Receptor expression-enhancing protein

Overview
NameReceptor expression-enhancing protein
Smed IDSMED30009218
Length (bp)980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor expression-enhancing protein (SMED30009218) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor expression-enhancing protein (SMED30009218) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor expression-enhancing protein (SMED30009218) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor expression-enhancing protein (SMED30009218) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009218

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009218h1SMcG0013946 dd_Smed_v4_1995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009218h1SMcG0013946 dd_Smed_v4_1995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009218h1SMcG0013946 dd_Smed_v4_1995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009218h1SMcG0013946 dd_Smed_v4_1995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30009218h1SMcG0013946 dd_Smed_v4_1995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009218h1SMcG0013946 dd_Smed_v4_1995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009218h1SMcG0013946 dd_Smed_v4_1995_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP5 (receptor accessory protein 5 [Source:HGNC Symbol;Acc:HGNC:30077])

HSP 1 Score: 179.104 bits (453), Expect = 5.077e-55
Identity = 87/175 (49.71%), Postives = 124/175 (70.86%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            R++ + +L++KN  TD+LAK+E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY SIKAIE+  K+DDT+WLTYWVVY  FS+ E  +DIFLSW P Y +LKCGFL++ M P+  NG+  +Y  IIRP+ LK++S++D V+       K++ DK  ET++   KE
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVV-------KDLKDKAKETADAITKE 173          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP6 (receptor accessory protein 6 [Source:HGNC Symbol;Acc:HGNC:30078])

HSP 1 Score: 162.925 bits (411), Expect = 9.459e-49
Identity = 74/156 (47.44%), Postives = 104/156 (66.67%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSN 554
            RQ++E +L ++N  T+VL  +E K  V +  L  G + +++LYL+FGY    L NLIGFV+PAY SIKAIE+  KDDDT WLTYWVVYA F L E  +D+ LSW P Y + KC FL++ M P  WNG++ +Y  ++RP  L++   +D ++N  S 
Sbjct:    5 RQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSG 160          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP6 (receptor accessory protein 6 [Source:HGNC Symbol;Acc:HGNC:30078])

HSP 1 Score: 163.31 bits (412), Expect = 1.515e-48
Identity = 74/156 (47.44%), Postives = 104/156 (66.67%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSN 554
            RQ++E +L ++N  T+VL  +E K  V +  L  G + +++LYL+FGY    L NLIGFV+PAY SIKAIE+  KDDDT WLTYWVVYA F L E  +D+ LSW P Y + KC FL++ M P  WNG++ +Y  ++RP  L++   +D ++N  S 
Sbjct:    5 RQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSG 160          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP5 (receptor accessory protein 5 [Source:HGNC Symbol;Acc:HGNC:30077])

HSP 1 Score: 149.443 bits (376), Expect = 9.697e-44
Identity = 74/141 (52.48%), Postives = 100/141 (70.92%), Query Frame = 3
Query:  189 GLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            G+I ++ALYL+FGY    L NLIGF +PAY SIKAIE+  K+DDT+WLTYWVVY  FS+ E  +DIFLSW P Y +LKCGFL++ M P+  NG+  +Y  IIRP+ LK++S++D V+       K++ DK  ET++   KE
Sbjct:   31 GVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVV-------KDLKDKAKETADAITKE 164          
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Match: REEP5 (receptor accessory protein 5 [Source:HGNC Symbol;Acc:HGNC:30077])

HSP 1 Score: 137.117 bits (344), Expect = 1.509e-39
Identity = 62/112 (55.36%), Postives = 84/112 (75.00%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLK 422
            R++ + +L++KN  TD+LAK+E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY SIKAIE+  K+DDT+WLTYWVVY  FS+ E  +DIFLSW P Y +LK
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLK 117          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: yop-1 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:Q9N4G8])

HSP 1 Score: 120.168 bits (300), Expect = 8.884e-33
Identity = 62/160 (38.75%), Postives = 104/160 (65.00%), Query Frame = 3
Query:  108 LNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGE 587
            L++ +  T+VLA +E K  V R++L +G++ + ALYLIFG++   + N +GFV+PAY SIKAIE++ K+DDT+WLTYWV++A  S+VE  +   ++  P+Y L K  FL+YL +P+ + G+  +Y+  ++P   ++   ID    +  NF+  +    G+
Sbjct:   18 LHEPSTVTNVLATVEQKTGVKRLHLVLGVVGLQALYLIFGHSAQLVCNFMGFVYPAYMSIKAIESSNKEDDTQWLTYWVIFAILSVVEFFSVQIVAVFPVYWLFKSIFLLYLYLPS-FLGAAKLYHRFVKPVAARHSGSIDA---KIGNFADRVNSAAGK 173          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: T03F6.6 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:Q8WQD3])

HSP 1 Score: 94.7449 bits (234), Expect = 5.674e-23
Identity = 45/117 (38.46%), Postives = 69/117 (58.97%), Query Frame = 3
Query:  102 IYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVP 452
            +Y +    + + + K+E+   + R  L  GLI +  +Y+I G    F+ NLIG  +PAY S+KAI T   DDDT WL YW V+ AFS+++      +S+ P+Y + K  FL+YL +P
Sbjct:   33 LYADHGPFYKENVKKLEDATGLKREMLAYGLIGLNCVYMIIGSGAEFVCNLIGVAYPAYVSVKAIRTEGTDDDTMWLIYWTVFGAFSIIDFFAASIMSYFPIYWVAKAAFLLYLYLP 149          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: T03F6.6 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:Q8WQD3])

HSP 1 Score: 94.7449 bits (234), Expect = 5.674e-23
Identity = 45/117 (38.46%), Postives = 69/117 (58.97%), Query Frame = 3
Query:  102 IYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVP 452
            +Y +    + + + K+E+   + R  L  GLI +  +Y+I G    F+ NLIG  +PAY S+KAI T   DDDT WL YW V+ AFS+++      +S+ P+Y + K  FL+YL +P
Sbjct:   33 LYADHGPFYKENVKKLEDATGLKREMLAYGLIGLNCVYMIIGSGAEFVCNLIGVAYPAYVSVKAIRTEGTDDDTMWLIYWTVFGAFSIIDFFAASIMSYFPIYWVAKAAFLLYLYLP 149          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: F56B3.6 (Receptor expression-enhancing protein [Source:UniProtKB/TrEMBL;Acc:O45108])

HSP 1 Score: 88.5817 bits (218), Expect = 1.160e-20
Identity = 52/141 (36.88%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  132 DVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSN 554
            D+           R +L      +IA +L+FG     L NLIGF +P Y S+KAI +   DDDT WL YW  +A   LV+  ++  LSW P Y + K  FLVYL +P +  GS+  Y +I+ P V+     +D+     SN
Sbjct:   66 DMAMMYAESAGFKRDHLSYAAFGLIAFFLVFGSVARLLCNLIGFGYPTYASVKAIRSPGGDDDTVWLIYWTCFAVLYLVDFFSEAILSWFPFYYIAKACFLVYLYLP-QTQGSVMFYETIVDPLVIFVDKNLDKFYYNRSN 205          
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Match: T19C3.4 (pep chromosome:WBcel235:III:618246:620254:-1 gene:WBGene00020562.1 transcript:T19C3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T19C3.4)

HSP 1 Score: 64.3142 bits (155), Expect = 7.810e-12
Identity = 38/124 (30.65%), Postives = 69/124 (55.65%), Query Frame = 3
Query:  258 GFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLS-WIPLYALLKCGFLVYLMVPAKWN-GXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLD 623
            G ++PAY S KA+ T    +  KW+ YW+V+A +S +E++ D+ L+ W P Y  LK  F+ +L+ P  W  G+  +Y   + P + +++  ID +L    + S   + ++G  S  + K+ V +
Sbjct:   14 GTLYPAYRSYKAVRTKDTREYVKWMMYWIVFAIYSFLENLLDLVLAFWFPFYFQLKIVFIFWLLSP--WTKGASILYRKWVHPTLNRHEKDIDALLESAKSESYNQLMRIGSKSLVYAKDVVAE 135          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: ReepB (gene:FBgn0033906 transcript:FBtr0087525)

HSP 1 Score: 132.109 bits (331), Expect = 3.212e-37
Identity = 65/157 (41.40%), Postives = 98/157 (62.42%), Query Frame = 3
Query:   78 NTYRQKLEIYL-NKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQ 545
            N Y+  +   L +    +T V   +E K  V RVN+ +G + + A+YLIFG+    L N+IG ++PAY SI AIE++ K DDTKWL YWV +  F+++E  + +  S IP Y LLKC FL++ M+P + NGS  IY  ++RPY LK+   +D +++ 
Sbjct:   10 NGYKDDVSKSLRDASKPWTKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDD 166          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: ReepB (gene:FBgn0033906 transcript:FBtr0302453)

HSP 1 Score: 132.109 bits (331), Expect = 3.212e-37
Identity = 65/157 (41.40%), Postives = 98/157 (62.42%), Query Frame = 3
Query:   78 NTYRQKLEIYL-NKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQ 545
            N Y+  +   L +    +T V   +E K  V RVN+ +G + + A+YLIFG+    L N+IG ++PAY SI AIE++ K DDTKWL YWV +  F+++E  + +  S IP Y LLKC FL++ M+P + NGS  IY  ++RPY LK+   +D +++ 
Sbjct:   10 NGYKDDVSKSLRDASKPWTKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDD 166          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: CG4960 (gene:FBgn0039371 transcript:FBtr0346108)

HSP 1 Score: 123.635 bits (309), Expect = 5.101e-34
Identity = 62/153 (40.52%), Postives = 92/153 (60.13%), Query Frame = 3
Query:   75 YNTYRQKLEIYL-NKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKID 530
            +N Y+Q +   L +    +T     +E K  V RVN+ +G I+  A YL+FG+    L N+IG ++PAY SI  IE++ K DD +WL YWV +  F+++E    +  S IP Y LLKC FL++ M+P + NGS  IY+ ++RPY LK    +D
Sbjct:   12 FNGYKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVD 164          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: CG4960 (gene:FBgn0039371 transcript:FBtr0084919)

HSP 1 Score: 123.635 bits (309), Expect = 5.101e-34
Identity = 62/153 (40.52%), Postives = 92/153 (60.13%), Query Frame = 3
Query:   75 YNTYRQKLEIYL-NKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKID 530
            +N Y+Q +   L +    +T     +E K  V RVN+ +G I+  A YL+FG+    L N+IG ++PAY SI  IE++ K DD +WL YWV +  F+++E    +  S IP Y LLKC FL++ M+P + NGS  IY+ ++RPY LK    +D
Sbjct:   12 FNGYKQDINRSLRDASKPWTKAFDSLEEKTGVERVNIFVGSILFCAFYLVFGWCAQLLCNIIGVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLIWCMLPTERNGSTLIYHKLVRPYFLKLHDPVD 164          
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Match: ReepB (gene:FBgn0033906 transcript:FBtr0302451)

HSP 1 Score: 121.709 bits (304), Expect = 1.886e-33
Identity = 59/133 (44.36%), Postives = 87/133 (65.41%), Query Frame = 3
Query:  144 KIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLN 542
            +    V+V  V L IG + + A+YLIFG+    L N+IG ++PAY SI AIE++ K DDTKWL YWV +  F+++E  + +  S IP Y LLKC FL++ M+P + NGS  IY  ++RPY LK+   +D +++
Sbjct:   15 ETRRNVRVPLVYLGIGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIID 147          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep5 (receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9181])

HSP 1 Score: 173.711 bits (439), Expect = 4.823e-53
Identity = 89/170 (52.35%), Postives = 116/170 (68.24%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSE 596
            +Q+ +  L++KN  TD+LAKIE K  V+R  +   +I  IA+YL+ GY    L NLIGFV+PAY SIKAIE+  KDDDTKWLTYWVVY  FS+VE   DIFLSW P Y L KC FLV+ M P   NGSI +Y  IIRP+ LKN++KID V+   ++ +    DK+ + ++
Sbjct:    6 KQRFDNALHEKNMVTDLLAKIEAKTGVNRSYIAYAVIAFIAIYLVIGYGASLLCNLIGFVYPAYISIKAIESPAKDDDTKWLTYWVVYGVFSVVEFFADIFLSWFPFYFLAKCAFLVWCMAPTPSNGSIMLYTRIIRPFFLKNEAKIDNVMKDLTDKAAGAADKIKDEAK 175          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: zgc:101744 (zgc:101744 [Source:ZFIN;Acc:ZDB-GENE-050320-111])

HSP 1 Score: 162.155 bits (409), Expect = 1.224e-48
Identity = 85/188 (45.21%), Postives = 115/188 (61.17%), Query Frame = 3
Query:   78 NTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSDE 641
            NT  ++ + +  +KN  TD LA +E K  V +  +  G++ ++A YLIFGY    L NLIGF++PAY SIKAIE+  K+DDTKWLTYWVVY  FS+ E  +DIFL W P Y   KC FL++ M P  WNGS  IY  ++RP+ LK+++  D V++  S        K    +ET  KE  L  L SD+
Sbjct:    3 NTVTERYDAFFKQKNVLTDFLAVLEEKTGVQKQYIAAGVVSIVAFYLIFGYGASLLCNLIGFIYPAYASIKAIESNNKEDDTKWLTYWVVYGLFSVAEFFSDIFLFWFPFYYAGKCLFLLWCMAPISWNGSQVIYTRVVRPFFLKHEAAFDNVVSDLSG-------KAKSAAETMAKEG-LTLLNSDK 182          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:447918])

HSP 1 Score: 155.606 bits (392), Expect = 7.200e-46
Identity = 77/185 (41.62%), Postives = 115/185 (62.16%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVG-ETSETFVKERVLDNLKSD 638
            + ++E +LN+KN  TD L KIE K  + +  L  G   V   +L+ GY    + NLIGFV+PAY+SIKAIE+  K+DDT+WLTYWV+Y  FS+ E  +DIFL W P Y + KC FL++ M P  WNGS  +Y  ++RP+ LK+++ +D +++  S  +    + V  E   T V+ R +   +S+
Sbjct:    9 KDRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICNLIGFVYPAYFSIKAIESPGKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCMAPVSWNGSQVLYRHVVRPFFLKHEAAVDGMVSNISVKAMSAAENVTREVLHTLVRNRTVGPAESE 193          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:447918])

HSP 1 Score: 155.606 bits (392), Expect = 7.200e-46
Identity = 77/185 (41.62%), Postives = 115/185 (62.16%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVG-ETSETFVKERVLDNLKSD 638
            + ++E +LN+KN  TD L KIE K  + +  L  G   V   +L+ GY    + NLIGFV+PAY+SIKAIE+  K+DDT+WLTYWV+Y  FS+ E  +DIFL W P Y + KC FL++ M P  WNGS  +Y  ++RP+ LK+++ +D +++  S  +    + V  E   T V+ R +   +S+
Sbjct:    9 KDRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICNLIGFVYPAYFSIKAIESPGKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCMAPVSWNGSQVLYRHVVRPFFLKHEAAVDGMVSNISVKAMSAAENVTREVLHTLVRNRTVGPAESE 193          
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:447918])

HSP 1 Score: 155.606 bits (392), Expect = 7.200e-46
Identity = 77/185 (41.62%), Postives = 115/185 (62.16%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVG-ETSETFVKERVLDNLKSD 638
            + ++E +LN+KN  TD L KIE K  + +  L  G   V   +L+ GY    + NLIGFV+PAY+SIKAIE+  K+DDT+WLTYWV+Y  FS+ E  +DIFL W P Y + KC FL++ M P  WNGS  +Y  ++RP+ LK+++ +D +++  S  +    + V  E   T V+ R +   +S+
Sbjct:    9 KDRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICNLIGFVYPAYFSIKAIESPGKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCMAPVSWNGSQVLYRHVVRPFFLKHEAAVDGMVSNISVKAMSAAENVTREVLHTLVRNRTVGPAESE 193          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep5 (receptor accessory protein 5 [Source:NCBI gene;Acc:496723])

HSP 1 Score: 174.096 bits (440), Expect = 4.465e-53
Identity = 89/187 (47.59%), Postives = 124/187 (66.31%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE--RVLDNLKSDE 641
            +   E +L++KN  TDVL KIE K  V+R  + + +I ++A+YL+ GY    L NLIGF +PAY SIKAIE+  KDDDT+WLTYWVVY  FS++E   DIFLSW P Y ++KCGFL++ M P+  NG+  IY  I+RP+ LK++ ++D ++       K+I DK  ET++T  KE  +   NL  DE
Sbjct:    6 KDSFEKFLHQKNVCTDVLEKIEAKTGVNRRYIALAIIGIVAIYLVIGYGASLLCNLIGFAYPAYVSIKAIESATKDDDTQWLTYWVVYGIFSIIEFFADIFLSWFPFYYMIKCGFLLWCMSPSPSNGATLIYKRIVRPFFLKHEGEMDRLV-------KDIKDKASETADTITKEAKKATVNLLGDE 185          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep5 (receptor accessory protein 5 [Source:NCBI gene;Acc:496723])

HSP 1 Score: 172.555 bits (436), Expect = 1.811e-52
Identity = 85/175 (48.57%), Postives = 119/175 (68.00%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            +   E +L++KN  TDVL KIE K  V+R  + + +I ++A+YL+ GY    L NLIGF +PAY SIKAIE+  KDDDT+WLTYWVVY  FS++E   DIFLSW P Y ++KCGFL++ M P+  NG+  IY  I+RP+ LK++ ++D ++       K+I DK  ET++T  KE
Sbjct:    6 KDSFEKFLHQKNVCTDVLEKIEAKTGVNRRYIALAIIGIVAIYLVIGYGASLLCNLIGFAYPAYVSIKAIESATKDDDTQWLTYWVVYGIFSIIEFFADIFLSWFPFYYMIKCGFLLWCMSPSPSNGATLIYKRIVRPFFLKHEGEMDRLV-------KDIKDKASETADTITKE 173          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:548805])

HSP 1 Score: 150.214 bits (378), Expect = 1.186e-43
Identity = 79/191 (41.36%), Postives = 109/191 (57.07%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEV--------LNQTSNFSKEIIDKVGETSETFVKERVLDNLKS 635
            +++L+ +LN  N  + +L K E K  + +  L  G I  + LYLIFGY    + NLIGFV+PAY S+KAIE+  K DDT WLTYWVVY  FS+VE  +DIFL W P Y L KC FL++ M P  WNGS  +Y   IRP+ LK+   +D V        LN   + ++ ++  +  +     +E     L S
Sbjct:    5 KERLQNFLNGDNFVSRLLGKAEEKTGIKKYYLASGSICSLGLYLIFGYGASLVCNLIGFVYPAYVSVKAIESPDKKDDTIWLTYWVVYGVFSVVEFFSDIFLFWFPFYYLGKCCFLLWCMAPFSWNGSQILYDRFIRPFFLKHHRTVDSVVSDLGGQALNTAESVTRGVLHTLTSSRTLLAREGGQQALPS 195          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: reep6 (receptor accessory protein 6 [Source:NCBI gene;Acc:548805])

HSP 1 Score: 149.443 bits (376), Expect = 1.680e-43
Identity = 74/153 (48.37%), Postives = 98/153 (64.05%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQ 545
            +++L+ +LN  N  + +L K E K  + +  L  G I  + LYLIFGY    + NLIGFV+PAY S+KAIE+  K DDT WLTYWVVY  FS+VE  +DIFL W P Y L KC FL++ M P  WNGS  +Y   IRP+ LK+   +D V++ 
Sbjct:    5 KERLQNFLNGDNFVSRLLGKAEEKTGIKKYYLASGSICSLGLYLIFGYGASLVCNLIGFVYPAYVSVKAIESPDKKDDTIWLTYWVVYGVFSVVEFFSDIFLFWFPFYYLGKCCFLLWCMAPFSWNGSQILYDRFIRPFFLKHHRTVDSVVSD 157          
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Match: teddm1 (transmembrane epididymal protein 1 [Source:Xenbase;Acc:XB-GENE-6462916])

HSP 1 Score: 75.8702 bits (185), Expect = 3.138e-15
Identity = 41/112 (36.61%), Postives = 67/112 (59.82%), Query Frame = 3
Query:  252 LIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGE 587
            + G ++PAY S KA++T    +  KW+ YW+V+A F+  E++TDI LSW P Y  LK  F+++L+ P    GS  +Y   + P +   + +IDE + Q  + S E + +VG+
Sbjct:   13 IFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIILSWFPFYFELKIAFVIWLLSPYT-KGSSVLYRKFVHPTLSSKEKEIDEYIAQARDKSYETMMRVGK 123          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep5 (receptor accessory protein 5 [Source:MGI Symbol;Acc:MGI:1270152])

HSP 1 Score: 179.104 bits (453), Expect = 3.719e-55
Identity = 90/187 (48.13%), Postives = 128/187 (68.45%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE--RVLDNLKSDE 641
            R++ + +L++KN  TD+LAK+E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY S+KAIE+  KDDDT+WLTYWVVY  FS+ E  +D+FLSW P Y +LKCGFL++ M P+  NG+  +Y  IIRP  LK++S++D V+       K++ DK  ET++   KE  +   NL  DE
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLKHESQVDSVV-------KDVKDKAKETADAISKEVKKATVNLLGDE 185          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep6 (receptor accessory protein 6 [Source:MGI Symbol;Acc:MGI:1917585])

HSP 1 Score: 128.257 bits (321), Expect = 1.017e-35
Identity = 72/156 (46.15%), Postives = 100/156 (64.10%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSN 554
            RQ+ E +L +KN  T+ L  +E +  V +  L  G + ++ LYL+FGY    L N+IGFV+PAY S+KAIE+  K+DDT WLTYWVVYA F LVE  +D+ L W P Y   KC FL++ M P  WNG++ +Y+ +IRP  LK+   +D   +Q S 
Sbjct:    5 RQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSG 160          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep6 (receptor accessory protein 6 [Source:MGI Symbol;Acc:MGI:1917585])

HSP 1 Score: 128.257 bits (321), Expect = 2.101e-35
Identity = 72/159 (45.28%), Postives = 101/159 (63.52%), Query Frame = 3
Query:   78 NTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSN 554
            +  RQ+ E +L +KN  T+ L  +E +  V +  L  G + ++ LYL+FGY    L N+IGFV+PAY S+KAIE+  K+DDT WLTYWVVYA F LVE  +D+ L W P Y   KC FL++ M P  WNG++ +Y+ +IRP  LK+   +D   +Q S 
Sbjct:    2 DGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSG 160          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep6 (receptor accessory protein 6 [Source:MGI Symbol;Acc:MGI:1917585])

HSP 1 Score: 128.257 bits (321), Expect = 2.101e-35
Identity = 72/159 (45.28%), Postives = 101/159 (63.52%), Query Frame = 3
Query:   78 NTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSN 554
            +  RQ+ E +L +KN  T+ L  +E +  V +  L  G + ++ LYL+FGY    L N+IGFV+PAY S+KAIE+  K+DDT WLTYWVVYA F LVE  +D+ L W P Y   KC FL++ M P  WNG++ +Y+ +IRP  LK+   +D   +Q S 
Sbjct:    2 DGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSG 160          
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Match: Reep5 (receptor accessory protein 5 [Source:MGI Symbol;Acc:MGI:1270152])

HSP 1 Score: 107.071 bits (266), Expect = 2.419e-28
Identity = 55/113 (48.67%), Postives = 73/113 (64.60%), Query Frame = 3
Query:   96 LEIYLNKKNAFTDVLAKIENKVKVSRVNL----CIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLK 422
            +  +L    AF +V  KI   +  +R +       G+I ++ALYL+FGY    L NLIGF +PAY S+KAIE+  KDDDT+WLTYWVVY  FS+ E  +D+FLSW P Y +LK
Sbjct:    9 VHTHLPGNCAFREV--KIATSLVAARKHFPSLRSQGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLK 119          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q29RM3|REEP5_BOVIN (Receptor expression-enhancing protein 5 OS=Bos taurus OX=9913 GN=REEP5 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.886e-55
Identity = 89/175 (50.86%), Postives = 125/175 (71.43%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            RQ+ + +L++KN  TD+LAK E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY SIKAIE+  K+DDT+WLTYWVVY  FS+VE  +D+FLSW P Y +LKCGFL++ M P+  NG+  +Y  IIRP+ LK++S++D V+N       ++ DK  ET++T  KE
Sbjct:    6 RQRFDQFLHQKNCMTDLLAKTEAKTGVNRSFIALGVIGLLALYLVFGYGASLLCNLIGFGYPAYVSIKAIESPNKEDDTQWLTYWVVYGVFSIVEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPANGADLLYKRIIRPFFLKHESQVDNVVN-------DLKDKAKETADTISKE 173          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q5RE33|REEP5_PONAB (Receptor expression-enhancing protein 5 OS=Pongo abelii OX=9601 GN=REEP5 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.822e-54
Identity = 87/175 (49.71%), Postives = 124/175 (70.86%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            R++ + +L++KN  TD+LAK+E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY SIKAIE+  K+DDT+WLTYWVVY  FS+ E  +DIFLSW P Y +LKCGFL++ M P+  NG+  +Y  IIRP+ LK++S++D V+       K++ DK  ET++   KE
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQVDSVV-------KDLKDKAKETADAITKE 173          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q00765|REEP5_HUMAN (Receptor expression-enhancing protein 5 OS=Homo sapiens OX=9606 GN=REEP5 PE=1 SV=3)

HSP 1 Score: 179.104 bits (453), Expect = 2.438e-54
Identity = 87/175 (49.71%), Postives = 124/175 (70.86%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            R++ + +L++KN  TD+LAK+E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY SIKAIE+  K+DDT+WLTYWVVY  FS+ E  +DIFLSW P Y +LKCGFL++ M P+  NG+  +Y  IIRP+ LK++S++D V+       K++ DK  ET++   KE
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVV-------KDLKDKAKETADAITKE 173          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|B2RZ37|REEP5_RAT (Receptor expression-enhancing protein 5 OS=Rattus norvegicus OX=10116 GN=Reep5 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 4.050e-54
Identity = 89/187 (47.59%), Postives = 128/187 (68.45%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE--RVLDNLKSDE 641
            R++ + +L++KN  TD+LAK+E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY S+KAIE+  KDDDT+WLTYWVVY  FS+ E  +D+FLSW P Y +LKCGFL++ M P+  NG+  +Y  +IRP  LK++S++D V+       K++ DK  ET++   KE  +   NL  DE
Sbjct:    6 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYRRVIRPIFLKHESQVDSVV-------KDVKDKAKETADAISKEVKKATVNLLGDE 185          
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Match: sp|Q60870|REEP5_MOUSE (Receptor expression-enhancing protein 5 OS=Mus musculus OX=10090 GN=Reep5 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 9.857e-54
Identity = 85/175 (48.57%), Postives = 124/175 (70.86%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            R++ + +L++KN  TD+LAK+E K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY S+KAIE+  KDDDT+WLTYWVVY  FS+ E  +D+FLSW+P Y +LKCGFL++ M P+  NG+  +Y  IIRP  L+++S++D V+       K++ DK  ET++   KE
Sbjct:    2 RERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWLPFYYMLKCGFLLWCMAPSPANGAEMLYRRIIRPIFLRHESQVDSVV-------KDVKDKAKETADAISKE 169          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: R7UL64 (Receptor expression-enhancing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_20933 PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.399e-59
Identity = 95/169 (56.21%), Postives = 127/169 (75.15%), Query Frame = 3
Query:   78 NTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVG 584
              ++ KL+  L++KNAFTD+L K+E K  V R+ L +GL   +ALYL+ GY   FL N +GF++PAY S+KAIE+  KDDDTKWLTYWVVY+ FSLVE  TDIFL WIP Y LLKC FL+Y MVP  WNGSI IY  +IRP++LK+Q+K+DE L++ +  ++E++D+V 
Sbjct:    6 EAFKAKLDKALHEKNAFTDILEKVEAKTNVRRLYLVMGLAAFLALYLMVGYGAQFLCNFLGFLYPAYASVKAIESKGKDDDTKWLTYWVVYSGFSLVEFFTDIFLFWIPFYWLLKCVFLLYCMVPTSWNGSIMIYNKVIRPFILKHQAKVDEALDKAAGVAQEVLDEVS 174          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: A0A2H1C4Z4 (Receptor expression-enhancing protein OS=Fasciola hepatica OX=6192 GN=D915_10483 PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.661e-57
Identity = 93/167 (55.69%), Postives = 126/167 (75.45%), Query Frame = 3
Query:   66 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKE 566
            M+   ++R  L+  L++KNAF D+LAK E K+KVSRVN+ +GL+  IALYLIFGY   FLA+LIGF++PAY SIKA+ET +K+DDTKWLTYWVV+A+ S+VE+ TDIF  WIPLY+LLKC   ++LM P   NGSI  Y  +IRPY+LK++ K+D+     S+ + +
Sbjct:    1 MDKVRSWRSSLDESLHRKNAFNDLLAKAEEKIKVSRVNIVLGLVAFIALYLIFGYGTSFLASLIGFIYPAYKSIKALETHEKEDDTKWLTYWVVFASVSIVEAFTDIFFFWIPLYSLLKCVVFLFLMAPTSPNGSILFYEKVIRPYILKHEKKLDQAFEAASDLAGD 167          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: V4BCB5 (Receptor expression-enhancing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_149167 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.018e-56
Identity = 98/187 (52.41%), Postives = 131/187 (70.05%), Query Frame = 3
Query:   78 NTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSD 638
             T++ KLE +L++KNAFT++L K+E K  V R+    G++V++ALYL+ GY   FL N IGF++PAY S KAIE+T+KDDDT+WLTYWVVY AFSLVE   DIFL WIP Y LLKC FLV+ MVPA  NGS  IY  +IRP+VL++Q KID+ L++  +  KE  +   +        RV+++ K D
Sbjct:   10 ETWKAKLEKFLHEKNAFTNLLEKMEQKTGVKRIYFAFGIVVLLALYLMIGYGAQFLCNFIGFLYPAYASFKAIESTKKDDDTQWLTYWVVYGAFSLVEFFADIFLFWIPFYWLLKCIFLVWCMVPAPCNGSDTIYNKVIRPFVLRHQDKIDKALDEAKDAMKEAQEAGQDMLTDEAVRRVVNDAKLD 196          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: F7D9H0 (Receptor expression-enhancing protein OS=Monodelphis domestica OX=13616 GN=REEP5 PE=3 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.154e-55
Identity = 94/189 (49.74%), Postives = 131/189 (69.31%), Query Frame = 3
Query:   81 TYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE--RVLDNLKSDE 641
            T +Q+ E +L++KN  TD+LAKIE+K  V+R  + +G+I ++ALYL+FGY    L NLIGF +PAY SIKAIE+  KDDDT+WLTYWVVY  FS+ E  +D+FLSW P Y +LKCGFL++ M P+  NG+  +Y  +IRP+ LK+QS++D V+       K++ DK  ET++   KE  +   NL  DE
Sbjct:    4 TLKQRFEQFLHQKNCMTDLLAKIESKTGVNRAYVALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPSNGAEMLYRRLIRPFFLKHQSQMDSVV-------KDLKDKAKETADALAKEAKKATVNLLGDE 185          
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Match: A0A0X3PP64 (Receptor expression-enhancing protein OS=Schistocephalus solidus OX=70667 GN=REEP6 PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.526e-55
Identity = 97/192 (50.52%), Postives = 135/192 (70.31%), Query Frame = 3
Query:   66 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDN-LKSD 638
            M  +   + +L+  LN+KNAFTDVL KIE+K KV ++   + +  ++ALYL+ GY   FLANLIGF++PAY+SIKAIE+  KDDDTKWLTYWVVYA FSL+E  TDI L WIPLYA +KC FLV+LMVP   NGS  +Y ++I+P V K + +ID+ +++  +F+K+   +         K+ ++D+ LKSD
Sbjct:    1 MNSFIDLKDQLQKKLNEKNAFTDVLGKIEDKTKVPKIYQVLAIAAIVALYLMVGYGATFLANLIGFLYPAYYSIKAIESPAKDDDTKWLTYWVVYAFFSLIEFFTDIILFWIPLYAFMKCMFLVFLMVPGPLNGSCMLYNNVIQPIVSKYEKRIDDCMDEAGDFAKKATKR--------AKDAMIDSALKSD 184          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: reep5 (receptor accessory protein 5 [Source:NCBI gene;Acc:103047111])

HSP 1 Score: 177.948 bits (450), Expect = 7.715e-55
Identity = 90/183 (49.18%), Postives = 121/183 (66.12%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKS 635
            +++ E +L +KN  TDVL KIE K  VSR  + + +I +IA+YL+ GY    L NLIGFV+PAY SIKAIE+T KDDDTKWLTYWVVY  FS+ E   DIFLSW P Y + KC FLV+ M P   NGSI IY  IIRP+ L+N++KID+V+      + +  DK+ + ++      + +  K+
Sbjct:    6 KERFERFLYEKNMMTDVLGKIEAKTGVSRTYIALAVIALIAIYLVVGYGASLLCNLIGFVYPAYISIKAIESTDKDDDTKWLTYWVVYGVFSVAEFFADIFLSWFPFYYIGKCAFLVWCMAPTPANGSIMIYTRIIRPFFLRNEAKIDDVVKDIKGKASDAADKIRDEAKKATANLIFEEKKT 188          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: reep6 (receptor expression-enhancing protein 6 [Source:NCBI gene;Acc:103040819])

HSP 1 Score: 162.925 bits (411), Expect = 1.085e-48
Identity = 80/185 (43.24%), Postives = 117/185 (63.24%), Query Frame = 3
Query:   66 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVG-ETSETFVKERV 617
            +  +   + ++E +LN+KN  TD L KIE K  + +  L IG + V  LYL+FGY    L NLIGFV+PAY+SIKAIE+  K+DDT+WLTYWVVY  F + E  +DIFL W P Y + KC FL++ M P  WNGS  +Y  ++RP+ LK+++ +D +++  S  +    + V  E  ++  K R+
Sbjct:    2 LSIFTKIKTRVEAFLNEKNIVTDCLNKIEEKTGIKKRYLAIGAVSVTGLYLLFGYGASLLCNLIGFVYPAYFSIKAIESPNKEDDTQWLTYWVVYGFFGVGEFFSDIFLYWFPFYYVFKCLFLLWCMAPFSWNGSQVLYNHLVRPFFLKHEATVDNMVSDLSGKAMNAAESVTREVIQSLAKNRI 186          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054484.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000334.1:571283:578213:-1 gene:ENSAMXG00000033021.1 transcript:ENSAMXT00000054484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 3.885e-25
Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 3
Query:  282 SIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVK 608
            SIKAIE+  K+DDT+WLTYWVVY  FS+ E  +DIFL W P Y   KC FL++ M P  WNGS  IY  ++RP+ LK+++  D V+   S  +K     V +  + F+ 
Sbjct:   50 SIKAIESRNKEDDTQWLTYWVVYGLFSVAEFFSDIFLFWFPFYYAGKCVFLLWCMAPVTWNGSQIIYTRLVRPFFLKHEAAFDSVVKDLSGKAKSAAQSVVKEGKAFMS 158          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041103.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000334.1:568138:578213:-1 gene:ENSAMXG00000033021.1 transcript:ENSAMXT00000041103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 7.997e-25
Identity = 50/108 (46.30%), Postives = 68/108 (62.96%), Query Frame = 3
Query:  282 SIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFV 605
            SIKAIE+  K+DDT+WLTYWVVY  FS+ E  +DIFL W P Y   KC FL++ M P  WNGS  IY  ++RP+ LK+++  D V+   S  +K     V +  + F+
Sbjct:   50 SIKAIESRNKEDDTQWLTYWVVYGLFSVAEFFSDIFLFWFPFYYAGKCVFLLWCMAPVTWNGSQIIYTRLVRPFFLKHEAAFDSVVKDLSGKAKSAAQSVVKEGKAFM 157          
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Match: reep2 (receptor accessory protein 2 [Source:NCBI gene;Acc:103039959])

HSP 1 Score: 78.9518 bits (193), Expect = 1.928e-16
Identity = 40/110 (36.36%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  258 GFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGE 587
            G ++PAY S KA++T    +  KW+ YW+V+A FS  E++TD+ LSW P Y  LK  F+++L+ P    GS  +Y   + P +   + +IDE + Q  + S E + + G+
Sbjct:   15 GTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFALFSTAETITDMLLSWFPFYFELKIAFVIWLLSPYT-KGSSVLYRKFVHPTLSNKEKEIDEYITQAKDRSYETMMRFGK 123          
BLAST of Receptor expression-enhancing protein vs. Ensembl Sea Lamprey
Match: reep5 (receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9181])

HSP 1 Score: 160.614 bits (405), Expect = 8.666e-49
Identity = 78/165 (47.27%), Postives = 110/165 (66.67%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKV 581
            ++  + ++ +KN FT+ L  +E K  VS+  L +GL V I +YLI GY    L N IGF++PAY+SIKAIE+  KDDDT+WL YWVVY  F +VE  +DIFL W+P Y  +KC FLV+ M P K+NG+  IY  +IRP+ LK++ K+D++ N     +KE  D +
Sbjct:    5 KEMFDNFVKEKNVFTEALDLVEKKTGVSKSILALGLSVFIGIYLIVGYGASLLCNFIGFLYPAYYSIKAIESVNKDDDTQWLIYWVVYGFFCVVEFFSDIFLYWVPFYYFIKCVFLVWCMAPVKYNGAQKIYTLLIRPWFLKHEGKLDDIANNLGKKAKEAADAI 169          
BLAST of Receptor expression-enhancing protein vs. Ensembl Sea Lamprey
Match: reep2 (receptor accessory protein 2 [Source:NCBI gene;Acc:568927])

HSP 1 Score: 57.7658 bits (138), Expect = 3.206e-10
Identity = 31/88 (35.23%), Postives = 49/88 (55.68%), Query Frame = 3
Query:  324 KWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGE 587
            +W+ YW+V+A F+  E+ TD+ LSWIP Y  LK   +V+L+ P    GS  +Y   + P +   + +IDE + Q    S E + + G 
Sbjct:    2 RWMMYWIVFALFTTFETFTDLLLSWIPFYYELKIALVVWLLSPYT-KGSSVLYRKFVHPMLSSREQEIDEYIVQAKEKSYETMVRFGR 88          
BLAST of Receptor expression-enhancing protein vs. Ensembl Yeast
Match: YOP1 (Reticulon-interacting protein; ER integral membrane protein involved in the generation of tubular ER morphology; promotes membrane curvature; forms tubules in vitro; regulates the ER asymmetry-induced inheritance block during ER stress; role in ER-derived peroxisomal biogenesis; interacts with Yip1p to mediate membrane traffic and with Sey1p to maintain ER morphology; facilitates lipid exchange between the ER and mitochondria; forms ER foci upon DNA replication stress [Source:SGD;Acc:S000006232])

HSP 1 Score: 78.9518 bits (193), Expect = 4.096e-18
Identity = 54/159 (33.96%), Postives = 88/159 (55.35%), Query Frame = 3
Query:  111 NKKNAFTDVLAKIENKVKVSRVNLCIGL--IVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRP----YVLKNQSKI--DEVLNQTSNFSK 563
            + K +   +L ++ENK  + +  L  GL    ++ +++  G  G  L+N  GFV PAY S+ A++T    DDT+ LTYW+V++  S++E  +   L  IP Y  LK  FL+Y+ +P +  G+  IY  I+ P    Y+L++ SK   DE+    +  SK
Sbjct:   16 DTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFLIYIALP-QTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASK 173          
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Match: EDO32055 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW66])

HSP 1 Score: 152.91 bits (385), Expect = 1.758e-45
Identity = 85/177 (48.02%), Postives = 118/177 (66.67%), Query Frame = 3
Query:   81 TYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKE 611
            T  + LE +L +KN FTD L K+E K KV ++ L +GL+ V +LYLIFGY    +  ++GF +PAY S+KA+E+ QKDDDT+WL YWVV+A+F++VE  +DI LSW PLY L K  FL + M P  WNGS  +Y  +I+P+VL++QS+ID  L           +KVGE  + + KE
Sbjct:   10 TGLENLENWLEEKNYFTDALGKVEEKTKVKKLYLFLGLVGVFSLYLIFGYGADLIVTVLGFAYPAYQSVKAVESVQKDDDTQWLIYWVVFASFNIVEFFSDILLSWFPLYFLTKLIFLGWCMAPVSWNGSDTLYQKVIKPFVLRHQSQIDSTL-----------EKVGEKMDKYAKE 175          
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Match: EDO46781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP23])

HSP 1 Score: 109.383 bits (272), Expect = 2.078e-28
Identity = 56/167 (33.53%), Postives = 105/167 (62.87%), Query Frame = 3
Query:   78 NTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDK 578
            +T  ++++  L ++N FTD+L KIEN  +V R    + +++   LY+  GYA     N+I  VFP Y SI AIE    +  TKWL YWV++A  + +E    +F++W+P + LLK  FLV+ M P + +GS  +Y+ ++RP V+++++++++V++  +   +++ ++
Sbjct:   23 DTIMEEIDSLLMQQNFFTDLLRKIENFTRVPRRIQVLLMVLFTLLYVAEGYAAACFCNVIAVVFPVYASISAIENPDYEIGTKWLMYWVIFAFVNFME----VFIAWLPSFYLLKFLFLVWCMAPGRVSGSEVMYFRVVRPLVMRHKARVNDVISDAAKRVRQVAER 185          
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Match: EDO40347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K3])

HSP 1 Score: 63.929 bits (154), Expect = 1.348e-12
Identity = 39/131 (29.77%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  240 FLANLI-GFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLS-WIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDN 626
            +L+ L+ G ++PAY S KAI+T    +  +W+ YW+V+A F   E  TD+ L  W P Y  +K  F+++L+ P    GS  +Y   + P + K++ +ID  + Q      + + +V   S +   E ++  
Sbjct:    3 YLSRLVFGTLYPAYNSYKAIKTKNVREYVRWMMYWIVFALFITAELFTDMLLGVWFPFYYEIKIIFMLWLLSPTT-KGSSVLYRKFVHPMLSKHEKEIDSYIEQAKESGYDTLIRVSRNSISIAAETMMRT 132          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep5 (receptor expression-enhancing protein 5 [Source:NCBI gene;Acc:101173158])

HSP 1 Score: 172.17 bits (435), Expect = 1.344e-52
Identity = 87/183 (47.54%), Postives = 122/183 (66.67%), Query Frame = 3
Query:   87 RQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKS 635
            R++ E +L+K NA T VLAK+E +  VSR  + +G+I +IA+YL+ GY    L NLIGF++PAY SIKAIE+  K+DDTKWLTYWVVY  FS+ E   DIFLSW P Y + KC FLV+ M P   NGS+ IY+ IIRP+ LKN++ ID+ +    + + +  DK+ + ++      + +  KS
Sbjct:    6 RERFERFLHKDNALTAVLAKLEARSGVSRTYISLGVIGIIAVYLVIGYGASLLCNLIGFMYPAYISIKAIESATKEDDTKWLTYWVVYGIFSVAEFFADIFLSWFPFYYIGKCAFLVWCMAPIPSNGSVQIYHRIIRPFFLKNEATIDDTVKNLKDKASDAADKIRDEAKKATANIIFEEKKS 188          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: zgc:101744 (receptor expression-enhancing protein 5 [Source:NCBI gene;Acc:101170803])

HSP 1 Score: 166.007 bits (419), Expect = 3.259e-50
Identity = 84/188 (44.68%), Postives = 120/188 (63.83%), Query Frame = 3
Query:   78 NTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSDE 641
            N  +++   +LN+KN  TD LA +E K  V +  + +GL   + LYL+FGY    L+NLIGF++PAY+SIKAIE+  K+DDT+WLTYWVVY  F++VE+ +DIFL W+P Y + KC FLV+ M P KWNGS  +Y  +I P+ LK+Q+ +D       N + ++  +     ET  KE V   L  D+
Sbjct:    2 NQLKERFTAFLNEKNFVTDQLATLEQKTGVKKEFIVLGLFGFLVLYLLFGYGASLLSNLIGFIYPAYFSIKAIESKNKEDDTQWLTYWVVYGLFTVVEAFSDIFLFWLPFYYVGKCLFLVWCMAPVKWNGSNMLYSRVILPFFLKHQTAMD-------NMATDLKARTKSLCETVTKEAVSSALNHDK 182          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep6 (receptor expression-enhancing protein 6 [Source:NCBI gene;Acc:101164298])

HSP 1 Score: 160.999 bits (406), Expect = 1.179e-47
Identity = 79/186 (42.47%), Postives = 117/186 (62.90%), Query Frame = 3
Query:   66 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVG-ETSETFVKERVL 620
            ++ +++ +++ E +LN+KN  TD L K+E K  + +  +  G + +  LYL++GY    L NLIGF +PAY+SIKAIE+  KDDDTKWLTYWVVY  FSL E  +DIFL W P Y   KC FL++ M P  WNGS  IY  ++RP  L++++ +D +++  S  +    + +  E   T VK + L
Sbjct:    4 LDIFSSIKERAEKFLNEKNMVTDFLGKVEEKTGIKKKFIAAGAVSLTGLYLVYGYGASLLCNLIGFAYPAYYSIKAIESPCKDDDTKWLTYWVVYGVFSLGEFFSDIFLYWFPFYYAFKCLFLLWCMAPMSWNGSQIIYNKVVRPIFLRHEATVDNMVSDLSGKAMSAAENLTREVLSTLVKNKTL 189          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep2 (receptor accessory protein 2 [Source:NCBI gene;Acc:101159201])

HSP 1 Score: 73.559 bits (179), Expect = 1.291e-14
Identity = 39/110 (35.45%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  258 GFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGE 587
            G ++PAY S KA++T    +  KW+ YW+V+A F+  E+ TD+ LSW P Y  LK  F+++L+ P    GS  +Y   + P +   + +IDE + Q  + S E + + G+
Sbjct:   15 GTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFALFTTAETATDLLLSWFPFYFELKIAFVIWLLSPYT-KGSSVLYRKFVHPTLSNKEKEIDEYIAQAKDKSYETMMRFGK 123          
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Match: reep3a (receptor expression-enhancing protein 3 [Source:NCBI gene;Acc:101157167])

HSP 1 Score: 73.1738 bits (178), Expect = 1.583e-14
Identity = 37/112 (33.04%), Postives = 68/112 (60.71%), Query Frame = 3
Query:  252 LIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGE 587
            L G ++PAY+S KA++T    +  +W+ YW+V+A +++VE++TD+ ++W PLY  LK  F+++L+ P    G+  IY   + P +   + +ID+ + Q    S E +   G+
Sbjct:   19 LFGTLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVVETITDLTVAWFPLYYELKIAFVIWLLSPYT-RGASLIYRKCLHPLLSSREREIDDYIVQAKERSYETMVNFGK 129          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000036637.1 (SMESG000036637.1)

HSP 1 Score: 370.548 bits (950), Expect = 1.398e-130
Identity = 192/192 (100.00%), Postives = 192/192 (100.00%), Query Frame = 3
Query:   66 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSDE 641
            MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGSIYIYYSIIRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSDE
Sbjct:    1 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGSIYIYYSIIRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSDE 192          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000043862.1 (SMESG000043862.1)

HSP 1 Score: 193.356 bits (490), Expect = 4.945e-61
Identity = 105/191 (54.97%), Postives = 133/191 (69.63%), Query Frame = 3
Query:   66 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSD 638
            M   + Y+ +LE  L++KNAFTD LA +E K  V +V L  GLI  I LYLI GY   FLAN IGF++PAY S+KAIET +KDDDTKWLTYWVVYAAFSL+E  TDIFL WIPLYALLKC FLV+ M P  WNGS+ IY  +I+P+VL+++ KID  + + S    ++I +  E +     ER  D+ K+D
Sbjct:    1 MNLVDGYKNQLEKKLSEKNAFTDALAIVEAKTGVKKVYLVGGLIGFIILYLIVGYGAQFLANFIGFLYPAYCSVKAIETKEKDDDTKWLTYWVVYAAFSLLEFFTDIFLFWIPLYALLKCIFLVFCMAPTTWNGSLLIYERLIKPFVLRHEKKIDSAIAKGS----KVISEFAEEA-----ERRYDDSKTD 182          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000042627.1 (SMESG000042627.1)

HSP 1 Score: 128.642 bits (322), Expect = 3.806e-36
Identity = 63/173 (36.42%), Postives = 103/173 (59.54%), Query Frame = 3
Query:   66 MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALYLIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVG 584
            M+ +    + ++  L  KN FT++LA  E    V R  +C+G+  V+ LY++FG     + NLIGF++PAY S+  IE+  K +D KW+TYW +Y+   L+ES  +  L  IP Y + KC FL++ M+   WNGS+  Y  I+RP +++N++ ID  +   +N + + + KV 
Sbjct:    1 MDRFKINYKSIDSKLQGKNIFTNILAYFEKVTGVPRSKICVGICFVVILYVLFGPYAIAIVNLIGFIYPAYASLNEIESRNKTEDIKWMTYWTIYSYLILLESFLEKVLLSIPFYPIFKCAFLIFCMISNPWNGSLIFYKHILRPLIVQNKATIDSAVTTITNEANDFLTKVN 173          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000044545.1 (SMESG000044545.1)

HSP 1 Score: 71.633 bits (174), Expect = 3.292e-14
Identity = 50/163 (30.67%), Postives = 83/163 (50.92%), Query Frame = 3
Query:  252 LIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDN-LKSDE--*TRILDNGDLTLRLC----VCVCDHIHFVF 719
            L   + PAY S K++    + D   W+ YW+V+A F+ VE+VTDI L WIP Y  +K  F++++ +P    G   I+  ++ P +LK + +ID+++ + S      + + G     F    VL   +K  +   +R L  GDL++       V   +HI  VF
Sbjct:   13 LFAILHPAYKSYKSLRQKNQKDILTWMMYWIVFAIFTAVETVTDIILCWIPFYYEMKTLFVLWMALPIT-KGYSIIFRRLVHPELLKRELEIDQIIEKASEKGYNTLLEFGAKGINFAATTVLTTAVKGQQLLASRSLSLGDLSISRRTHSYVPTEEHIDDVF 174          
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Match: SMESG000044545.1 (SMESG000044545.1)

HSP 1 Score: 71.633 bits (174), Expect = 4.038e-14
Identity = 50/163 (30.67%), Postives = 83/163 (50.92%), Query Frame = 3
Query:  252 LIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSLVESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGXXXXXXXXXRPYVLKNQSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDN-LKSDE--*TRILDNGDLTLRLC----VCVCDHIHFVF 719
            L   + PAY S K++    + D   W+ YW+V+A F+ VE+VTDI L WIP Y  +K  F++++ +P    G   I+  ++ P +LK + +ID+++ + S      + + G     F    VL   +K  +   +R L  GDL++       V   +HI  VF
Sbjct:   13 LFAILHPAYKSYKSLRQKNQKDILTWMMYWIVFAIFTAVETVTDIILCWIPFYYEMKTLFVLWMALPIT-KGYSIIFRRLVHPELLKRELEIDQIIEKASEKGYNTLLEFGAKGINFAATTVLTTAVKGQQLLASRSLSLGDLSISRRTHSYVPTEEHIDDVF 174          
The following BLAST results are available for this feature:
BLAST of Receptor expression-enhancing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
REEP55.077e-5549.71receptor accessory protein 5 [Source:HGNC Symbol;A... [more]
REEP69.459e-4947.44receptor accessory protein 6 [Source:HGNC Symbol;A... [more]
REEP61.515e-4847.44receptor accessory protein 6 [Source:HGNC Symbol;A... [more]
REEP59.697e-4452.48receptor accessory protein 5 [Source:HGNC Symbol;A... [more]
REEP51.509e-3955.36receptor accessory protein 5 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yop-18.884e-3338.75Receptor expression-enhancing protein [Source:Uni... [more]
T03F6.65.674e-2338.46Receptor expression-enhancing protein [Source:Uni... [more]
T03F6.65.674e-2338.46Receptor expression-enhancing protein [Source:Uni... [more]
F56B3.61.160e-2036.88Receptor expression-enhancing protein [Source:Uni... [more]
T19C3.47.810e-1230.65pep chromosome:WBcel235:III:618246:620254:-1 gene:... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ReepB3.212e-3741.40gene:FBgn0033906 transcript:FBtr0087525[more]
ReepB3.212e-3741.40gene:FBgn0033906 transcript:FBtr0302453[more]
CG49605.101e-3440.52gene:FBgn0039371 transcript:FBtr0346108[more]
CG49605.101e-3440.52gene:FBgn0039371 transcript:FBtr0084919[more]
ReepB1.886e-3344.36gene:FBgn0033906 transcript:FBtr0302451[more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep54.823e-5352.35receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-... [more]
zgc:1017441.224e-4845.21zgc:101744 [Source:ZFIN;Acc:ZDB-GENE-050320-111][more]
reep67.200e-4641.62receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
reep67.200e-4641.62receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
reep67.200e-4641.62receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep54.465e-5347.59receptor accessory protein 5 [Source:NCBI gene;Acc... [more]
reep51.811e-5248.57receptor accessory protein 5 [Source:NCBI gene;Acc... [more]
reep61.186e-4341.36receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
reep61.680e-4348.37receptor accessory protein 6 [Source:NCBI gene;Acc... [more]
teddm13.138e-1536.61transmembrane epididymal protein 1 [Source:Xenbase... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Reep53.719e-5548.13receptor accessory protein 5 [Source:MGI Symbol;Ac... [more]
Reep61.017e-3546.15receptor accessory protein 6 [Source:MGI Symbol;Ac... [more]
Reep62.101e-3545.28receptor accessory protein 6 [Source:MGI Symbol;Ac... [more]
Reep62.101e-3545.28receptor accessory protein 6 [Source:MGI Symbol;Ac... [more]
Reep52.419e-2848.67receptor accessory protein 5 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29RM3|REEP5_BOVIN1.886e-5550.86Receptor expression-enhancing protein 5 OS=Bos tau... [more]
sp|Q5RE33|REEP5_PONAB1.822e-5449.71Receptor expression-enhancing protein 5 OS=Pongo a... [more]
sp|Q00765|REEP5_HUMAN2.438e-5449.71Receptor expression-enhancing protein 5 OS=Homo sa... [more]
sp|B2RZ37|REEP5_RAT4.050e-5447.59Receptor expression-enhancing protein 5 OS=Rattus ... [more]
sp|Q60870|REEP5_MOUSE9.857e-5448.57Receptor expression-enhancing protein 5 OS=Mus mus... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UL643.399e-5956.21Receptor expression-enhancing protein OS=Capitella... [more]
A0A2H1C4Z41.661e-5755.69Receptor expression-enhancing protein OS=Fasciola ... [more]
V4BCB51.018e-5652.41Receptor expression-enhancing protein OS=Lottia gi... [more]
F7D9H01.154e-5549.74Receptor expression-enhancing protein OS=Monodelph... [more]
A0A0X3PP644.526e-5550.52Receptor expression-enhancing protein OS=Schistoce... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep57.715e-5549.18receptor accessory protein 5 [Source:NCBI gene;Acc... [more]
reep61.085e-4843.24receptor expression-enhancing protein 6 [Source:NC... [more]
ENSAMXT00000054484.13.885e-2545.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041103.17.997e-2546.30pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
reep21.928e-1636.36receptor accessory protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
reep58.666e-4947.27receptor accessory protein 5 [Source:ZFIN;Acc:ZDB-... [more]
reep23.206e-1035.23receptor accessory protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOP14.096e-1833.96Reticulon-interacting protein; ER integral membran... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO320551.758e-4548.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467812.078e-2833.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403471.348e-1229.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reep51.344e-5247.54receptor expression-enhancing protein 5 [Source:NC... [more]
zgc:1017443.259e-5044.68receptor expression-enhancing protein 5 [Source:NC... [more]
reep61.179e-4742.47receptor expression-enhancing protein 6 [Source:NC... [more]
reep21.291e-1435.45receptor accessory protein 2 [Source:NCBI gene;Acc... [more]
reep3a1.583e-1433.04receptor expression-enhancing protein 3 [Source:NC... [more]
back to top
BLAST of Receptor expression-enhancing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036637.11.398e-130100.00SMESG000036637.1[more]
SMESG000043862.14.945e-6154.97SMESG000043862.1[more]
SMESG000042627.13.806e-3636.42SMESG000042627.1[more]
SMESG000044545.13.292e-1430.67SMESG000044545.1[more]
SMESG000044545.14.038e-1430.67SMESG000044545.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009218 ID=SMED30009218|Name=Receptor expression-enhancing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=980bp
GTCATAAATACTTTTATATTTAAATACTGTTCTTACGTATAAATTTTATA
AATTAATATATTGCTATGGAGTGCTATAATACTTATAGACAAAAGCTTGA
AATTTATTTAAATAAGAAAAATGCATTTACAGATGTTTTGGCAAAAATTG
AAAACAAAGTTAAAGTTTCAAGAGTTAACTTATGCATTGGCTTAATCGTG
GTTATTGCTCTCTATTTAATATTTGGCTATGCTGGCCATTTTCTAGCCAA
TTTAATTGGATTTGTGTTTCCTGCTTATTGGAGCATCAAAGCGATCGAGA
CAACCCAGAAAGATGATGACACGAAATGGCTAACATATTGGGTTGTGTAT
GCCGCATTCAGTCTTGTTGAATCTGTCACAGACATATTTTTATCTTGGAT
TCCCCTGTACGCATTGTTGAAGTGCGGTTTCCTTGTGTATCTGATGGTGC
CAGCAAAATGGAATGGATCGATATACATCTATTACTCAATCATTCGCCCG
TATGTGTTGAAAAATCAATCGAAAATCGATGAAGTTCTCAATCAAACATC
GAATTTTTCCAAGGAAATTATTGATAAAGTGGGCGAGACCAGTGAAACCT
TTGTCAAGGAACGAGTGCTTGATAATTTGAAATCCGATGAATAGACGAGG
ATTTTGGATAACGGAGATCTGACATTGAGACTATGTGTGTGTGTGTGTGA
TCATATACATTTTGTTTTCTTATCTGTCGTTATTTCTTTTGCTGTTATTG
AGATCATTATGAACTTCATATTTATCAATTATCATTAATCTATATTATTA
TCACTGTGCCGTCGTATTGATTAGCAAGTGTGCCGTGATATCGAATTATT
TGGTTTCTAATCGAATCAAATTTTCATATTGCAATTATATTTTGTCTTTT
ATTTCCTGGGATGATGAAAGTTACCGTTGGAAAATTATTTATTTTAATTG
ATTTGTAGTAAATAAATTTTGACTTCAAAA
back to top

protein sequence of SMED30009218-orf-1

>SMED30009218-orf-1 ID=SMED30009218-orf-1|Name=SMED30009218-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MECYNTYRQKLEIYLNKKNAFTDVLAKIENKVKVSRVNLCIGLIVVIALY
LIFGYAGHFLANLIGFVFPAYWSIKAIETTQKDDDTKWLTYWVVYAAFSL
VESVTDIFLSWIPLYALLKCGFLVYLMVPAKWNGSIYIYYSIIRPYVLKN
QSKIDEVLNQTSNFSKEIIDKVGETSETFVKERVLDNLKSDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004345TB2_DP1_HVA22
IPR003133T_Ag_DNA-bd
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004345TB2/DP1/HVA22-related proteinPFAMPF03134TB2_DP1_HVA22coord: 69..146
e-value: 7.5E-27
score: 93.1
IPR004345TB2/DP1/HVA22-related proteinPANTHERPTHR12300HVA22-LIKE PROTEINScoord: 30..177
NoneNo IPR availablePANTHERPTHR12300:SF93RECEPTOR EXPRESSION-ENHANCING PROTEIN 5coord: 30..177
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
NoneNo IPR availableTMHMMTMhelixcoord: 121..143
NoneNo IPR availableTMHMMTMhelixcoord: 92..114