFINSVQFSNHTKY
EVCKGQVLNSQDLKDLYDGLKSNRLCNYSSIITGYIGSKTFLEEVCNIVE
DIKRLNPNALFYCDPVMGDNGKMYVPSELLDVYRSKVLSLADVMFPNQYE
AELLTGIEIKSEVDILKALALFHNKGVKTAVVTSSNIGPSDVLFGFVSKI
NNDGQPQRFRLEIPKIPYDFVGTGDLFVSLFLGWSLKFPNNLREVCSRVI
GSMQKVLKRTVAHYEGLNSNLNIPECQGLELKLVDSIQDLMNPQSFDRII
QLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR004625PyrdxlKinase
IPR029056Ribokinase-like
IPR011611PfkB_dom
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0008478pyridoxal kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0008615pyridoxine biosynthetic process
GO:0009443pyridoxal 5'-phosphate salvage
GO:0010054trichoblast differentiation
GO:0016310phosphorylation
GO:0042538hyperosmotic salinity response
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004625Pyridoxine kinaseTIGRFAMTIGR00687TIGR00687coord: 7..263
e-value: 4.8E-74
score: 247.3
IPR004625Pyridoxine kinasePANTHERPTHR10534PYRIDOXAL KINASEcoord: 6..295
IPR004625Pyridoxine kinaseCDDcd01173pyridoxal_pyridoxamine_kinasecoord: 7..260
e-value: 3.3696E-102
score: 297.574
IPR011611Carbohydrate kinase PfkBPFAMPF00294PfkBcoord: 89..254
e-value: 9.8E-13
score: 48.1
IPR029056Ribokinase-likeGENE3DG3DSA:3.40.1190.20coord: 4..298
e-value: 8.6E-94
score: 316.2
IPR029056Ribokinase-likeSUPERFAMILYSSF53613Ribokinase-likecoord: 7..296
NoneNo IPR availablePANTHERPTHR10534:SF2PYRIDOXAL KINASEcoord: 6..295