early growth response-3

Overview
Nameearly growth response-3 (AFJ24724.1)
Smed IDSMED30009224
Length (bp)689
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of early growth response-3 (SMED30009224) t-SNE clustered cells

Violin plots show distribution of expression levels for early growth response-3 (SMED30009224) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of early growth response-3 (SMED30009224) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for early growth response-3 (SMED30009224) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009224

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30009224SMESG000000959.1 SmedASXL_001353SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30009224SMESG000000959.1 dd_Smed_v4_14711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009224SMESG000000959.1 dd_Smed_v4_14711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009224SMESG000000959.1 dd_Smed_v4_14711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009224SMESG000000959.1 dd_Smed_v4_14711_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009224SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009224SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009224SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009224SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009224SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30009224SMESG000000959.1 dd_Smed_v6_14711_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30009224SMESG000000959.1 dd_Smed_v6_12410_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009224SMESG000000959.1 dd_Smed_v4_14711_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009224SMESG000000959.1 dd_Smed_v4_14711_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009224SMESG000000959.1 SMED_07471_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009224SMESG000000959.1 SMED_07471_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of early growth response-3 vs. Ensembl Human
Match: EGR1 (early growth response 1 [Source:HGNC Symbol;Acc:HGNC:3238])

HSP 1 Score: 102.449 bits (254), Expect = 1.522e-24
Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C   +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  329 SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 414          

HSP 2 Score: 66.2402 bits (160), Expect = 4.878e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  327 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 388          

HSP 3 Score: 61.6178 bits (148), Expect = 1.662e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  366 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 422          
BLAST of early growth response-3 vs. Ensembl Human
Match: EGR4 (early growth response 4 [Source:HGNC Symbol;Acc:HGNC:3241])

HSP 1 Score: 99.7525 bits (247), Expect = 1.104e-23
Identity = 44/80 (55.00%), Postives = 54/80 (67.50%), Query Frame = 2
Query:  389 VRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
             + F C   +C ++F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  377 AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 456          

HSP 2 Score: 62.003 bits (149), Expect = 1.168e-10
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            + F C  C + F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+  
Sbjct:  408 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLKGL 474          

HSP 3 Score: 51.6026 bits (122), Expect = 3.461e-7
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  497 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  387 CVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 430          
BLAST of early growth response-3 vs. Ensembl Human
Match: EGR4 (early growth response 4 [Source:HGNC Symbol;Acc:HGNC:3241])

HSP 1 Score: 99.3673 bits (246), Expect = 1.976e-23
Identity = 44/80 (55.00%), Postives = 54/80 (67.50%), Query Frame = 2
Query:  389 VRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
             + F C   +C ++F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  480 AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 559          

HSP 2 Score: 62.003 bits (149), Expect = 1.472e-10
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            + F C  C + F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+  
Sbjct:  511 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLKGL 577          

HSP 3 Score: 51.6026 bits (122), Expect = 4.827e-7
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  497 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  490 CVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 533          
BLAST of early growth response-3 vs. Ensembl Human
Match: EGR2 (early growth response 2 [Source:HGNC Symbol;Acc:HGNC:3239])

HSP 1 Score: 96.2857 bits (238), Expect = 1.898e-22
Identity = 46/88 (52.27%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  331 SKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK 418          

HSP 2 Score: 62.003 bits (149), Expect = 1.259e-10
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC++C ++F RSD    HT+IH  +K
Sbjct:  368 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 424          
BLAST of early growth response-3 vs. Ensembl Human
Match: EGR2 (early growth response 2 [Source:HGNC Symbol;Acc:HGNC:3239])

HSP 1 Score: 96.2857 bits (238), Expect = 1.898e-22
Identity = 46/88 (52.27%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  331 SKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK 418          

HSP 2 Score: 62.003 bits (149), Expect = 1.259e-10
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC++C ++F RSD    HT+IH  +K
Sbjct:  368 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 424          
BLAST of early growth response-3 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 98.5969 bits (244), Expect = 2.974e-26
Identity = 48/88 (54.55%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  365 NSSKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
             SSK   + R + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:    2 KSSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 89          

HSP 2 Score: 62.3882 bits (150), Expect = 1.647e-12
Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 2
Query:  458 RIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    5 KMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 63          

HSP 3 Score: 55.0694 bits (131), Expect = 1.006e-9
Identity = 24/51 (47.06%), Postives = 31/51 (60.78%), Query Frame = 2
Query:  398 FTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            F C  C + F R D L  H R HTGE+P +C+ C K+F R D  + HT+IH
Sbjct:   43 FQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIH 93          
BLAST of early growth response-3 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 98.2117 bits (243), Expect = 5.225e-26
Identity = 48/88 (54.55%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  365 NSSKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
             SSK   + R + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:    2 KSSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 89          

HSP 2 Score: 61.6178 bits (148), Expect = 4.383e-12
Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 2
Query:  458 RIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    5 KMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 63          

HSP 3 Score: 56.225 bits (134), Expect = 4.505e-10
Identity = 25/58 (43.10%), Postives = 33/58 (56.90%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKP 565
            + F C  C + F R D L  H R HTGE+P +C+ C K+F R D  + HT+IH    P
Sbjct:   41 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGP 98          
BLAST of early growth response-3 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 101.679 bits (252), Expect = 1.072e-25
Identity = 48/87 (55.17%), Postives = 58/87 (66.67%), Query Frame = 2
Query:  368 SSKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SSK   + R + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:  168 SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 254          

HSP 2 Score: 64.3142 bits (155), Expect = 3.761e-12
Identity = 29/62 (46.77%), Postives = 40/62 (64.52%), Query Frame = 2
Query:  449 RHERIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            +  ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  167 KSSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 228          

HSP 3 Score: 56.6102 bits (135), Expect = 1.825e-9
Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + F C  C + F R D L  H R HTGE+P +C+ C K+F R D  + HT+IH
Sbjct:  206 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIH 258          
BLAST of early growth response-3 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 101.293 bits (251), Expect = 1.373e-25
Identity = 48/87 (55.17%), Postives = 58/87 (66.67%), Query Frame = 2
Query:  368 SSKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SSK   + R + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:  168 SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 254          

HSP 2 Score: 64.3142 bits (155), Expect = 5.139e-12
Identity = 29/62 (46.77%), Postives = 40/62 (64.52%), Query Frame = 2
Query:  449 RHERIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            +  ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  167 KSSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 228          

HSP 3 Score: 58.151 bits (139), Expect = 6.837e-10
Identity = 25/60 (41.67%), Postives = 34/60 (56.67%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYR 571
            + F C  C + F R D L  H R HTGE+P +C+ C K+F R D  + HT+IH    P +
Sbjct:  206 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGPGK 265          
BLAST of early growth response-3 vs. Ensembl Celegans
Match: egrh-1 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:Q18250])

HSP 1 Score: 99.7525 bits (247), Expect = 4.150e-24
Identity = 47/89 (52.81%), Postives = 59/89 (66.29%), Query Frame = 2
Query:  368 SSKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SSK   + R + C  + C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH +
Sbjct:  364 SSKMPLQDRPYKCPRDGCDRRFSRSDELTRHIRIHTGQKPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTK 452          

HSP 2 Score: 60.8474 bits (146), Expect = 1.325e-10
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + F C  C +AF R D L  H R HTGE+P +C+ C ++F RSD    HT++H
Sbjct:  402 KPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTKVH 454          
BLAST of early growth response-3 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0330050)

HSP 1 Score: 104.375 bits (259), Expect = 2.515e-25
Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C    C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct: 1027 SKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 1112          

HSP 2 Score: 69.3218 bits (168), Expect = 2.197e-13
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct: 1025 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 1086          

HSP 3 Score: 61.6178 bits (148), Expect = 9.531e-11
Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct: 1064 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of early growth response-3 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083542)

HSP 1 Score: 103.99 bits (258), Expect = 2.846e-25
Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C    C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct: 1027 SKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 1112          

HSP 2 Score: 69.3218 bits (168), Expect = 2.239e-13
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct: 1025 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 1086          

HSP 3 Score: 61.6178 bits (148), Expect = 1.047e-10
Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct: 1064 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of early growth response-3 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0301615)

HSP 1 Score: 103.219 bits (256), Expect = 5.755e-25
Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C    C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct:  558 SKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 643          

HSP 2 Score: 68.9366 bits (167), Expect = 3.568e-13
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  556 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 617          

HSP 3 Score: 61.2326 bits (147), Expect = 1.423e-10
Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct:  595 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 651          
BLAST of early growth response-3 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0344633)

HSP 1 Score: 102.449 bits (254), Expect = 9.313e-25
Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C    C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct:  747 SKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 832          

HSP 2 Score: 68.5514 bits (166), Expect = 5.087e-13
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  745 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 806          

HSP 3 Score: 60.8474 bits (146), Expect = 1.891e-10
Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct:  784 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 840          
BLAST of early growth response-3 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083543)

HSP 1 Score: 102.449 bits (254), Expect = 9.313e-25
Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C    C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct:  747 SKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 832          

HSP 2 Score: 68.5514 bits (166), Expect = 5.087e-13
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  745 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 806          

HSP 3 Score: 60.8474 bits (146), Expect = 1.891e-10
Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct:  784 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 840          
BLAST of early growth response-3 vs. Ensembl Zebrafish
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 102.064 bits (253), Expect = 3.994e-25
Identity = 48/87 (55.17%), Postives = 59/87 (67.82%), Query Frame = 2
Query:  374 KSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            K   R + F+C   +C++ F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC+R F RSDER RH R
Sbjct:  242 KGAAREKPFSCPVESCERRFSRSDELNRHVRIHTGHKPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRHMR 328          

HSP 2 Score: 58.151 bits (139), Expect = 1.300e-9
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P +C+ C +RF RSD    H R+H  ++
Sbjct:  278 KPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRHMRVHLKQR 334          
BLAST of early growth response-3 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 103.219 bits (256), Expect = 5.349e-25
Identity = 47/88 (53.41%), Postives = 57/88 (64.77%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C   TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  302 SKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 389          

HSP 2 Score: 61.2326 bits (147), Expect = 1.475e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC  C ++F RSD    HT+IH  +K
Sbjct:  339 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQK 395          
BLAST of early growth response-3 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 103.219 bits (256), Expect = 5.349e-25
Identity = 47/88 (53.41%), Postives = 57/88 (64.77%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C   TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  302 SKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 389          

HSP 2 Score: 61.2326 bits (147), Expect = 1.475e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC  C ++F RSD    HT+IH  +K
Sbjct:  339 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQK 395          
BLAST of early growth response-3 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 93.5893 bits (231), Expect = 9.554e-23
Identity = 44/79 (55.70%), Postives = 51/79 (64.56%), Query Frame = 2
Query:  392 RQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  146 RPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRH 224          

HSP 2 Score: 60.8474 bits (146), Expect = 9.792e-11
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C+FC ++F RSD    HT+IH   K
Sbjct:  176 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQRHK 232          

HSP 3 Score: 60.8474 bits (146), Expect = 1.049e-10
Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  473 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIR 198          
BLAST of early growth response-3 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 93.5893 bits (231), Expect = 9.554e-23
Identity = 44/79 (55.70%), Postives = 51/79 (64.56%), Query Frame = 2
Query:  392 RQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  146 RPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRH 224          

HSP 2 Score: 60.8474 bits (146), Expect = 9.792e-11
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C+FC ++F RSD    HT+IH   K
Sbjct:  176 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQRHK 232          

HSP 3 Score: 60.8474 bits (146), Expect = 1.049e-10
Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  473 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIR 198          
BLAST of early growth response-3 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 102.834 bits (255), Expect = 9.838e-25
Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C   +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  298 SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 383          

HSP 2 Score: 66.6254 bits (161), Expect = 3.375e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  296 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 357          

HSP 3 Score: 62.003 bits (149), Expect = 1.142e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  335 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 391          
BLAST of early growth response-3 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 102.449 bits (254), Expect = 9.964e-25
Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C   +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  271 SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 356          

HSP 2 Score: 66.6254 bits (161), Expect = 3.108e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  269 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 330          

HSP 3 Score: 62.003 bits (149), Expect = 1.202e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  308 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 364          
BLAST of early growth response-3 vs. Ensembl Xenopus
Match: usp31 (ubiquitin specific peptidase 31 [Source:Xenbase;Acc:XB-GENE-920956])

HSP 1 Score: 96.6709 bits (239), Expect = 1.679e-22
Identity = 43/79 (54.43%), Postives = 54/79 (68.35%), Query Frame = 2
Query:  392 RQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            + F C   +C ++F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct:  438 KAFACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRH 516          

HSP 2 Score: 57.7658 bits (138), Expect = 2.787e-9
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P +C+ C +RF RSD    H ++H  +K
Sbjct:  468 KPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRHGKVHMKQK 524          

HSP 3 Score: 53.1434 bits (126), Expect = 1.127e-7
Identity = 26/54 (48.15%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  473 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            E+  AC    C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  437 EKAFACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIR 490          
BLAST of early growth response-3 vs. Ensembl Xenopus
Match: tbl1x (transducin beta like 1 X-linked [Source:Xenbase;Acc:XB-GENE-982285])

HSP 1 Score: 95.5153 bits (236), Expect = 1.929e-22
Identity = 46/88 (52.27%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  252 SKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK 339          

HSP 2 Score: 62.003 bits (149), Expect = 1.139e-10
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC++C ++F RSD    HT+IH  +K
Sbjct:  289 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 345          
BLAST of early growth response-3 vs. Ensembl Xenopus
Match: serpinb4 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:Xenbase;Acc:XB-GENE-5787878])

HSP 1 Score: 95.1301 bits (235), Expect = 2.414e-22
Identity = 42/72 (58.33%), Postives = 49/72 (68.06%), Query Frame = 2
Query:  413 CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  279 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAK 350          

HSP 2 Score: 62.3882 bits (150), Expect = 7.188e-11
Identity = 30/54 (55.56%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  473 ERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  269 ERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 322          

HSP 3 Score: 62.003 bits (149), Expect = 9.631e-11
Identity = 25/53 (47.17%), Postives = 33/53 (62.26%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + F C  C ++F R D L  H R HTGE+P AC+FC ++F RSD    H +IH
Sbjct:  300 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAKIH 352          
BLAST of early growth response-3 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 102.449 bits (254), Expect = 9.833e-25
Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C   +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  327 SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 412          

HSP 2 Score: 66.2402 bits (160), Expect = 3.453e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  325 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 386          

HSP 3 Score: 61.6178 bits (148), Expect = 1.177e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  364 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 420          
BLAST of early growth response-3 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 102.449 bits (254), Expect = 9.833e-25
Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C   +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  327 SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 412          

HSP 2 Score: 66.2402 bits (160), Expect = 3.453e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  325 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 386          

HSP 3 Score: 61.6178 bits (148), Expect = 1.177e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  364 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 420          
BLAST of early growth response-3 vs. Ensembl Mouse
Match: Egr4 (early growth response 4 [Source:MGI Symbol;Acc:MGI:99252])

HSP 1 Score: 101.679 bits (252), Expect = 1.464e-24
Identity = 45/80 (56.25%), Postives = 55/80 (68.75%), Query Frame = 2
Query:  389 VRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            V+ F C   +C ++F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  369 VKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 448          

HSP 2 Score: 62.003 bits (149), Expect = 8.501e-11
Identity = 29/76 (38.16%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLR 619
            + F C  C + F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+
Sbjct:  400 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLK 464          

HSP 3 Score: 51.6026 bits (122), Expect = 2.542e-7
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  497 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  379 CVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 422          
BLAST of early growth response-3 vs. Ensembl Mouse
Match: Egr2 (early growth response 2 [Source:MGI Symbol;Acc:MGI:95296])

HSP 1 Score: 96.2857 bits (238), Expect = 1.161e-22
Identity = 46/88 (52.27%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  328 SKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK 415          

HSP 2 Score: 62.003 bits (149), Expect = 8.596e-11
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC++C ++F RSD    HT+IH  +K
Sbjct:  365 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 421          
BLAST of early growth response-3 vs. Ensembl Mouse
Match: Egr2 (early growth response 2 [Source:MGI Symbol;Acc:MGI:95296])

HSP 1 Score: 96.2857 bits (238), Expect = 1.161e-22
Identity = 46/88 (52.27%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  328 SKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTK 415          

HSP 2 Score: 62.003 bits (149), Expect = 8.596e-11
Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC++C ++F RSD    HT+IH  +K
Sbjct:  365 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 421          
BLAST of early growth response-3 vs. UniProt/SwissProt
Match: sp|O73693|EGR1_TAEGU (Early growth response protein 1 (Fragment) OS=Taeniopygia guttata OX=59729 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.746e-24
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  413 CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 70          

HSP 2 Score: 60.077 bits (144), Expect = 5.786e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:   22 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 78          

HSP 3 Score: 59.3066 bits (142), Expect = 1.236e-9
Identity = 25/44 (56.82%), Postives = 31/44 (70.45%), Query Frame = 2
Query:  497 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 44          
BLAST of early growth response-3 vs. UniProt/SwissProt
Match: sp|P26632|EGR1_DANRE (Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 4.038e-24
Identity = 47/88 (53.41%), Postives = 57/88 (64.77%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C   TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  302 SKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 389          

HSP 2 Score: 61.2326 bits (147), Expect = 1.114e-9
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC  C ++F RSD    HT+IH  +K
Sbjct:  339 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQK 395          
BLAST of early growth response-3 vs. UniProt/SwissProt
Match: sp|A4II20|EGR1_XENTR (Early growth response protein 1 OS=Xenopus tropicalis OX=8364 GN=egr1 PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 5.212e-24
Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C   +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  298 SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 383          

HSP 2 Score: 66.6254 bits (161), Expect = 1.788e-11
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  296 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 357          

HSP 3 Score: 62.003 bits (149), Expect = 6.052e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  335 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 391          
BLAST of early growth response-3 vs. UniProt/SwissProt
Match: sp|Q6NTY6|EGR1B_XENLA (Early growth response protein 1-B OS=Xenopus laevis OX=8355 GN=egr1-b PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 5.735e-24
Identity = 46/88 (52.27%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C   +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH +
Sbjct:  275 SKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTK 362          

HSP 2 Score: 62.003 bits (149), Expect = 6.889e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  312 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 368          
BLAST of early growth response-3 vs. UniProt/SwissProt
Match: sp|O73692|EGR1_COTJA (Early growth response protein 1 (Fragment) OS=Coturnix japonica OX=93934 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.925e-24
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  413 CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 70          

HSP 2 Score: 59.6918 bits (143), Expect = 8.582e-10
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:   22 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 78          

HSP 3 Score: 58.9214 bits (141), Expect = 1.546e-9
Identity = 25/44 (56.82%), Postives = 31/44 (70.45%), Query Frame = 2
Query:  497 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 44          
BLAST of early growth response-3 vs. TrEMBL
Match: I1ZI70 (Early growth response-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 2.865e-132
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 2
Query:   50 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPXXXXXXXXXXXXXLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 640
            MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQF CNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL
Sbjct:    1 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQFMCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 197          
BLAST of early growth response-3 vs. TrEMBL
Match: G1CSV5 (EGR-like protein 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.123e-96
Identity = 145/197 (73.60%), Postives = 165/197 (83.76%), Query Frame = 2
Query:   50 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPXXXXXXXXXXXXXLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 640
            MV+NIQKLTL VKIDK EF+EIQTGYTPLPGIHESFYL+NTENW+NLKTPSPMDC ++EF+ IY S++D+  +ST +         N+ KSL +I    SSPLSE S KSQ R++QFTCNTCKK+FYRRDELKRHERIHTGERPLAC+FCDKRFMRSDHLSTH RIHTGEKPY+C+ C RLF RSDERLRH RQ HL
Sbjct:    1 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKL-------NPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 186          
BLAST of early growth response-3 vs. TrEMBL
Match: T1DF98 (Egrl-3 (Fragment) OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 7.615e-82
Identity = 122/194 (62.89%), Postives = 151/194 (77.84%), Query Frame = 2
Query:   56 RNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPXXXXXXXXXXXXXLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 637
            +N++KL L VKIDK+EF+ I TGYTPLPG+H+SFY  +T NWNN+KTPSPMDC DIEFIL Y S+E+N   ST++P SS++        L    ++C SP SE SSKSQ + ++F C+TC K+F RRDELKRHERIH+GERPL+C++C+KRFMRSDH +TH RIHTGEKPY C+ C   FGRSDERLRH R NH
Sbjct:    1 KNLRKLKLSVKIDKTEFENIHTGYTPLPGVHQSFYCNDTINWNNIKTPSPMDCDDIEFILFYNSNEENNVISTVVPVSSENT-------LTYTFSQCGSPKSETSSKSQLKRKEFPCSTCTKSFSRRDELKRHERIHSGERPLSCDYCNKRFMRSDHRATHLRIHTGEKPYHCHFCPISFGRSDERLRHMRLNH 187          
BLAST of early growth response-3 vs. TrEMBL
Match: T1E116 (Egrl-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 6.382e-68
Identity = 106/196 (54.08%), Postives = 134/196 (68.37%), Query Frame = 2
Query:   50 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPXXXXXXXXXXXXXLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 637
            MVRN+  + L VKID SEFD   TGYTP PG+H+SFY  +T   +N+KTPSP+DC+DIEFIL+Y S E+  + S+                     +   S + +  + SQ   ++F C+TC K F+RRDEL+RH RIH+GERPLAC+FCDKRFMRSDH +TH RIHTGEKPY+C+ C+  FGRSDERLRH R NH
Sbjct:    1 MVRNV--IQLSVKIDLSEFDNFHTGYTPFPGVHQSFYGNDTTQIDNIKTPSPIDCKDIEFILVYSSTEEKSKMSSE-------------------EHFTFSMIPKPKTDSQTMKKKFICSTCMKPFFRRDELRRHGRIHSGERPLACDFCDKRFMRSDHRTTHRRIHTGEKPYKCHFCASSFGRSDERLRHMRVNH 175          
BLAST of early growth response-3 vs. TrEMBL
Match: I1ZI72 (Early growth response-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 8.451e-28
Identity = 53/82 (64.63%), Postives = 63/82 (76.83%), Query Frame = 2
Query:  383 NRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            N  R F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH R HTGEKPY C++CS+ F RSDE+LRH R
Sbjct:  194 NIERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKR 275          
BLAST of early growth response-3 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 106.686 bits (265), Expect = 7.204e-27
Identity = 53/102 (51.96%), Postives = 64/102 (62.75%), Query Frame = 2
Query:  335 TNRCSSPLSENSSKSQN--RVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            TNR  +P +    K+    R + F C    C++ F R DEL RH R+HTG RP  C  C +RF RSDHL+TH R HTGEKP+ C+VC R F RSDER RH R
Sbjct:  253 TNRAHAPKATGGRKAAGARREKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHAR 354          

HSP 2 Score: 60.077 bits (144), Expect = 2.867e-10
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            R F C  C + F R D L  H R HTGE+P +C+ C +RF RSD    H R+H  ++
Sbjct:  304 RPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQR 360          
BLAST of early growth response-3 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 102.449 bits (254), Expect = 1.715e-25
Identity = 48/88 (54.55%), Postives = 57/88 (64.77%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            +    R + F C    C++ F R DEL RH R+HTG RP  C  C +RF RSDHL+TH R HTGEKP+ C+VC R F RSDER RH R
Sbjct:  228 AAGARREKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHAR 315          

HSP 2 Score: 60.077 bits (144), Expect = 2.584e-10
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            R F C  C + F R D L  H R HTGE+P +C+ C +RF RSD    H R+H  ++
Sbjct:  265 RPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQR 321          
BLAST of early growth response-3 vs. Ensembl Cavefish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:103036296])

HSP 1 Score: 102.449 bits (254), Expect = 7.829e-25
Identity = 47/88 (53.41%), Postives = 57/88 (64.77%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C   TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  309 SKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 396          

HSP 2 Score: 60.077 bits (144), Expect = 2.794e-10
Identity = 25/53 (47.17%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + F C  C + F R D L  H R HTGE+P AC  C ++F RSD    HT+IH
Sbjct:  346 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIH 398          
BLAST of early growth response-3 vs. Ensembl Cavefish
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:103046494])

HSP 1 Score: 95.9005 bits (237), Expect = 8.213e-23
Identity = 46/86 (53.49%), Postives = 54/86 (62.79%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  287 SKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRH 372          

HSP 2 Score: 63.1586 bits (152), Expect = 2.739e-11
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+FC ++F RSD    HT+IH  +K
Sbjct:  324 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQK 380          

HSP 3 Score: 60.8474 bits (146), Expect = 1.603e-10
Identity = 30/62 (48.39%), Postives = 36/62 (58.06%), Query Frame = 2
Query:  449 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R  +    ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  285 RPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 346          
BLAST of early growth response-3 vs. Ensembl Cavefish
Match: EGR2 (early growth response protein 2b-like [Source:NCBI gene;Acc:103032442])

HSP 1 Score: 95.9005 bits (237), Expect = 8.441e-23
Identity = 43/81 (53.09%), Postives = 53/81 (65.43%), Query Frame = 2
Query:  392 RQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R + C    C + F R DEL RH R+HTG +P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH +
Sbjct:  275 RPYPCPAEGCDRRFSRSDELARHVRVHTGHKPFQCRICMRSFGRSDHLTTHIRTHTGEKPFACDLCGRKFARSDERRRHAK 355          

HSP 2 Score: 64.3142 bits (155), Expect = 1.113e-11
Identity = 29/54 (53.70%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  473 ERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ERP  C    CD+RF RSD L+ H R+HTG KP++C +C R FGRSD    H R
Sbjct:  274 ERPYPCPAEGCDRRFSRSDELARHVRVHTGHKPFQCRICMRSFGRSDHLTTHIR 327          

HSP 3 Score: 59.3066 bits (142), Expect = 5.371e-10
Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    H +IH
Sbjct:  305 KPFQCRICMRSFGRSDHLTTHIRTHTGEKPFACDLCGRKFARSDERRRHAKIH 357          
BLAST of early growth response-3 vs. Ensembl Sea Lamprey
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 98.5969 bits (244), Expect = 2.981e-25
Identity = 47/87 (54.02%), Postives = 54/87 (62.07%), Query Frame = 2
Query:  374 KSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            K+    R F C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH R
Sbjct:  164 KTPPHARPFPCPAEGCDRRFSRTDELTRHIRIHTGHKPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGR 250          

HSP 2 Score: 65.4698 bits (158), Expect = 4.075e-13
Identity = 28/53 (52.83%), Postives = 34/53 (64.15%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + FTC  C ++F R D L  H R HTGE+P AC+FC +RF RSD    H RIH
Sbjct:  200 KPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGRIH 252          
BLAST of early growth response-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006002.1 (pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 gene:ENSPMAG00000005404.1 transcript:ENSPMAT00000006002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 2.734e-21
Identity = 40/77 (51.95%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            +Q+ C  C + F R D LK H RIHTGE+P  C  C + F +S  L TH R+HTGEKPYRC VC R+F +S    RH
Sbjct:    3 QQYECRQCGREFVRSDALKAHMRIHTGEKPYRCGACGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRH 79          

HSP 2 Score: 65.4698 bits (158), Expect = 3.164e-13
Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGR 601
            R F C+ C +AF      +RH R HTG+RP  C  C + F +  ++  H R H GEKP+ C+VC++ F R
Sbjct:  143 RPFRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRSHKGEKPFGCDVCAQGFTR 212          

HSP 3 Score: 56.6102 bits (135), Expect = 4.189e-10
Identity = 29/83 (34.94%), Postives = 43/83 (51.81%), Query Frame = 2
Query:  344 CSSPLSENS-----SKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCN 577
            CS   +E S     +++    R + C  C +AF +R  +KRH+R H GE+P  C+ C + F R  +L  H   H GE P  C+
Sbjct:  150 CSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRSHKGEKPFGCDVCAQGFTRLCNLKVHLLKHAGEFPQICS 232          

HSP 4 Score: 56.225 bits (134), Expect = 6.536e-10
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 2
Query:  398 FTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSR 589
            + C  C +AF +   LK H+R+HTGE+P  C  C + F +S H + H + HT    + C  C+R
Sbjct:   33 YRCGACGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRHRKAHTVSHMHSCRQCTR 96          

HSP 5 Score: 55.4546 bits (132), Expect = 1.309e-9
Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 2
Query:  470 GERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSD 607
            G +   C  C + F+RSD L  H RIHTGEKPYRC  C R F +S 
Sbjct:    1 GRQQYECRQCGREFVRSDALKAHMRIHTGEKPYRCGACGRAFSQSS 46          

HSP 6 Score: 53.9138 bits (128), Expect = 4.110e-9
Identity = 28/77 (36.36%), Postives = 37/77 (48.05%), Query Frame = 2
Query:  404 CNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQN 634
            C  C K      E + H R +  ERP  C+ C + F    +   HTR HTG++PYRC  C R F +     RH R +
Sbjct:  119 CIQCYKGSSDVVEFRVHFRANICERPFRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRSH 195          
BLAST of early growth response-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000923.1 (pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 gene:ENSPMAG00000000839.1 transcript:ENSPMAT00000000923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 4.193e-21
Identity = 37/79 (46.84%), Postives = 47/79 (59.49%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R + C  C + F R    +RH R+HTGERP AC  C +RF +  HL+ HTR+HTGE+PY C  C R F +     RH R
Sbjct:   20 RPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHLR 98          

HSP 2 Score: 57.3806 bits (137), Expect = 2.987e-11
Identity = 25/46 (54.35%), Postives = 29/46 (63.04%), Query Frame = 2
Query:  458 RIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 595
            R HTGERP AC  C +RF R  +   H R+HTGE+PY C  C R F
Sbjct:   14 RNHTGERPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRF 59          
BLAST of early growth response-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 4.609e-20
Identity = 34/78 (43.59%), Postives = 48/78 (61.54%), Query Frame = 2
Query:  389 VRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
             + F C  C KAF +  +L+ H+R HTGE+P  C+ C+K F +S +L  H R HTGEKP++C VC + F  S    +H
Sbjct:   29 TKPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKH 106          

HSP 2 Score: 69.707 bits (169), Expect = 8.310e-16
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            + F C  C+KAF +   L  H R HT  +P  C  C K F +S  L +H R HTGEKP++C+VC + F +S    +H R
Sbjct:    4 KPFKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQR 80          

HSP 3 Score: 52.7582 bits (125), Expect = 1.298e-9
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  467 TGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            TGE+P  C  C+K F +S +L+ H R HT  KP+RC +C + F +S +   H R
Sbjct:    1 TGEKPFKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQR 52          
BLAST of early growth response-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005225.1 (pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1 gene:ENSPMAG00000004710.1 transcript:ENSPMAT00000005225.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 6.443e-20
Identity = 38/91 (41.76%), Postives = 54/91 (59.34%), Query Frame = 2
Query:  365 NSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 637
             SS S+ + R + C+ C K+F +  +L+RH RIHTGERP  C  CDK F +++ L  H + HTGEKPY+C  C   F +      H ++ H
Sbjct: 1680 GSSASRQKPRLYKCDHCDKSFAKPSQLQRHNRIHTGERPYICQVCDKAFNQTNALQIHMKKHTGEKPYKCQYCDMAFSQKGNMKIHIKRAH 1770          

HSP 2 Score: 72.7886 bits (177), Expect = 3.713e-15
Identity = 32/78 (41.03%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            R + C  C K F +   LK+H R HTGE+P  C  C + F+ S  L  H R HTGEK Y+C++C   F  +    RH 
Sbjct:  953 RSYRCGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHM 1030          

HSP 3 Score: 68.9366 bits (167), Expect = 9.156e-14
Identity = 32/78 (41.03%), Postives = 40/78 (51.28%), Query Frame = 2
Query:  404 CNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 637
            C  C K F +  +L RH RIHTGERP  C  C + F +   L  H   HTGE+PYRC  C   F +      H ++ H
Sbjct:  165 CEHCMKTFQKPSQLIRHIRIHTGERPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVH 242          

HSP 4 Score: 66.2402 bits (160), Expect = 5.836e-13
Identity = 31/78 (39.74%), Postives = 40/78 (51.28%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            R + C  C KAF +   LK+H R HTGE+P  C  C + F+ S  L  H R H G K Y+C +C   F  +    RH 
Sbjct:  633 RPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIRTHVGLKAYKCVMCDGTFTTNGSLKRHM 710          

HSP 5 Score: 61.6178 bits (148), Expect = 2.522e-11
Identity = 28/76 (36.84%), Postives = 37/76 (48.68%), Query Frame = 2
Query:  398 FTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            + C  C +AF  +  L  H + HTG +   C  CDK F     L  H R+HTG KP+ C  C++ F  S  R  H 
Sbjct:  484 YKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHI 559          

HSP 6 Score: 61.2326 bits (147), Expect = 3.699e-11
Identity = 31/82 (37.80%), Postives = 40/82 (48.78%), Query Frame = 2
Query:  383 NRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            N VR   C  C K F +  +L RH RIHT E+P  C  C + F     L+ H + HTG K + C +C +LF        H R
Sbjct:  451 NGVRWHMCPYCNKEFKKPSDLVRHIRIHTHEKPYKCTQCFRAFAVKSTLTAHRKTHTGLKEFMCPLCDKLFSTQGSLKVHIR 532          

HSP 7 Score: 60.077 bits (144), Expect = 9.319e-11
Identity = 27/52 (51.92%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  473 ERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            +RP  C +C+K F +S HL  H R HTGEKPYRC  CSR F  S     H R
Sbjct:  632 DRPYRCGYCNKAFKKSSHLKQHIRSHTGEKPYRCGQCSRSFVSSGVLKAHIR 683          

HSP 8 Score: 57.7658 bits (138), Expect = 5.029e-10
Identity = 27/77 (35.06%), Postives = 36/77 (46.75%), Query Frame = 2
Query:  398 FTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            F C  C + F     LK H R HTGE+   C+ CD  F  +  L+ H  +HT   P++C  C   F  S    +H R
Sbjct:  983 FKCAQCGRGFVSSGVLKAHMRTHTGEKAYKCDLCDATFTTNGSLTRHMVMHTSMHPFKCPFCEESFRTSLHCRKHMR 1059          

HSP 9 Score: 55.4546 bits (132), Expect = 2.531e-9
Identity = 31/89 (34.83%), Postives = 45/89 (50.56%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHT-RIHTGEKP------YRCNVCSRLFGRSDERLRHFRQNH 637
            R FTC  C +AF ++  L+ H+  HTGERP  C FC   F +  +L  H  R+H+  KP      ++C  CS +F +      H  + H
Sbjct:  189 RPFTCEECGRAFNQKGALQIHKAKHTGERPYRCAFCPHTFSQRGNLRAHIQRVHSDAKPGGEQPVFQCEDCSCVFKKLGSLNAHISRMH 277          

HSP 10 Score: 51.6026 bits (122), Expect = 4.835e-8
Identity = 22/47 (46.81%), Postives = 27/47 (57.45%), Query Frame = 2
Query:  488 CNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C +C+K F +S HL  H R HTGEKP++C  C R F  S     H R
Sbjct:  957 CGYCNKGFKKSSHLKQHVRSHTGEKPFKCAQCGRGFVSSGVLKAHMR 1003          

HSP 11 Score: 50.0618 bits (118), Expect = 1.707e-7
Identity = 22/59 (37.29%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  374 KSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            K+   +++F C  C K F  +  LK H R+HTG +P  C  C+K+F  S H  +H   H
Sbjct:  504 KTHTGLKEFMCPLCDKLFSTQGSLKVHIRLHTGAKPFDCPHCNKKFRTSGHRKSHIASH 562          

HSP 12 Score: 49.2914 bits (116), Expect = 3.017e-7
Identity = 21/59 (35.59%), Postives = 31/59 (52.54%), Query Frame = 2
Query:  452 HERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            H + HTG++   C+ C+  F     L  H R+HTG KP++C  C + F  S  R  H +
Sbjct: 1192 HVKTHTGQKHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSHIQ 1250          

HSP 13 Score: 49.2914 bits (116), Expect = 3.073e-7
Identity = 21/59 (35.59%), Postives = 31/59 (52.54%), Query Frame = 2
Query:  374 KSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            K+    + F C+ C   F  +  LK H R+HTG +P  C  C++RF  S H  +H + H
Sbjct: 1194 KTHTGQKHFKCHICNSPFSTKGSLKVHMRLHTGAKPFKCPHCEQRFRTSGHRKSHIQSH 1252          
BLAST of early growth response-3 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 77.7962 bits (190), Expect = 4.969e-17
Identity = 32/85 (37.65%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  374 KSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            K  ++ + + C TCK+ F   + L +H R H+GE+P  C+ C+K+F  S  L  H R HTGEKP +C +C + F  S    +H +
Sbjct:  760 KVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 844          

HSP 2 Score: 62.3882 bits (150), Expect = 6.866e-12
Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 595
            + + C+ C K F     LK H R HTGE+PL C  C KRF  S +LS H + H  +K Y+C+ CS+ F
Sbjct:  794 KPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH--QKKYKCSDCSKSF 859          

HSP 3 Score: 62.003 bits (149), Expect = 9.351e-12
Identity = 27/72 (37.50%), Postives = 42/72 (58.33%), Query Frame = 2
Query:  413 CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C + F +R +L RH ++H+  +P  C  C + F   + L  HTR H+GEKPY+C++C++ F  S     H R
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIR 816          
BLAST of early growth response-3 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 75.485 bits (184), Expect = 3.173e-16
Identity = 31/79 (39.24%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  389 VRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            V++  C  C + F +   L+ H R H G +P  C++C KRF +  +L TH R+HTGEKPY C++C + F R      H 
Sbjct:  590 VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668          

HSP 2 Score: 67.0106 bits (162), Expect = 2.190e-13
Identity = 28/70 (40.00%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNV--CSRLF 595
            + F C+ C K F +   L+ HER+HTGE+P +C+ CDK+F R  +L+ H   H   KP+ C +  C++ F
Sbjct:  619 KPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTF 688          
BLAST of early growth response-3 vs. Ensembl Yeast
Match: MIG1 (Transcription factor involved in glucose repression; sequence specific DNA binding protein containing two Cys2His2 zinc finger motifs; regulated by the SNF1 kinase and the GLC7 phosphatase; regulates filamentous growth along with Mig2p in response to glucose depletion; activated in stochastic pulses of nuclear localization, shuttling between cytosol and nucleus depending on external glucose levels and its phosphorylation state [Source:SGD;Acc:S000003003])

HSP 1 Score: 67.0106 bits (162), Expect = 1.970e-13
Identity = 36/74 (48.65%), Postives = 45/74 (60.81%), Query Frame = 2
Query:  371 SKSQNRV-------RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKP 565
            SKS+++V       R   C  C +AF+R +   RH RIHTGE+P AC+F  C KRF RSD L+ H RIHT   P
Sbjct:   22 SKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHP 95          

HSP 2 Score: 55.8398 bits (133), Expect = 1.104e-9
Identity = 27/55 (49.09%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  470 GERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNV--CSRLFGRSDERLRHFR 628
              RP AC  C + F R +H + H RIHTGEKP+ C+   C + F RSDE  RH R
Sbjct:   34 APRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRR 88          
BLAST of early growth response-3 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 66.6254 bits (161), Expect = 2.352e-13
Identity = 35/86 (40.70%), Postives = 41/86 (47.67%), Query Frame = 2
Query:  398 FTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCN---------VCSRLFGRSDERLRHFR 628
            F C+ C K F R   LK H R HT ERP  C+ C K F R      H  +HTG+K Y C           C + F RSD   RHF+
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654          

HSP 2 Score: 50.0618 bits (118), Expect = 9.742e-8
Identity = 25/64 (39.06%), Postives = 34/64 (53.12%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNF---------CDKRFMRSDHLSTHTRIHTG 556
            R F C+ C KAF R+ + KRHE +HTG++   C           C K+F RSD L  H +  +G
Sbjct:  595 RPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESG 658          
BLAST of early growth response-3 vs. Ensembl Yeast
Match: MSN4 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes, inducing gene expression; involved in diauxic shift [Source:SGD;Acc:S000001545])

HSP 1 Score: 65.855 bits (159), Expect = 4.977e-13
Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHER-IHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + F C  C+KAF R + LKRH R +H+ ERP AC FC+K+F RSD+LS H + H
Sbjct:  571 KPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTH 624          

HSP 2 Score: 50.447 bits (119), Expect = 7.807e-8
Identity = 21/52 (40.38%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  476 RPLACNFCDKRFMRSDHLSTHTR-IHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            +P  C  C+K F RS+HL  H R +H+ E+P+ C  C + F RSD   +H +
Sbjct:  571 KPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622          
BLAST of early growth response-3 vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 90.8929 bits (224), Expect = 5.188e-24
Identity = 44/81 (54.32%), Postives = 52/81 (64.20%), Query Frame = 2
Query:  392 RQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            R + C   TC + F R DEL RH R HTG++P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:    2 RPYACPVETCPRRFSRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMK 82          

HSP 2 Score: 53.9138 bits (128), Expect = 6.888e-10
Identity = 26/54 (48.15%), Postives = 30/54 (55.56%), Query Frame = 2
Query:  398 FTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGE 559
            F C  C + F R D L  H R HTGE+P AC  C +RF RSD    H +IH  E
Sbjct:   34 FQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMKIHLRE 87          
BLAST of early growth response-3 vs. Ensembl Nematostella
Match: EDO40036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B6])

HSP 1 Score: 83.1889 bits (204), Expect = 1.412e-19
Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 2
Query:  344 CSSPLSENSSKSQNR-----VRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQN 634
            C    +E SS +++R      R + C  C KAF +   LK H R+HTGE+P  C  C++ F +  +L TH R HTGEKPY+C+ CS+LF +    ++H +++
Sbjct:  122 CQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMRVHTGEKPYPCPLCERAFAKGYNLKTHMRTHTGEKPYKCDFCSKLFSQHSTLMQHVQRH 223          

HSP 2 Score: 76.6406 bits (187), Expect = 3.726e-17
Identity = 35/79 (44.30%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            + +TC  C+++F     L +H R HTGERP  C  CDK F +S  L  H R+HTGEKPY C +C R F +      H R
Sbjct:  115 KPYTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMRVHTGEKPYPCPLCERAFAKGYNLKTHMR 193          

HSP 3 Score: 72.0182 bits (175), Expect = 2.082e-15
Identity = 34/79 (43.04%), Postives = 44/79 (55.70%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ++  C+TC K F     LK H RIHTGE+P  C FC + F     L+ H R HTGE+PY+C  C + F +S     H R
Sbjct:   87 KEHKCDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAHTGERPYKCKECDKAFSQSGGLKVHMR 165          

HSP 4 Score: 54.299 bits (129), Expect = 4.275e-9
Identity = 29/79 (36.71%), Postives = 39/79 (49.37%), Query Frame = 2
Query:  398 FTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQN 634
            + C+ C +    R  L  H RIH  ++   C+ C K+F    +L  H RIHTGEKPY C  C R F       +H R +
Sbjct:   61 YQCHHCPEKLKLRCHLNYHLRIHAPKKEHKCDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAH 139          

HSP 5 Score: 51.6026 bits (122), Expect = 4.301e-8
Identity = 24/60 (40.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYR 571
            + + C  C++AF +   LK H R HTGE+P  C+FC K F +   L  H + H G  P R
Sbjct:  171 KPYPCPLCERAFAKGYNLKTHMRTHTGEKPYKCDFCSKLFSQHSTLMQHVQRHQGNAPIR 230          

HSP 6 Score: 50.0618 bits (118), Expect = 1.328e-7
Identity = 25/82 (30.49%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  350 SPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 595
            + L ++ S  +  V++  C+ CK AF  + +L +H   +TG+ P  C+ C ++     HL+ H RIH  +K ++C+ C + F
Sbjct:   17 TKLRKHLSSHKVEVKRLHCDGCKVAFAFQYQLDKHIYRNTGDVPYQCHHCPEKLKLRCHLNYHLRIHAPKKEHKCDTCGKQF 98          
BLAST of early growth response-3 vs. Ensembl Nematostella
Match: EDO49116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU6])

HSP 1 Score: 81.2629 bits (199), Expect = 2.487e-19
Identity = 37/78 (47.44%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            + +TC  C K F R    +RH  IHTG++P  C  C K F  + HL  H RIHTGEKPY CN+CSR F +     RH 
Sbjct:    2 KPYTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHI 79          

HSP 2 Score: 75.8702 bits (185), Expect = 2.575e-17
Identity = 37/88 (42.05%), Postives = 49/88 (55.68%), Query Frame = 2
Query:  374 KSQNRV----RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            K  NR+    + +TCN C + F +   L+RH   HTGE+P  C +C K F+ S  L  H RIHTGE+PY+C  CS+ F  S     H 
Sbjct:   48 KIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHI 135          

HSP 3 Score: 75.0998 bits (183), Expect = 4.199e-17
Identity = 36/75 (48.00%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  404 CNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C  C KAF    +L+RH RIHTGERP  C  C K F  S +L +H   HTGEKPY+C++C+  F  S     H R
Sbjct:   90 CTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIR 164          

HSP 4 Score: 73.559 bits (179), Expect = 1.817e-16
Identity = 34/79 (43.04%), Postives = 44/79 (55.70%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            + + C  C KAF     LK H RIHTGE+P  CN C + F +  +L  H   HTGEKP++C  C + F  S +  RH R
Sbjct:   30 KPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVR 108          

HSP 5 Score: 51.2174 bits (121), Expect = 2.628e-8
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            R + C  C KAF     L+ H   HTGE+P  C+ C+ +F+ S +L TH RIH
Sbjct:  114 RPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIRIH 166          

HSP 6 Score: 45.4394 bits (106), Expect = 3.118e-6
Identity = 20/52 (38.46%), Postives = 27/52 (51.92%), Query Frame = 2
Query:  473 ERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ++P  C  C K F RS +   H  IHTG+KPY+C  C + F  +     H R
Sbjct:    1 DKPYTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNR 52          
BLAST of early growth response-3 vs. Ensembl Nematostella
Match: EDO43107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ7])

HSP 1 Score: 83.1889 bits (204), Expect = 2.868e-19
Identity = 39/78 (50.00%), Postives = 48/78 (61.54%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            R   C  C KAFY  ++L+RH RIH+GERP  C  CDK F  +  L THT IHTGEKP++C  C + F  S +  RH 
Sbjct:   57 RPHQCPVCPKAFYSSNDLRRHSRIHSGERPYICKHCDKSFATTISLKTHTYIHTGEKPHKCPQCPKTFATSSKLGRHI 134          

HSP 2 Score: 63.5438 bits (153), Expect = 3.513e-12
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFG 598
            R++ C+ C KAF     L++H   HTGERP  C  C K F  S+ L  H+RIH+GE+PY C  C + F 
Sbjct:   29 RKWKCSMCDKAFRHPFGLQQHIYTHTGERPHQCPVCPKAFYSSNDLRRHSRIHSGERPYICKHCDKSFA 97          

HSP 3 Score: 58.9214 bits (141), Expect = 1.569e-10
Identity = 31/82 (37.80%), Postives = 40/82 (48.78%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 637
            R + C  C K+F     LK H  IHTGE+P  C  C K F  S  L  H   H+ ++P+ C  C + F RS +  RH    H
Sbjct:   85 RPYICKHCDKSFATTISLKTHTYIHTGEKPHKCPQCPKTFATSSKLGRHIVTHSEQRPFSCEQCMKSFNRSGDLRRHCMTVH 166          

HSP 4 Score: 48.521 bits (114), Expect = 5.305e-7
Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 2
Query:  401 TCNTCKKAFYRRDELKRH-ERI--HTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            TC  C K F   + L RH +R+      R   C+ CDK F     L  H   HTGE+P++C VC + F  S++  RH R
Sbjct:    1 TCGKCGKIFTSLNYLARHIKRVCPDMSCRKWKCSMCDKAFRHPFGLQQHIYTHTGERPHQCPVCPKAFYSSNDLRRHSR 79          
BLAST of early growth response-3 vs. Ensembl Nematostella
Match: EDO29702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2W2])

HSP 1 Score: 80.8777 bits (198), Expect = 1.723e-18
Identity = 36/78 (46.15%), Postives = 50/78 (64.10%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            + + C+ C K F +  +LKRH +IHTG++P  C  C K F RS+ L TH RIH+G+KPY+C+VC + F  S    RH 
Sbjct:   90 KPYKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHL 167          

HSP 2 Score: 73.559 bits (179), Expect = 1.022e-15
Identity = 32/78 (41.03%), Postives = 46/78 (58.97%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 625
            + + C  C K F R + LK H RIH+G++P  C+ C K F  S +L  H  IH+G+KPY+C+VC + F  S    +H 
Sbjct:  118 KPYECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHL 195          

HSP 3 Score: 72.7886 bits (177), Expect = 1.811e-15
Identity = 32/79 (40.51%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            + + C+ C K F +   L RH RIH+G++P  C+ C K F +S +L TH RIH+G+KPY+C+ C + F +  +  RH +
Sbjct:   34 KPYRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLK 112          

HSP 4 Score: 70.0922 bits (170), Expect = 1.632e-14
Identity = 32/75 (42.67%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  404 CNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C  C   F R   LKRH  IH+G++P  C+ C K F +S  L+ H RIH+G+KPY+C+ C + F +S     H R
Sbjct:   10 CGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLR 84          

HSP 5 Score: 70.0922 bits (170), Expect = 1.839e-14
Identity = 32/79 (40.51%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            + + C+ C K F +   LK H RIH+G++P  C+ C K F++   L  H +IHTG+KPY C  C + F RS+    H R
Sbjct:   62 KPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLR 140          

HSP 6 Score: 67.0106 bits (162), Expect = 2.219e-13
Identity = 28/68 (41.18%), Postives = 41/68 (60.29%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 595
            + + C+ C K F     LKRH  IH+G++P  C+ C K F  S +L  H  IH+G+KPY+C+ C + F
Sbjct:  146 KPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCF 213          

HSP 7 Score: 58.5362 bits (140), Expect = 2.031e-10
Identity = 27/74 (36.49%), Postives = 44/74 (59.46%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLST---HTRIHTGEKPYRCNVCSRLFGRS 604
            + + C+ C K F     LK+H  IH+G++P  C+ C K F+   +L T   H  IH+G+KP++C+ C + F +S
Sbjct:  174 KPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLIHLMIHSGQKPHKCDECGKCFHQS 247          

HSP 8 Score: 47.7506 bits (112), Expect = 9.098e-7
Identity = 22/52 (42.31%), Postives = 29/52 (55.77%), Query Frame = 2
Query:  473 ERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            E+P  C  C   F R  +L  H  IH+G+KPYRC+ C + F +S    RH R
Sbjct:    5 EKPNECGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLR 56          
BLAST of early growth response-3 vs. Ensembl Medaka
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100272163])

HSP 1 Score: 102.449 bits (254), Expect = 7.424e-25
Identity = 47/88 (53.41%), Postives = 57/88 (64.77%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C   TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  304 SKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 391          

HSP 2 Score: 60.8474 bits (146), Expect = 1.661e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC  C ++F RSD    HT+IH  +K
Sbjct:  341 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQK 397          
BLAST of early growth response-3 vs. Ensembl Medaka
Match: ENSORLT00000034291.1 (early growth response protein 2b [Source:NCBI gene;Acc:101164744])

HSP 1 Score: 97.0561 bits (240), Expect = 2.830e-23
Identity = 46/88 (52.27%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  371 SKSQNRVRQFTC--NTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            SK+    R + C   +C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  295 SKTPVHQRPYPCPAESCDRRFSRSDELSRHLRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMK 382          

HSP 2 Score: 54.6842 bits (130), Expect = 1.625e-8
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P +C  C ++F RSD    H +IH  +K
Sbjct:  332 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMKIHLRQK 388          
BLAST of early growth response-3 vs. Ensembl Medaka
Match: ENSORLT00000000940.2 (early growth response protein 1 [Source:NCBI gene;Acc:101160576])

HSP 1 Score: 97.4413 bits (241), Expect = 3.476e-23
Identity = 41/75 (54.67%), Postives = 52/75 (69.33%), Query Frame = 2
Query:  404 CNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
             + C++ F R DEL RH R+HTG++P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  287 ADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAK 361          

HSP 2 Score: 63.1586 bits (152), Expect = 2.656e-11
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 2
Query:  401 TCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            +C + K    R+     HER H        + C++RF RSD L+ H R+HTG+KP++C +C R F RSD    H R
Sbjct:  262 SCQSKKSPGGRQCRTPPHERPHV----CPADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIR 333          

HSP 3 Score: 56.9954 bits (136), Expect = 3.168e-9
Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            + F C  C ++F R D L  H R HTGE+P  C+ C ++F RSD    H +IH
Sbjct:  311 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAKIH 363          
BLAST of early growth response-3 vs. Ensembl Medaka
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:101170128])

HSP 1 Score: 95.5153 bits (236), Expect = 1.768e-22
Identity = 46/86 (53.49%), Postives = 54/86 (62.79%), Query Frame = 2
Query:  371 SKSQNRVRQFTCNT--CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            SK+    R + C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  321 SKTPIHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRH 406          

HSP 2 Score: 62.7734 bits (151), Expect = 3.157e-11
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C + F R D L  H R HTGE+P AC+FC ++F RSD    HT+IH  +K
Sbjct:  358 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQK 414          

HSP 3 Score: 60.4622 bits (145), Expect = 1.928e-10
Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  473 ERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  327 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 380          
BLAST of early growth response-3 vs. Ensembl Medaka
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:100272164])

HSP 1 Score: 95.1301 bits (235), Expect = 1.996e-22
Identity = 42/72 (58.33%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  413 CKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  303 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAK 374          

HSP 2 Score: 62.7734 bits (151), Expect = 3.719e-11
Identity = 30/54 (55.56%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  473 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  293 ERPHACPAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 346          

HSP 3 Score: 60.4622 bits (145), Expect = 1.853e-10
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 562
            + F C  C ++F R D L  H R HTGE+P +C FC ++F RSD    H ++H  +K
Sbjct:  324 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 380          
BLAST of early growth response-3 vs. Planmine SMEST
Match: SMESG000000959.1 (SMESG000000959.1)

HSP 1 Score: 381.333 bits (978), Expect = 1.607e-136
Identity = 197/197 (100.00%), Postives = 197/197 (100.00%), Query Frame = 2
Query:   50 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPXXXXXXXXXXXXXLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 640
            MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL
Sbjct:    1 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 197          
BLAST of early growth response-3 vs. Planmine SMEST
Match: SMESG000000960.1 (SMESG000000960.1)

HSP 1 Score: 289.271 bits (739), Expect = 3.123e-100
Identity = 145/197 (73.60%), Postives = 165/197 (83.76%), Query Frame = 2
Query:   50 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPXXXXXXXXXXXXXLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 640
            MV+NIQKLTL VKIDK EF+EIQTGYTPLPGIHESFYL+NTENW+NLKTPSPMDC ++EF+ IY S++D+  +ST +         N+ KSL +I    SSPLSE S KSQ R++QFTCNTCKK+FYRRDELKRHERIHTGERPLAC+FCDKRFMRSDHLSTH RIHTGEKPY+C+ C RLF RSDERLRH RQ HL
Sbjct:    1 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKL-------NPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 186          
BLAST of early growth response-3 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 117.472 bits (293), Expect = 1.621e-31
Identity = 53/82 (64.63%), Postives = 63/82 (76.83%), Query Frame = 2
Query:  383 NRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            N  R F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH R HTGEKPY C++CS+ F RSDE+LRH R
Sbjct:  173 NIERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKR 254          
BLAST of early growth response-3 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 117.472 bits (293), Expect = 2.477e-31
Identity = 53/82 (64.63%), Postives = 63/82 (76.83%), Query Frame = 2
Query:  383 NRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            N  R F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH R HTGEKPY C++CS+ F RSDE+LRH R
Sbjct:  198 NIERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKR 279          
BLAST of early growth response-3 vs. Planmine SMEST
Match: SMESG000042500.1 (SMESG000042500.1)

HSP 1 Score: 114.39 bits (285), Expect = 1.307e-29
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 622
            + F C+TC   F RRDEL+RHE+IH+GE+PL+C +CDK F+RSDH  TH R HTGEKPY C++C + F RSDE+LRH
Sbjct:  266 KTFCCSTCDVKFTRRDELRRHEKIHSGEKPLSCPYCDKCFIRSDHRKTHIRTHTGEKPYACDICLKRFARSDEKLRH 342          

HSP 2 Score: 56.9954 bits (136), Expect = 2.467e-9
Identity = 26/53 (49.06%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  392 RQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 550
            +  +C  C K F R D  K H R HTGE+P AC+ C KRF RSD    HT+ H
Sbjct:  294 KPLSCPYCDKCFIRSDHRKTHIRTHTGEKPYACDICLKRFARSDEKLRHTKTH 346          

HSP 3 Score: 55.4546 bits (132), Expect = 7.006e-9
Identity = 25/64 (39.06%), Postives = 36/64 (56.25%), Query Frame = 2
Query:  437 DELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 628
            D+  + +++   E+   C+ CD +F R D L  H +IH+GEKP  C  C + F RSD R  H R
Sbjct:  253 DKPVKTKKVVQTEKTFCCSTCDVKFTRRDELRRHEKIHSGEKPLSCPYCDKCFIRSDHRKTHIR 316          
The following BLAST results are available for this feature:
BLAST of early growth response-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGR11.522e-2453.49early growth response 1 [Source:HGNC Symbol;Acc:HG... [more]
EGR41.104e-2355.00early growth response 4 [Source:HGNC Symbol;Acc:HG... [more]
EGR41.976e-2355.00early growth response 4 [Source:HGNC Symbol;Acc:HG... [more]
EGR21.898e-2252.27early growth response 2 [Source:HGNC Symbol;Acc:HG... [more]
EGR21.898e-2252.27early growth response 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egrh-22.974e-2654.55EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-25.225e-2654.55EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.072e-2555.17EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.373e-2555.17EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-14.150e-2452.81EGR (Early Growth factor Response factor) Homolog ... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sr2.515e-2552.33gene:FBgn0003499 transcript:FBtr0330050[more]
sr2.846e-2552.33gene:FBgn0003499 transcript:FBtr0083542[more]
sr5.755e-2552.33gene:FBgn0003499 transcript:FBtr0301615[more]
sr9.313e-2552.33gene:FBgn0003499 transcript:FBtr0344633[more]
sr9.313e-2552.33gene:FBgn0003499 transcript:FBtr0083543[more]
back to top
BLAST of early growth response-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr43.994e-2555.17early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
egr15.349e-2553.41early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr15.349e-2553.41early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr2a9.554e-2355.70early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
egr2a9.554e-2355.70early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr19.838e-2553.49early growth response 1 [Source:NCBI gene;Acc:1000... [more]
egr19.964e-2553.49early growth response 1 [Source:NCBI gene;Acc:1000... [more]
usp311.679e-2254.43ubiquitin specific peptidase 31 [Source:Xenbase;Ac... [more]
tbl1x1.929e-2252.27transducin beta like 1 X-linked [Source:Xenbase;Ac... [more]
serpinb42.414e-2258.33serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egr19.833e-2553.49early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr19.833e-2553.49early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr41.464e-2456.25early growth response 4 [Source:MGI Symbol;Acc:MGI... [more]
Egr21.161e-2252.27early growth response 2 [Source:MGI Symbol;Acc:MGI... [more]
Egr21.161e-2252.27early growth response 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of early growth response-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O73693|EGR1_TAEGU3.746e-2460.00Early growth response protein 1 (Fragment) OS=Taen... [more]
sp|P26632|EGR1_DANRE4.038e-2453.41Early growth response protein 1 OS=Danio rerio OX=... [more]
sp|A4II20|EGR1_XENTR5.212e-2453.49Early growth response protein 1 OS=Xenopus tropica... [more]
sp|Q6NTY6|EGR1B_XENLA5.735e-2452.27Early growth response protein 1-B OS=Xenopus laevi... [more]
sp|O73692|EGR1_COTJA5.925e-2460.00Early growth response protein 1 (Fragment) OS=Cotu... [more]
back to top
BLAST of early growth response-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI702.865e-13299.49Early growth response-3 OS=Schmidtea mediterranea ... [more]
G1CSV51.123e-9673.60EGR-like protein 1 OS=Schmidtea mediterranea OX=79... [more]
T1DF987.615e-8262.89Egrl-3 (Fragment) OS=Dendrocoelum lacteum OX=27895... [more]
T1E1166.382e-6854.08Egrl-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZI728.451e-2864.63Early growth response-4 OS=Schmidtea mediterranea ... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr47.204e-2751.96early growth response protein 1-B [Source:NCBI gen... [more]
egr41.715e-2554.55early growth response protein 1-B [Source:NCBI gen... [more]
egr17.829e-2553.41early growth response 1 [Source:NCBI gene;Acc:1030... [more]
egr2b8.213e-2353.49early growth response 2 [Source:NCBI gene;Acc:1030... [more]
EGR28.441e-2353.09early growth response protein 2b-like [Source:NCBI... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr42.981e-2554.02early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000006002.12.734e-2151.95pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 ... [more]
ENSPMAT00000000923.14.193e-2146.84pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 ... [more]
ENSPMAT00000007831.14.609e-2043.59pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ENSPMAT00000005225.16.443e-2041.76pep scaffold:Pmarinus_7.0:GL501320:452850:491555:1... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP14.969e-1737.65Zinc-regulated transcription factor; binds to zinc... [more]
AZF13.173e-1639.24Zinc-finger transcription factor; involved in diau... [more]
MIG11.970e-1348.65Transcription factor involved in glucose repressio... [more]
CRZ12.352e-1340.70Transcription factor, activates transcription of s... [more]
MSN44.977e-1353.70Stress-responsive transcriptional activator; activ... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491125.188e-2454.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400361.412e-1939.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491162.487e-1947.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431072.868e-1950.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297021.723e-1846.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of early growth response-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr17.424e-2553.41early growth response 1 [Source:NCBI gene;Acc:1002... [more]
ENSORLT00000034291.12.830e-2352.27early growth response protein 2b [Source:NCBI gene... [more]
ENSORLT00000000940.23.476e-2354.67early growth response protein 1 [Source:NCBI gene;... [more]
egr2b1.768e-2253.49early growth response 2 [Source:NCBI gene;Acc:1011... [more]
egr31.996e-2258.33early growth response 3 [Source:NCBI gene;Acc:1002... [more]
back to top
BLAST of early growth response-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000959.11.607e-136100.00SMESG000000959.1[more]
SMESG000000960.13.123e-10073.60SMESG000000960.1[more]
SMESG000028801.11.621e-3164.63SMESG000028801.1[more]
SMESG000028801.12.477e-3164.63SMESG000028801.1[more]
SMESG000042500.11.307e-2962.34SMESG000042500.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009224
GenBankAFJ24724.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009224 ID=SMED30009224|Name=early growth response-3|organism=Schmidtea mediterranea sexual|type=transcript|length=689bp
CTGTAACTGTACAATTATTTCACTGAATAGTGAAATATTTTGAAAAATAA
TGGTGCGTAATATACAGAAATTAACCTTAAAAGTGAAAATAGATAAATCA
GAATTTGATGAAATTCAGACTGGATATACCCCATTGCCGGGAATTCATGA
ATCGTTTTATCTAGAAAATACAGAGAATTGGAATAATTTAAAAACCCCTT
CTCCAATGGATTGCAGAGACATTGAGTTTATCCTTATTTATGGGTCTGAT
GAAGATAATAAGAGATATTCCACAATTATTCCAGATTCGTCTCAATCTGA
CACATCTAATTCTAATAAATCTCTTTGTGTGATCACAAATCGTTGTTCCA
GTCCATTGTCAGAAAACAGTTCTAAGAGTCAAAATCGAGTTCGGCAGTTT
ACGTGTAACACATGCAAAAAAGCATTTTATCGTCGGGATGAATTGAAAAG
ACATGAAAGAATTCACACTGGTGAACGTCCGTTAGCGTGCAATTTTTGCG
ATAAAAGATTTATGCGATCAGATCACTTATCAACTCACACAAGAATCCAC
ACCGGTGAGAAACCATATCGGTGCAATGTATGTTCTCGCCTTTTTGGCAG
ATCAGACGAAAGGTTGCGACATTTCAGACAAAATCATCTGTGAAAATATT
TTTTTTTGTATTTTGGAGATTTCTTCGCATATTTTACGA
back to top

protein sequence of SMED30009224-orf-1

>SMED30009224-orf-1 ID=SMED30009224-orf-1|Name=SMED30009224-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTP
SPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCS
SPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFC
DKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 145..167
e-value: 0.044
score: 22.9
coord: 117..139
e-value: 0.0015
score: 27.8
coord: 173..196
e-value: 0.19
score: 20.8
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 117..139
e-value: 2.7E-5
score: 24.4
coord: 147..167
e-value: 0.0026
score: 18.1
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 175..196
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 147..167
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 119..139
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 117..144
score: 16.976
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 173..197
score: 10.221
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 145..172
score: 15.459
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 166..197
e-value: 9.2E-10
score: 39.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 105..142
e-value: 9.1E-13
score: 49.8
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 143..165
e-value: 7.9E-14
score: 53.4
NoneNo IPR availablePANTHERPTHR24393:SF5PR DOMAIN ZINC FINGER PROTEIN 16coord: 69..195
NoneNo IPR availablePANTHERPTHR24393FAMILY NOT NAMEDcoord: 69..195
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 114..148
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 139..191