Ferric-chelate reductase 1

Overview
NameFerric-chelate reductase 1
Smed IDSMED30009212
Length (bp)1470
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ferric-chelate reductase 1 (SMED30009212) t-SNE clustered cells

Violin plots show distribution of expression levels for Ferric-chelate reductase 1 (SMED30009212) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ferric-chelate reductase 1 (SMED30009212) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ferric-chelate reductase 1 (SMED30009212) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009212

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009212SMESG000061404.1 dd_Smed_v4_8497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009212SMESG000061404.1 dd_Smed_v4_8497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009212SMESG000061404.1 dd_Smed_v4_8497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009212SMESG000061404.1 Contig47990newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009212SMESG000061404.1 Contig47990uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30009212SMESG000061404.1 dd_Smed_v4_8497_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009212SMESG000061404.1 dd_Smed_v4_8497_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ferric-chelate reductase 1 vs. Ensembl Human
Match: FRRS1 (ferric chelate reductase 1 [Source:HGNC Symbol;Acc:HGNC:27622])

HSP 1 Score: 115.161 bits (287), Expect = 1.165e-26
Identity = 110/385 (28.57%), Postives = 180/385 (46.75%), Query Frame = 2
Query:   92 SFQKCAVSKACFKSTKACS---EDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFL--VTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRN-PIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQ-WIIFI---FVICQVILEIILEIHG 1216
            S   C   K C +S   C    E  C ++    S   +++S + +EM+G    + GY++   S D+ MGDD    C     T  I      + ++ RS+ ++ ++   +D    + +G             + C F R +T      N  DL+    YY+ +A G+   +  + KH     +++    D T    N  IG S  +  L K HG +M +AWMT  SI V +AR++K VW++   + E +WF  HR L     VL  IA ++  ++ GG+S+   Y    HP  G IV+ L ++ P +A+ R  +    R +FNW H+ +G  A I+++  + +G+ LPG       LN P  W  +    FV   V  E++LE+H 
Sbjct:  194 SASDCGNKKFCIRSPLNCDPEKEASCVFL----SFTRDDQSVM-VEMSG---PSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQP----SHLTGRSHPVMDSRDTLEDMAWRLADG------------VMQCSFRRNIT-LPGVKNRFDLNTS--YYIFLADGA-ANDGRIYKH-SQQPLITYEKYDVTDSPKN--IGGSH-SVLLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFTTTVLTCIAFVMPFIYRGGWSRHAGY----HPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPG-------LNLPDSWKTYAMTGFVAWHVGTEVVLEVHA 535          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Human
Match: FRRS1 (ferric chelate reductase 1 [Source:HGNC Symbol;Acc:HGNC:27622])

HSP 1 Score: 111.309 bits (277), Expect = 2.199e-25
Identity = 109/383 (28.46%), Postives = 180/383 (47.00%), Query Frame = 2
Query:   92 SFQKCAVSKACFKSTKACS---EDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKD--FLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRN-PIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQ-WIIFI---FVICQVILEIILEI 1210
            S   C   K C +S   C    E  C ++    S   +++S + +EM+G    + GY++   S D+ MGDD    C     T  I      + ++ RS+ ++ ++   +D  + + +G             + C F R +T      N  DL+    YY+ +A G+   +  + KH     +++    D T    N  IG S  +  L K HG +M +AWMT  SI V +AR++K VW++   + E +WF  HR L     VL  IA ++  ++ GG+S+   Y    HP  G IV+ L ++ P +A+ R  +    R +FNW H+ +G  A I+++  + +G+ LPG       LN P  W  +    FV   V  E++LE+
Sbjct:  194 SASDCGNKKFCIRSPLNCDPEKEASCVFL----SFTRDDQSVM-VEMSG---PSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQP----SHLTGRSHPVMDSRDTLEDMAWRLADG------------VMQCSFRRNIT-LPGVKNRFDLNTS--YYIFLADGA-ANDGRIYKH-SQQPLITYEKYDVTDSPKN--IGGSH-SVLLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFTTTVLTCIAFVMPFIYRGGWSRHAGY----HPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPG-------LNLPDSWKTYAMTGFVAWHVGTEVVLEL 533          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Human
Match: FRRS1L (ferric chelate reductase 1 like [Source:HGNC Symbol;Acc:HGNC:1362])

HSP 1 Score: 62.3882 bits (150), Expect = 6.343e-10
Identity = 56/212 (26.42%), Postives = 97/212 (45.75%), Query Frame = 2
Query:    8 FLDIKYHKMKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTK-ACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSI 640
            F D++Y   +     T+      A I+V    C  +K CF+  K  C+ + CDY ++++ +  +    +E E++     T G++AVGFS DK MG D V+AC        + I   YN + + + +I  N   D++ +  N             R++CRF R V   ++ + + DL     +Y L A G  + +  + +H   S   SE  +
Sbjct:  121 FYDLRYLSEEGYPFPTAPPVDPFAKIKV--DDCGKTKGCFRYGKPGCNAETCDYFLSYRMIGAD----VEFELSA---DTDGWVAVGFSSDKKMGGDDVMACVHD-DNGRVRIQHFYN-VGQWAKEIQRNPARDEEGVFENN------------RVTCRFKRPVNVPRD-ETIVDLHLS--WYYLFAWGPAI-QGSITRHDIDSPPASERVV 305          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Celegans
Match: C05D12.1 (pep chromosome:WBcel235:II:11412232:11415820:-1 gene:WBGene00007339.1 transcript:C05D12.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D12.1)

HSP 1 Score: 108.997 bits (271), Expect = 2.816e-25
Identity = 117/425 (27.53%), Postives = 186/425 (43.76%), Query Frame = 2
Query:   41 LFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQ---CDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADN---LKDLSQGRRYYLLIAKGS--------DVGENGLNKHFPGSNVVSETSIDFTSGSFNSV----IG--------SSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNP-IKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEY-------PSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWI----IFIFVICQVILEII 1201
            LFL   LL Y  A    SF++C V+++C+     C+ D    C   V W+ +       LE ++     +   Y A+GFS ++ M DD V  C   P T +  +   +N+  +  N++L         L+T G     ++   +   S + L    P  + D    + DL  G  Y+LL A+GS        D+      + FP    +S+  + F   + +S     IG        S      +A  HGI+++ AW    S A+ I+RY+K ++ RN  +    WF  HR +     V+ VI ++ I    G       Y         K+H I GF   +L L+ P     R       RPIFNW H++VG+ ++ ++  TI++ L +   GL   + + P WI    I  F+ C +ILEII
Sbjct:   10 LFLFIFLLSYQQAS-SFSFEQCNVTRSCWFHPPECAADNLAACQSGVEWQMLPEGLFLQLEAKVHDLDQTRPFYAALGFSFNQRMDDDTVFECVV-PHTGDGKVQISFND--ETFNQVLPQ---GSSVLLTEGTT---SYVDGVLTCSAKLLLDNRPLIDNDTQFMVHDLESGS-YHLLFARGSANKYTLEKDIHSTNDGQQFPW---MSDEQVSFCRTNCSSPNLYHIGEMRQTYNVSRYWRYRIAVWHGILLMFAWWVLASNAILISRYFKPLFPRNKLLGTAVWFQLHRDMMILSVVIQVICVLFIFYQAGWVWYQCSYMCTSDDFSKKMHGITGFTATVLALLQPVFGFLRPSPTSSIRPIFNWGHWLVGMFSWSVASATIVLALPMGKTGLNRLYGHVPNWIVLGYILFFIACNLILEII 420          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Celegans
Match: C05D12.1 (pep chromosome:WBcel235:II:11412253:11415729:-1 gene:WBGene00007339.1 transcript:C05D12.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D12.1)

HSP 1 Score: 108.997 bits (271), Expect = 2.816e-25
Identity = 117/425 (27.53%), Postives = 186/425 (43.76%), Query Frame = 2
Query:   41 LFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQ---CDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADN---LKDLSQGRRYYLLIAKGS--------DVGENGLNKHFPGSNVVSETSIDFTSGSFNSV----IG--------SSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNP-IKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEY-------PSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWI----IFIFVICQVILEII 1201
            LFL   LL Y  A    SF++C V+++C+     C+ D    C   V W+ +       LE ++     +   Y A+GFS ++ M DD V  C   P T +  +   +N+  +  N++L         L+T G     ++   +   S + L    P  + D    + DL  G  Y+LL A+GS        D+      + FP    +S+  + F   + +S     IG        S      +A  HGI+++ AW    S A+ I+RY+K ++ RN  +    WF  HR +     V+ VI ++ I    G       Y         K+H I GF   +L L+ P     R       RPIFNW H++VG+ ++ ++  TI++ L +   GL   + + P WI    I  F+ C +ILEII
Sbjct:   10 LFLFIFLLSYQQAS-SFSFEQCNVTRSCWFHPPECAADNLAACQSGVEWQMLPEGLFLQLEAKVHDLDQTRPFYAALGFSFNQRMDDDTVFECVV-PHTGDGKVQISFND--ETFNQVLPQ---GSSVLLTEGTT---SYVDGVLTCSAKLLLDNRPLIDNDTQFMVHDLESGS-YHLLFARGSANKYTLEKDIHSTNDGQQFPW---MSDEQVSFCRTNCSSPNLYHIGEMRQTYNVSRYWRYRIAVWHGILLMFAWWVLASNAILISRYFKPLFPRNKLLGTAVWFQLHRDMMILSVVIQVICVLFIFYQAGWVWYQCSYMCTSDDFSKKMHGITGFTATVLALLQPVFGFLRPSPTSSIRPIFNWGHWLVGMFSWSVASATIVLALPMGKTGLNRLYGHVPNWIVLGYILFFIACNLILEII 420          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Celegans
Match: C05D12.1 (pep chromosome:WBcel235:II:11412253:11415772:-1 gene:WBGene00007339.1 transcript:C05D12.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D12.1)

HSP 1 Score: 108.997 bits (271), Expect = 2.816e-25
Identity = 117/425 (27.53%), Postives = 186/425 (43.76%), Query Frame = 2
Query:   41 LFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQ---CDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADN---LKDLSQGRRYYLLIAKGS--------DVGENGLNKHFPGSNVVSETSIDFTSGSFNSV----IG--------SSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNP-IKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEY-------PSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWI----IFIFVICQVILEII 1201
            LFL   LL Y  A    SF++C V+++C+     C+ D    C   V W+ +       LE ++     +   Y A+GFS ++ M DD V  C   P T +  +   +N+  +  N++L         L+T G     ++   +   S + L    P  + D    + DL  G  Y+LL A+GS        D+      + FP    +S+  + F   + +S     IG        S      +A  HGI+++ AW    S A+ I+RY+K ++ RN  +    WF  HR +     V+ VI ++ I    G       Y         K+H I GF   +L L+ P     R       RPIFNW H++VG+ ++ ++  TI++ L +   GL   + + P WI    I  F+ C +ILEII
Sbjct:   10 LFLFIFLLSYQQAS-SFSFEQCNVTRSCWFHPPECAADNLAACQSGVEWQMLPEGLFLQLEAKVHDLDQTRPFYAALGFSFNQRMDDDTVFECVV-PHTGDGKVQISFND--ETFNQVLPQ---GSSVLLTEGTT---SYVDGVLTCSAKLLLDNRPLIDNDTQFMVHDLESGS-YHLLFARGSANKYTLEKDIHSTNDGQQFPW---MSDEQVSFCRTNCSSPNLYHIGEMRQTYNVSRYWRYRIAVWHGILLMFAWWVLASNAILISRYFKPLFPRNKLLGTAVWFQLHRDMMILSVVIQVICVLFIFYQAGWVWYQCSYMCTSDDFSKKMHGITGFTATVLALLQPVFGFLRPSPTSSIRPIFNWGHWLVGMFSWSVASATIVLALPMGKTGLNRLYGHVPNWIVLGYILFFIACNLILEII 420          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Celegans
Match: C13B4.1 (pep chromosome:WBcel235:II:14470371:14479627:-1 gene:WBGene00007545.1 transcript:C13B4.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C13B4.1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.411e-16
Identity = 112/440 (25.45%), Postives = 189/440 (42.95%), Query Frame = 2
Query:  116 KACFKSTKACSEDQCDYI----VTWKSVKYNEKSYLEIEMTGTVLSTGG-YIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGS----DVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMI-GLKLPGAG--LKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYEL-----EKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFYIF 1381
            K  F S+  C +D+  Y     V   + K    SY+E E++ T  S+ G Y A+GFS D  M    V+ C +S G+  +++    N  S  SN  ++ ++  +   +TN        +    ++ C+         NA   K  +  ++Y+L+IAKG+     +G +G N++   + ++++      SGS N+++            H + M IAWMT   IAV  AR  +  W    P     WF+ HRG    G  L++ A ++I++H       + +  K H I G I + L  + PFI+  RC      RPIFN+IH  +G+ A +L+   I I G    G    ++L     P  +IF   +  +I   ++++      + N       ++      K E E    +   P        +     RL +  F  F
Sbjct:  567 KGTFDSS-TCGKDKACYTPPNNVDTVAYKVLNDSYIEFEISSTQSSSSGVYTALGFSNDGKMNPANVIEC-SSLGSQPLSMKFSTN--SGYSNDRISGEEAIRSQYITNTET-----SYVDGKIYCKGTVRSDGNSNAAIFK-YTPKQQYHLIIAKGTASPGGLGYHGTNRYISTARLLTDLGAGNESGSSNTLL----------ILHAMFMTIAWMTMVPIAVIFARVLRSSWPTTKPGGLLIWFHIHRGANLIGIALMIAAFVLILIHKDWKFTTIGWGGK-HAIIGIIALCLAWLQPFISTLRCSPNDSRRPIFNYIHRGIGVTAMVLATTAICIAGYHFTGGRHVVQLVLALIPISVIFALSLFFIIFNNVVDVDTKSFTKTNGASARTEDIPMRPTSKTESETTWAIQSPPTSTDSNREVPAEKKRLWVNRFREF 985          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Celegans
Match: C13B4.1 (pep chromosome:WBcel235:II:14470523:14479627:-1 gene:WBGene00007545.1 transcript:C13B4.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C13B4.1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.459e-15
Identity = 94/332 (28.31%), Postives = 156/332 (46.99%), Query Frame = 2
Query:  116 KACFKSTKACSEDQCDYI----VTWKSVKYNEKSYLEIEMTGTVLSTGG-YIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGS----DVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILS 1081
            K  F S+  C +D+  Y     V   + K    SY+E E++ T  S+ G Y A+GFS D  M    V+ C +S G+  +++    N  S  SN  ++ ++  +   +TN        +    ++ C+         NA   K  +  ++Y+L+IAKG+     +G +G N++   + ++++      SGS N+++            H + M IAWMT   IAV  AR  +  W    P     WF+ HRG    G  L++ A ++I++H       + +  K H I G I + L  + PFI+  RC      RPIFN+IH  +G+ A +L+
Sbjct:  567 KGTFDSS-TCGKDKACYTPPNNVDTVAYKVLNDSYIEFEISSTQSSSSGVYTALGFSNDGKMNPANVIEC-SSLGSQPLSMKFSTN--SGYSNDRISGEEAIRSQYITNTET-----SYVDGKIYCKGTVRSDGNSNAAIFK-YTPKQQYHLIIAKGTASPGGLGYHGTNRYISTARLLTDLGAGNESGSSNTLL----------ILHAMFMTIAWMTMVPIAVIFARVLRSSWPTTKPGGLLIWFHIHRGANLIGIALMIAAFVLILIHKDWKFTTIGWGGK-HAIIGIIALCLAWLQPFISTLRCSPNDSRRPIFNYIHRGIGVTAMVLA 877          

HSP 2 Score: 48.521 bits (114), Expect = 9.860e-6
Identity = 34/107 (31.78%), Postives = 57/107 (53.27%), Query Frame = 2
Query:   56 SLLCYSSAVIQVSFQK--CAVSKACFKSTKACSEDQCDYI-VTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEIS 367
            S+L +   V  + F    C ++K CF  T  C+ D CD I  +W  +  N+   + +E+TG V +T  Y+A+GFS +  MG+  V+ C +S   S  ++   YN ++
Sbjct:  364 SILTFLDQVNNLGFNDATCGLTKGCFTPTD-CT-DGCDDIRSSWSLLSDNQ---IHVELTGKVNATNKYVAMGFSTNGTMGNTSVIEC-SSFDNSNFSMTFSYNLVN 464          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Fly
Match: CG8399 (gene:FBgn0034067 transcript:FBtr0087207)

HSP 1 Score: 102.449 bits (254), Expect = 9.301e-23
Identity = 114/402 (28.36%), Postives = 170/402 (42.29%), Query Frame = 2
Query:   95 FQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISK----RSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEK 1285
            +  C  SK CF     C   +    +T  +V+ +     E E+     +   Y+AVG S D  MGDD    C   P    +N+ +     S     RSN +  N     D  + +G  Y            CR  R            DL  G+ Y+LL+A GS + EN +  H  G  + S   I+        + GSS++   L + HG  MI AW+   S+ +  ARY+K  W          WF  HR L    + L V A ++I      + +L +     H I G I +IL  I P  AL R     K RP FNW H++ G +A+IL I TI   +KLP A L      +  WI+  FV+  V++ +I  I G  + R    + + +++    + +
Sbjct:  226 YNGCGQSKNCFGFPDGCVATKSCTSITVVTVRGD---VFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECV--PENGRVNLYSSLTSASPYSAVRSN-VNQNSARLLDASIVDGVIY------------CRVQRDAVTNVQGRTF-DLRNGK-YHLLVASGSSLKENSVGYHDIG-RLPSAQPINL--AEVQDLSGSSRL---LIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAYVLI------WVELKQAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVTIFFSVKLPKAELP----EWMDWILVSFVVVHVLVHLIFSIGGMASERHLSQRANTFQMGDMSHHQ 591          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Fly
Match: CG8399 (gene:FBgn0034067 transcript:FBtr0340018)

HSP 1 Score: 100.523 bits (249), Expect = 3.621e-22
Identity = 109/365 (29.86%), Postives = 154/365 (42.19%), Query Frame = 2
Query:   95 FQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISK----RSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFV 1174
            +  C  SK CF     C   +    +T  +V+ +     E E+     +   Y+AVG S D  MGDD    C   P    +N+ +     S     RSN +  N     D  + +G  Y            CR  R            DL  G+ Y+LL+A GS + EN +  H  G  + S   I+        + GSS++   L + HG  MI AW+   S+ +  ARY+K  W          WF  HR L    + L V A ++I      + +L +     H I G I +IL  I P  AL R     K RP FNW H++ G +A+IL I TI   +KLP A L       P+W+ +I V
Sbjct:  226 YNGCGQSKNCFGFPDGCVATKSCTSITVVTVRGD---VFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECV--PENGRVNLYSSLTSASPYSAVRSN-VNQNSARLLDASIVDGVIY------------CRVQRDAVTNVQGRTF-DLRNGK-YHLLVASGSSLKENSVGYHDIG-RLPSAQPINL--AEVQDLSGSSRL---LIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAYVLI------WVELKQAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVTIFFSVKLPKAEL-------PEWMDWILV 551          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Zebrafish
Match: wu:fj05g07 (wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307])

HSP 1 Score: 100.523 bits (249), Expect = 3.992e-22
Identity = 102/345 (29.57%), Postives = 153/345 (44.35%), Query Frame = 2
Query:   92 SFQKCAVSKACFKSTKAC---SEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFL-VTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKL 1111
            S   C  +K CF     C   + + C ++    S   +++S ++IEM G      GY+A+GFS DK MG+D V  C        + +   +N   K S  IL+   +      +TNG            +++C F    T           +    Y+L+IA GS    N     F  +  VS T  +  + S   VI S +   P+ KAHG +M+I+WM   SI + IARY K V   +    +  WF  H  L +   +   IA II+ V  G      ++    HP+ G +V+IL LI P +A  RC+ +H+ R +FNW H         L++  I  GL L
Sbjct:  186 SIPGCGSTKVCFSEPNNCNPTTSNGCYFVAVQTS---SDQSEMKIEMFG---QADGYVAIGFSDDKEMGNDDVYIC-GKDNNGNLQVQHAFNS-GKSSPAILSLGNVSNIMTALTNG------------KINCSF----TSRNTISTASRAASNNEYHLMIAAGSS---NEGKIQFHTNKYVSSTKANLLNPSV--VITSEEEFPPIVKAHGCLMLISWMATGSIGMIIARYLKGVAKGQGCCGKDFWFVAHVSLMTLSVIATAIAFIIVFVSAG------DWVGGAHPVLGCLVMILSLIQPIVAAFRCEPQHERRFVFNWAHSCNAFAIKCLAVAAIFTGLAL 495          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Zebrafish
Match: frrs1b (ferric-chelate reductase 1b [Source:ZFIN;Acc:ZDB-GENE-080917-44])

HSP 1 Score: 94.7449 bits (234), Expect = 3.050e-20
Identity = 99/372 (26.61%), Postives = 164/372 (44.09%), Query Frame = 2
Query:  104 CAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPL-AKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIH 1213
            C + K+C +  + C E Q D    + S +    S +  E++G      GY++   S+DK M                                   N   D+ + +++G             + C F R V   +  ++L   S  + YYL +A G    ++G         ++S +  D T GS   + GS    SPL  K HG +M+IAW +  +  V +ARY+K  W  +N + +  WF  HR L S   +L ++A ++  ++ GG+SK     + +HP  G +V+ L LI P +AL R       R IFNW+HF  G  A I+++ TI +G+      L      +   ++   VI  V+ +++LE+H
Sbjct:  201 CGIEKSCLRDPEGC-EPQNDAACHFLSFRAESNSVM-FELSG---PAEGYVSFALSLDKWM-----------------------------------NVLKDRAWRLSDG------------VIQCSFRRDV--HQPPEDLNRFSLDQMYYLFMAHGR--ADDGRTHRHDRQPLISASQTDMT-GSPKEIGGS---RSPLLMKFHGALMLIAWTSTVTAGVIMARYFKPDWPEQNILGQKVWFQLHRMLMSLTVLLTLVAFVLPFIYRGGWSKR----AGIHPYLGCVVMALTLIQPVMALFRPAPDAARRYIFNWMHFGTGTAAQIVAVVTIFLGIHQQALFLPSP---WATGLLAFTVIWFVLADLVLEVH 505          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Zebrafish
Match: frrs1a (ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-45])

HSP 1 Score: 90.8929 bits (224), Expect = 5.609e-19
Identity = 102/386 (26.42%), Postives = 161/386 (41.71%), Query Frame = 2
Query:   86 QVSFQKCAVSKACFKSTKACS---EDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGL-NKHFPGSNVVSETSIDFTSGSFNSVIGSSKI----NSPL-AKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIH 1213
            Q S   C   K C      C+   +  C Y+    S        +  E++G      GY++   S DK MGDD V  C    G   +++ A Y            +  +D  + V++G             + C+F R +   ++ +     S    YYL IA GS   E G+ ++H         T     S     +IG   I     SPL  K HG +M+IAWM   S    +A Y+K  W    +  +  WF  HR L S   +L  +  I+  ++ G +S      +  HP  G  V+IL    P +A  R       R IFNW+H+ VG  A I+++ +I +G+K     L      +   I+  FV+  ++L+++L++H
Sbjct:  190 QFSSDGCGRQKTCLLDPVGCNPSVDTNCFYLAYSTS-----GQTVSFELSG---PAQGYVSFALSSDKWMGDDDVYLCVYDGG--RVSVEAAYTTGRTYPKVSSQSVLMDVGWRVSDG------------IIQCKFSRSIYTPQDPERF---SLNNSYYLFIAHGS--AEYGMIHRH---------TRQPLISSHHQVIIGPPVILTGSRSPLLMKYHGALMLIAWMLAGSTGTLMAGYFKPDWPEQTLFGQKIWFQVHRMLMSLTVLLTSVGFIVPFIYRGKWSTR----AGAHPYLGCTVMILAFCQPLMAAFRPAPDSPRRWIFNWLHWGVGNAAEIIAVGSIFLGIKQQSLLLPYP---WTTGILSAFVVWTIVLKLVLQLH 532          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Zebrafish
Match: frrs1a (ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-45])

HSP 1 Score: 75.8702 bits (185), Expect = 3.212e-14
Identity = 89/335 (26.57%), Postives = 134/335 (40.00%), Query Frame = 2
Query:  104 CAVSKACFKSTKACS---EDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKI----NSPL-AKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILS 1081
            C   K C      C+   +  C Y+    S +      +  E++G      GY++   S DK MGDD V  C    G   +++ A Y            +  +D  + V++G             + C+F R +   ++ +     S    YYL IA GS   E G+        +   T     S     +IG   I     SPL  K HG +M+IAWM   S    +A Y+K  W    +  +  WF  HR L S   +L  +  I+  ++ G +S      +  HP  G  V+IL    P +A  R       R IFNW+H+ VG  A I++
Sbjct:  203 CGRQKTCLLDPVGCNPSVDTNCFYLAYSTSGQT-----VSFELSG---PAQGYVSFALSSDKWMGDDDVYLCVYDGG--RVSVEAAYTTGRTYPKVSSQSVLMDVGWRVSDG------------IIQCKFSRSIYTPQDPERF---SLNNSYYLFIAHGS--AEYGM--------IHRHTRQPLISSHHQVIIGPPVILTGSRSPLLMKYHGALMLIAWMLAGSTGTLMAGYFKPDWPEQTLFGQKIWFQVHRMLMSLTVLLTSVGFIVPFIYRGKWSTR----AGAHPYLGCTVMILAFCQPLMAAFRPAPDSPRRWIFNWLHWGVGNAAEIIA 498          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Xenopus
Match: ENSXETT00000052073.1 (putative ferric-chelate reductase 1 [Source:NCBI gene;Acc:100489839])

HSP 1 Score: 110.923 bits (276), Expect = 2.290e-25
Identity = 121/405 (29.88%), Postives = 183/405 (45.19%), Query Frame = 2
Query:   86 QVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGP--NYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQW---IIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEK 1285
            Q+S   C   K CF     C+ D    +  + SV  +   Y+  EM+G V ST  YIAVGFS D+ MG+D    C  +        ++G  +I +R      N    K+ + +  P  NYG         + C F+     + +   L   S    YY+ +A G     NG  K      +++   ID ++ S N+   S +  S L   HG +M+IAWMT  +I + +ARY K+        +G WF  H  L S   +L  IA I+I   V G+S      +  HP+ G IV+IL  + PF A+ R    HK R IFNW H +  ++  +L++ T+ +GL+L             QW   ++  F   +V+  IILE+          + R+N   EK  YE+
Sbjct:  163 QISNITCGTGKFCFSDPANCNPDSSGCL--FMSVVPSSNGYV-FEMSGPV-STLEYIAVGFSDDQKMGNDDDYICATN--------LSGNVQI-QRVFLTGNNSPQSKNLIFSGSPVWNYGNGI------MKCCFI----AQASISTLSRASASSTYYIFLATG-PTEANGQIKQHTKIPLITAAKIDLSAFSGNNKAASGE--STLVLGHGALMLIAWMTTGTIGMLMARYMKNAAKEQYFGKGLWFLMHVFLMSLTVILTSIAFIMIFAEVSGWSS----DTGAHPVLGCIVMILSFLQPFGAMLRPAPTHKRRFIFNWAHGLNALVIKVLAVATLFLGLQLVDTSTN-------QWMPKVMGGFYGWEVLFYIILEV----------NTRYN---EKELYEE 517          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 103.99 bits (258), Expect = 2.976e-23
Identity = 110/383 (28.72%), Postives = 177/383 (46.21%), Query Frame = 2
Query:   83 IQVSFQKCAVSKACFKSTKACSED---QCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLA-KAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHG 1216
            IQVS   C  +K C ++  +C  +   +C ++    S + + +S L +EM+G      GYI+   S D  MGDD    C       +IN       I  RS+  +++  + +D            +  +   + C F R +    + +   DL  G  YY+ +A G D  +  L +H         T+  +    F   +G S+  SPL  K HG +M +AWMT  SI V IAR++K VW  + +  E  WF  HR L     +L  IA ++  ++ G +SK   Y    HP  G  V+IL ++ P +A+ R   +   R IFNW H+  G  A I+++  + IG+ L    L      +  + +  FV+  V ++++LE HG
Sbjct:  109 IQVS-SGCGSTKFCIRNPVSCDPEHNPKCFFL----SFRKDGQSVL-VEMSG---PGQGYISFALSYDHWMGDDDAYLCVKEDQGVQINPA----YIRGRSHPEVSSPDVLRDV----------AWRLEDGVIQCSFKRNIQIPASKERF-DL--GGSYYIFLADG-DAKDGLLLRH---QRQPLMTNRMYNISGFPEDVGGSR--SPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGY----HPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARIIAVTAMFIGMDLQALDLPDP---WDTYTMVGFVLWHVFVDLLLEAHG 452          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 103.605 bits (257), Expect = 5.463e-23
Identity = 107/376 (28.46%), Postives = 174/376 (46.28%), Query Frame = 2
Query:  104 CAVSKACFKSTKACSED---QCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLA-KAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHG 1216
            C  +K C ++  +C  +   +C ++    S + + +S L +EM+G      GYI+   S D  MGDD    C       +IN    Y  I  RS+  +++  + +D            +  +   + C F R +    + +   DL  G  YY+ +A G D  +  L +H         T+  +    F   +G S+  SPL  K HG +M +AWMT  SI V IAR++K VW  + +  E  WF  HR L     +L  IA ++  ++ G +SK   Y    HP  G  V+IL ++ P +A+ R   +   R IFNW H+  G  A I+++  + IG+ L    L      +  + +  FV+  V ++++LE HG
Sbjct:  199 CGSTKFCIRNPVSCDPEHNPKCFFL----SFRKDGQSVL-VEMSG---PGQGYISFALSYDHWMGDDDAYLCVKEDQGVQIN--PAY--IRGRSHPEVSSPDVLRDV----------AWRLEDGVIQCSFKRNIQIPASKERF-DL--GGSYYIFLADG-DAKDGLLLRH---QRQPLMTNRMYNISGFPEDVGGSR--SPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGY----HPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARIIAVTAMFIGMDLQALDLPDP---WDTYTMVGFVLWHVFVDLLLEAHG 536          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 103.605 bits (257), Expect = 5.562e-23
Identity = 118/430 (27.44%), Postives = 191/430 (44.42%), Query Frame = 2
Query:  104 CAVSKACFKSTKACSED---QCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLA-KAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFYI 1378
            C  +K C ++  +C  +   +C ++    S + + +S L +EM+G      GYI+   S D  MGDD    C       +IN    Y  I  RS+  +++  + +D            +  +   + C F R +    + +   DL  G  YY+ +A G D  +    K  P       T+  +    F   +G S+  SPL  K HG +M +AWMT  SI V IAR++K VW  + +  E  WF  HR L     +L  IA ++  ++ G +SK   Y    HP  G  V+IL ++ P +A+ R   +   R IFNW H+  G  A I+++  + IG+ L    L      +  + +  FV+  V ++++LE HG             + L K E +  + LN  PD        +   F+ ++L  YI
Sbjct:  192 CGSTKFCIRNPVSCDPEHNPKCFFL----SFRKDGQSVL-VEMSG---PGQGYISFALSYDHWMGDDDAYLCVKEDQGVQIN--PAY--IRGRSHPEVSSPDVLRDV----------AWRLEDGVIQCSFKRNIQIPASKERF-DL--GGSYYIFLADG-DAKDGKFCKRQP-----LMTNRMYNISGFPEDVGGSR--SPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGY----HPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARIIAVTAMFIGMDLQALDLPDP---WDTYTMVGFVLWHVFVDLLLEAHG-------------FCLLKKEDQVGI-LNSSPD------EAEGHTFKKIVLTVYI 561          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Xenopus
Match: FRRS1 (ferric-chelate reductase 1 [Source:NCBI gene;Acc:100497064])

HSP 1 Score: 103.219 bits (256), Expect = 6.726e-23
Identity = 107/376 (28.46%), Postives = 174/376 (46.28%), Query Frame = 2
Query:  104 CAVSKACFKSTKACSED---QCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLA-KAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHG 1216
            C  +K C ++  +C  +   +C ++    S + + +S L +EM+G      GYI+   S D  MGDD    C       +IN    Y  I  RS+  +++  + +D            +  +   + C F R +    + +   DL  G  YY+ +A G D  +  L +H         T+  +    F   +G S+  SPL  K HG +M +AWMT  SI V IAR++K VW  + +  E  WF  HR L     +L  IA ++  ++ G +SK   Y    HP  G  V+IL ++ P +A+ R   +   R IFNW H+  G  A I+++  + IG+ L    L      +  + +  FV+  V ++++LE HG
Sbjct:  199 CGSTKFCIRNPVSCDPEHNPKCFFL----SFRKDGQSVL-VEMSG---PGQGYISFALSYDHWMGDDDAYLCVKEDQGVQIN--PAY--IRGRSHPEVSSPDVLRDV----------AWRLEDGVIQCSFKRNIQIPASKERF-DL--GGSYYIFLADG-DAKDGLLLRH---QRQPLMTNRMYNISGFPEDVGGSR--SPLIIKFHGAMMFVAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVILTAIAFVLPFIYRGYFSKRAGY----HPHLGVTVMILTVLQPVLAVFRPPPQTPRRGIFNWTHWATGTAARIIAVTAMFIGMDLQALDLPDP---WDTYTMVGFVLWHVFVDLLLEAHG 536          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Mouse
Match: Frrs1 (ferric-chelate reductase 1 [Source:MGI Symbol;Acc:MGI:108076])

HSP 1 Score: 123.25 bits (308), Expect = 1.214e-29
Identity = 107/378 (28.31%), Postives = 180/378 (47.62%), Query Frame = 2
Query:  101 KCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVT-PEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRN-PIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQ----WIIFIFVICQVILEIILEIHG 1216
            +C   K C +S   C  ++    V     + N+   + +EM+G    + GY++  FS D+ MGDD    C     T  ++I + Y  ++ RS  ++ ++   +D            +      + C F R +T PE  A N   L++   YY+  A+G    +  + +H     +  E    +        +G S+ +SPL KAHG +M +AWMT  SI V +AR+++ VW++   ++E +WF  HR L     +L  +A ++  V+ GG+S    Y    HP  G  V+ L ++ P +A  R  +    R +FNW H+ VG  A I+++  + +G+ LPG       LN P     + +  FV+  +  E+ILEIH 
Sbjct:  197 ECGNKKFCVRSPLNCDPEKEPACVFLSFTRDNQS--VMVEMSG---PSDGYVSFAFSHDQWMGDDDAYLCIREDQT--VDIQSSY--LTGRSYPVMDSRGTLEDM----------AWRLADSVIQCSFRRNITLPE--AKNRFVLNES--YYIFFAEGPS-HDGRIFRHSQQPLITYE---KYNVTDTPKSVGGSR-SSPLLKAHGALMFVAWMTTVSIGVLVARFFRSVWSKAFFLREAAWFQVHRMLMVATSLLTCVAFVLPFVYRGGWSWRAGY----HPYLGCTVMTLAVLQPLLATFRPPLHDPRRQVFNWTHWSVGTAARIIAVAAMFLGMDLPG-------LNLPSPQKTYAMMGFVVWHIGTEVILEIHA 535          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Mouse
Match: Frrs1 (ferric-chelate reductase 1 [Source:MGI Symbol;Acc:MGI:108076])

HSP 1 Score: 123.25 bits (308), Expect = 1.214e-29
Identity = 107/378 (28.31%), Postives = 180/378 (47.62%), Query Frame = 2
Query:  101 KCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVT-PEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRN-PIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQ----WIIFIFVICQVILEIILEIHG 1216
            +C   K C +S   C  ++    V     + N+   + +EM+G    + GY++  FS D+ MGDD    C     T  ++I + Y  ++ RS  ++ ++   +D            +      + C F R +T PE  A N   L++   YY+  A+G    +  + +H     +  E    +        +G S+ +SPL KAHG +M +AWMT  SI V +AR+++ VW++   ++E +WF  HR L     +L  +A ++  V+ GG+S    Y    HP  G  V+ L ++ P +A  R  +    R +FNW H+ VG  A I+++  + +G+ LPG       LN P     + +  FV+  +  E+ILEIH 
Sbjct:  197 ECGNKKFCVRSPLNCDPEKEPACVFLSFTRDNQS--VMVEMSG---PSDGYVSFAFSHDQWMGDDDAYLCIREDQT--VDIQSSY--LTGRSYPVMDSRGTLEDM----------AWRLADSVIQCSFRRNITLPE--AKNRFVLNES--YYIFFAEGPS-HDGRIFRHSQQPLITYE---KYNVTDTPKSVGGSR-SSPLLKAHGALMFVAWMTTVSIGVLVARFFRSVWSKAFFLREAAWFQVHRMLMVATSLLTCVAFVLPFVYRGGWSWRAGY----HPYLGCTVMTLAVLQPLLATFRPPLHDPRRQVFNWTHWSVGTAARIIAVAAMFLGMDLPG-------LNLPSPQKTYAMMGFVVWHIGTEVILEIHA 535          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Mouse
Match: Frrs1l (ferric-chelate reductase 1 like [Source:MGI Symbol;Acc:MGI:2442704])

HSP 1 Score: 62.7734 bits (151), Expect = 2.345e-10
Identity = 55/212 (25.94%), Postives = 98/212 (46.23%), Query Frame = 2
Query:    8 FLDIKYHKMKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTK-ACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSI 640
            F D++Y   +     T+      A I+V  + C  +K CF+  K  C+ + CDY ++++ +  +    +E E++     T G++AVGFS DK MG D V+AC        + I   YN + + + ++  N   D++ +  N             R++CRF R V   ++ + + DL     +Y L A G  + +  + +H   S   SE  +
Sbjct:   70 FYDLRYLSEEGYPFPTAPPVDPFAKIKV--EDCGRTKGCFRYGKPGCNAETCDYFLSYRMIGAD----VEFELSA---DTDGWVAVGFSSDKKMGGDDVMACVHD-DNGRVRIQHFYN-VGQWAKEVQRNPARDEEGVFENN------------RVTCRFKRPVNVPRD-ETIVDLHLS--WYYLFAWGPAI-QGAITRHDIDSPPASERVV 254          
BLAST of Ferric-chelate reductase 1 vs. UniProt/SwissProt
Match: sp|Q8K385|FRRS1_MOUSE (Ferric-chelate reductase 1 OS=Mus musculus OX=10090 GN=FRRS1 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.448e-28
Identity = 108/380 (28.42%), Postives = 181/380 (47.63%), Query Frame = 2
Query:  101 KCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFL--VTNGPNYGGNFNRDIRRLSCRFLRLVT-PEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRN-PIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQ----WIIFIFVICQVILEIILEIHG 1216
            +C   K C +S   C  ++    V     + N+   + +EM+G    + GY++  FS D+ MGDD    C     T  ++I   Y  ++ RS  ++ ++   +D    + +G             + C F R +T PE  A N   L++   YY+  A+G    +  + +H     +  E    +        +G S+ +SPL KAHG +M +AWMT  SI V +AR+++ VW++   ++E +WF  HR L     +L  +A ++  V+ GG+S    Y    HP  G  V+ L ++ P +A  R  +    R +FNW H+ VG  A I+++  + +G+ LPG       LN P     + +  FV+  +  E+ILEIH 
Sbjct:  197 ECGNKKFCVRSPLNCDPEKEPACVFLSFTRDNQS--VMVEMSG---PSDGYVSFAFSHDQWMGDDDAYLCIREDQT--VDIQPSY--LTGRSYPVMDSRGTLEDMAWRLADG------------VIQCSFRRNITLPE--AKNRFVLNES--YYIFFAEGPS-HDGRIFRHSQQPLITYE---KYNVTDTPKSVGGSR-SSPLLKAHGALMFVAWMTTVSIGVLVARFFRSVWSKAFFLREAAWFQVHRMLMVATSLLTCVAFVLPFVYRGGWSWRAGY----HPYLGCTVMTLAVLQPLLATFRPPLHDPRRQVFNWTHWSVGTAARIIAVAAMFLGMDLPG-------LNLPSPQKTYAMMGFVVWHIGTEVILEIHA 535          
BLAST of Ferric-chelate reductase 1 vs. UniProt/SwissProt
Match: sp|Q6ZNA5|FRRS1_HUMAN (Ferric-chelate reductase 1 OS=Homo sapiens OX=9606 GN=FRRS1 PE=2 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 5.595e-26
Identity = 110/385 (28.57%), Postives = 180/385 (46.75%), Query Frame = 2
Query:   92 SFQKCAVSKACFKSTKACS---EDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFL--VTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRN-PIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQ-WIIFI---FVICQVILEIILEIHG 1216
            S   C   K C +S   C    E  C ++    S   +++S + +EM+G    + GY++   S D+ MGDD    C     T  I      + ++ RS+ ++ ++   +D    + +G             + C F R +T      N  DL+    YY+ +A G+   +  + KH     +++    D T    N  IG S  +  L K HG +M +AWMT  SI V +AR++K VW++   + E +WF  HR L     VL  IA ++  ++ GG+S+   Y    HP  G IV+ L ++ P +A+ R  +    R +FNW H+ +G  A I+++  + +G+ LPG       LN P  W  +    FV   V  E++LE+H 
Sbjct:  194 SASDCGNKKFCIRSPLNCDPEKEASCVFL----SFTRDDQSVM-VEMSG---PSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQP----SHLTGRSHPVMDSRDTLEDMAWRLADG------------VMQCSFRRNIT-LPGVKNRFDLNTS--YYIFLADGA-ANDGRIYKH-SQQPLITYEKYDVTDSPKN--IGGSH-SVLLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFTTTVLTCIAFVMPFIYRGGWSRHAGY----HPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPG-------LNLPDSWKTYAMTGFVAWHVGTEVVLEVHA 535          
BLAST of Ferric-chelate reductase 1 vs. UniProt/SwissProt
Match: sp|A2VE04|FRRS1_BOVIN (Ferric-chelate reductase 1 OS=Bos taurus OX=9913 GN=FRRS1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 9.040e-24
Identity = 107/377 (28.38%), Postives = 176/377 (46.68%), Query Frame = 2
Query:  104 CAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILT--NKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFP----QWIIFIFVICQVILEIILEIHG 1216
            C   K C +S   C  ++ +      S   +++S + +EM+G    + GY++V FS D+ MGDD    C        I      + ++ RS+ I+   +   D  + + +G             + C F R +T      N  DL+    YY+ +A G+ V +  ++KH     +  E      +G   ++ GS  +   L K HG +M +AWMT  S+ V IAR++K VW++    + +WF  HR L      L  IA ++  ++ GG++    Y    HP  GFIV++L ++   +A  R  +    R +FNW H+ +G  A I+++  + +G+ LPG       LN P     + +  FV   V  EIILEIH 
Sbjct:  198 CGNKKFCIRSPLNCDPEK-ERACVLLSFTRDDQSVM-VEMSG---PSKGYLSVAFSHDRWMGDDDAYVCILEDQIVHIQP----SHLTGRSHPIMDFGDPLEDMAWRLVDG------------VMQCSFRRNIT-LPGVKNRFDLNAS--YYIFVADGAAV-DGRIHKHSQQPLITYEKYN--VTGDPKNIGGSHSLL--LLKVHGALMFVAWMTTVSVGVLIARFFKPVWSKALFGDAAWFQVHRTLMLTTSALTFIAFLLPFIYRGGWNWHAGY----HPYLGFIVMVLAVLQLLLAAFRPPLHDPRRQMFNWTHWSMGTAARIIAVAAMFLGMDLPG-------LNLPGPWKTYAMIGFVAWHVGTEIILEIHA 534          
BLAST of Ferric-chelate reductase 1 vs. UniProt/SwissProt
Match: sp|Q6INU7|FRRS1_XENLA (Putative ferric-chelate reductase 1 OS=Xenopus laevis OX=8355 GN=frrs1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.575e-23
Identity = 114/417 (27.34%), Postives = 188/417 (45.08%), Query Frame = 2
Query:  104 CAVSKACFKSTKACSED---QCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLR---LVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLA-KAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNY---------ELEKNEYEKAVQLNY 1303
            C  SK C ++  +C  +   +C ++    S + + +S L +EM+G      GYI+   S D+ MGDD    C       +IN    Y  I  RS+  +++  + +D            +  +   + C F R   +  P++  D       GR Y++ +A G D  +  L +H     +   T+  +    F   +G S+  SPL  K HG +M IAWMT  SI V IAR++K VW  + +  E  WF  HR L      L V+A ++  ++ G +SK   Y    HP  G  V+IL ++ P +A+ R   +   R IFNW H+  G  A I+++  + +G+ L    L      +  + +  FV+  V ++++LE HG    +  K    +          E E + ++K V   Y
Sbjct:  197 CGSSKFCIRNPVSCDPEHNPECFFL----SFRKDGQSVL-VEMSG---PGQGYISFALSHDQWMGDDDAYLCVKEDDGVQIN--PAY--IRGRSHPEVSSMDVLRDV----------AWRLEDGVIQCSFRRNIQIPIPKERFD------LGRSYFIFLADG-DAKDGLLYRHHRQPLM---TNRKYCITDFPEDVGGSR--SPLIIKLHGAMMFIAWMTTVSIGVIIARFFKPVWPTSSLFGEKIWFQIHRCLMITTVFLTVVAFVLPFIYRGYFSKRAGY----HPHLGVTVMILTVLQPVLAVFRPPPQTHRRGIFNWTHWATGTAARIIAVAAMFLGMDLQALDLPDP---WDTYTMIGFVLWHVFVDLLLEAHGFCLLKKAKTMEEDQIGILNSSPDEAEGHTFKKIVMTVY 572          
BLAST of Ferric-chelate reductase 1 vs. UniProt/SwissProt
Match: sp|A4QP81|FRRS1_DANRE (Putative ferric-chelate reductase 1 OS=Danio rerio OX=7955 GN=frrs1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.093e-22
Identity = 99/345 (28.70%), Postives = 149/345 (43.19%), Query Frame = 2
Query:   89 VSFQKCAVSKACFKSTKAC---SEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKL 1111
             S   C  +K CF     C   +   C ++    S   +++S + IEM G      GY+A+GFS D+ MG+D V  C        + +   +N    R   +      D    VTNG             ++C F+               +    YYL+IA GS    +  N  F  +  V+ T ++  + S   VI S +   P+ KAHG +M+I+WM   SI + IARY K V   +    +  WF  H  L +   +   IA II+ V  G      ++    HP+ G +V+IL LI P +A  RC+ +H+ R +FNW H         L++  I  GL L
Sbjct:  188 ASIPGCGTTKVCFSQPNNCDPTTSTGCYFVAVQAS---SDQSEMRIEMFG---PADGYVAIGFSDDQQMGNDDVYIC-GKDNNGNLQVQHAFNSGRSRPAILSLGNVTDILTAVTNG------------NINCSFIS----RNTISTASRAATTNEYYLMIAAGS---SSQGNIQFHTNKYVTSTKVNLLNPSV--VITSEEEFPPMVKAHGCLMLISWMATGSIGMIIARYLKGVAKGQGCFGKDFWFVAHVSLMTLSIIATAIAFIIVFVSAG------DWAGGAHPVLGCLVMILSLIQPIVAAFRCEPQHERRFVFNWAHSCNAFAIKCLAVAAIFTGLAL 498          
BLAST of Ferric-chelate reductase 1 vs. TrEMBL
Match: A0A3Q0KUG7 (Ceramidase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 8.486e-108
Identity = 179/412 (43.45%), Postives = 251/412 (60.92%), Query Frame = 2
Query:  143 CSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFY 1375
            C+E  C ++VTWK V    ++Y+E E+ G +    G+IA+ FS D+ +GDDGVV CY    T+ +NI AGYN+I+ ++         D++ L+T+G N GG FN     L CRF R V P      L DL+    Y+L++ +G +  ++G  + F G   VS+  +  TS  + S+ G     S +AK HG +M++AW+ C SI + +ARYYKDVW N   + E  WF  HR LQ     L  I++I+I ++  GYS+   YP  +HPI G IV  L LINP IALCRC   H+ RP FNWIHF +G  AYILS+PT+M+GL++P AGL+L  +N+P WI+  FVI Q ++EIILEIHGC  YR NK+KR  Y LE ++Y+ A +LN      P +P    R F+  I+G +
Sbjct:    2 CTESSCAFLVTWKLVSVKSENYVEFELRGNIQKVTGFIALAFSKDQRVGDDGVVGCYYQSSTNTVNIRAGYNDIAGKTTNFYNGP--DEELLITDGENLGGTFNAMDGTLQCRFRRRVRPLDTVHQLMDLTSPNAYHLIVTRGVERKKDGFGRPFAGGESVSQRPVVITSPIYGSMTGIIGRGSAIAKTHGCLMVLAWVLCASIGIILARYYKDVWPNSGLLGERVWFQSHRILQGICVGLTCISIILIFIYCEGYSQATAYPYYIHPILGLIVFSLALINPIIALCRCNPAHEYRPWFNWIHFFIGTFAYILSVPTMMLGLRMPAAGLQLQFINYPLWILIFFVIFQFMIEIILEIHGCFYYRRNKNKRRTYVLEIDQYQAAKRLNNARQPRPPEPEPSGRMFKYFIIGLH 411          
BLAST of Ferric-chelate reductase 1 vs. TrEMBL
Match: A0A4Z2DSA4 (Ferric-chelate reductase 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_009413 PE=4 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 6.735e-103
Identity = 167/392 (42.60%), Postives = 238/392 (60.71%), Query Frame = 2
Query:   86 QVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNY 1258
             ++  +CA++K C +    C+E  C ++VTWK V  N ++Y+E E+ G +    G+I + FS D+ +GDDGVV CY    T+ +NI AGYN+I+ ++         D+  L+T G N GG FN     L CRF R V P      L DL+    Y+L++ +G++   +G  + F G   +S+  +  TS  + S+ G    +S +AK HG +M++AW+ C SI + +ARYYKDVW N   + E  WF  HR LQ     L  I++I+I ++  GYS+   YP  +HPI G IV  L LINP IALCRC   H+ RP FNWIHF +G  AY+LS+PT+M+GL++P AGL+L  +N+P WI+  FVI Q ++EI LEIHGC  YR NK K  +Y
Sbjct:   24 DITLHECALTKGCLRPA-VCTESSCAFLVTWKLVSVNSENYVEFELKGNIQKNTGFITLAFSKDQRVGDDGVVGCYYQSSTNNVNIRAGYNDITGKTTNFYNGP--DEQLLITEGENLGGAFNAMDGTLQCRFRRRVRPLDTVHQLMDLTSPNAYHLIVTRGTERKIDGFGRPFAGGESLSQRPVVITSPIYGSMTGIIGRSSAIAKTHGCLMVLAWVLCASIGIILARYYKDVWPNSGLLGERVWFQSHRILQGICVGLTCISIILIFIYCEGYSQATAYPYYIHPILGLIVFSLALINPIIALCRCNPAHEYRPWFNWIHFFIGTFAYVLSVPTMMLGLRMPAAGLQLQFINYPLWILIFFVIFQFMIEITLEIHGCFYYRRNKSKNMDY 412          
BLAST of Ferric-chelate reductase 1 vs. TrEMBL
Match: A0A094ZJD1 (Ferric-chelate reductase 1 OS=Schistosoma haematobium OX=6185 GN=MS3_02889 PE=4 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.379e-102
Identity = 183/430 (42.56%), Postives = 259/430 (60.23%), Query Frame = 2
Query:   89 VSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFY 1375
            ++  +CA +K C +    C+E  C ++VTWK V    ++Y+E E+ G V    G+IA+ FS D+ +GDDGVV CY    T+ +NI AGYN+I+ ++         D++ L+T+G N GG FN     L CRF R V P      L DL+    Y+L++ +G +  ++G  + F G   VS+  +  TS  + S+ G     S +AK HG +M++AW+ C SI + +ARYYKDVW N   + E  WF  HR LQ     L  I++I+I ++  GYS+   YP  +HPI G IV  L LINP IALCRC   H+ RP FNWIHF +G  AY+LS+PT+M+GL++P AGL+L  +N+P WI+  FVI Q I+EI LEIHGC  YR NK+KR  Y LE ++Y+ A +LN      P +P    R F+  I+G +
Sbjct:   25 ITLHECASTKGCLRPAM-CTESSCAFLVTWKLVSVKSENYVEFELRGNVQKVTGFIALAFSKDQRVGDDGVVGCYYQSSTNTVNIRAGYNDIAGKTTNFYNGP--DEELLITDGENLGGTFNAMDGTLQCRFRRRVRPLDTVHQLMDLTSPNAYHLIVTRGVERKKDGFGRPFAGGESVSQRPVVITSPIYGSMTGIIGRGSAIAKTHGCLMVLAWVLCASIGIILARYYKDVWPNSGLLGERVWFQSHRILQGICVGLTCISIILIFIYCEGYSQATAYPYYIHPILGLIVFSLALINPIIALCRCNPAHEYRPWFNWIHFFIGTFAYVLSVPTMMLGLRMPAAGLQLQFINYPLWILIFFVIFQFIIEITLEIHGCFYYRRNKNKRRTYVLEIDQYQAAKRLNNARQPRPPEPEPSGRMFKYFIIGLH 451          
BLAST of Ferric-chelate reductase 1 vs. TrEMBL
Match: A0A158R8R2 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5954 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.674e-101
Identity = 180/447 (40.27%), Postives = 255/447 (57.05%), Query Frame = 2
Query:   41 LFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSP-LAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFY 1375
            LF + S+L +      V    C V+K C +    C ++ C+Y  TW+ V+ +E  Y+E E+ G + S+ G+I++ FS D   G DG V CY      +  + AGY   +  SN  L N   D+  L+T G + G ++      L CRF R VTP + A+ LKDL+    YYL+I +GSD       + +PG    S TS   TS  ++  +G    +SP + KAHG +M++AW+ C S+ V I+RYYKD+W N   + E  WF  HR L      L  +A+I+  +   GYS L  YP  +HPI G IV+ L +INPFI  CR    HKNRP FNW HFI+G IAY+LSIPTIM+GL++P AG++L  LN+P WI+  FVI Q  +E+ LEIHGC+ YR NK K+  Y  E  +Y+ AV++   P   P +P    R F+  ++  +
Sbjct:    8 LFFVVSVLGFK----DVDLSTCTVTKGCLRP-PICVDNLCEYGATWRLVEQDEIQYIEFELFGDIKSSSGFISLVFSRDAYFGGDGFVGCYYDTVDFKTVVRAGYRPEASESNH-LYNPSDDEKLLITTGDDLGSSYVDAQHYLQCRFRRRVTPVRMANQLKDLAPPNAYYLIIQRGSDPLRTSFGQLYPGGEATSNTSAVITSPLYDLTVGYLVSHSPGMVKAHGAMMVLAWVFCSSVGVIISRYYKDMWPNAGLLGERVWFQIHRILMGICVGLTCLAVILAFIFCQGYSALKIYPDYIHPILGLIVLCLAVINPFITFCRPHPMHKNRPYFNWTHFIIGTIAYVLSIPTIMLGLRMPAAGVQLRSLNYPLWILIFFVIFQFCVELTLEIHGCIHYRRNKHKKITYRNELEQYQNAVRVGGVPIPRPVEPEPSGRIFKYFMISLH 448          
BLAST of Ferric-chelate reductase 1 vs. TrEMBL
Match: A0A0X3PKR9 (Ferric-chelate reductase 1 OS=Schistocephalus solidus OX=70667 GN=FRRS1 PE=4 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 1.107e-99
Identity = 174/449 (38.75%), Postives = 249/449 (55.46%), Query Frame = 2
Query:   32 MKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFY 1375
            + L+F    +     A  ++    C V+K C + +  C++D C+Y  TW+ +  +   Y+E E+ G V S+ G++ + FS D+  G DG V CY      +  + AGY   +  SN++++    D   LVT G N GG ++   ++L CRF R VTP + +D LKDL+    Y+L+I +GSD   +     +PG   VS+ +   TS  +   I      S +AKAHG +M++AW+ C S+ V ++RYYKD+W N   + E  WF  HR L      L  IA+I+      GYS L  YP  +HPI G IV+ L  INP  + CRC    K+RP FNWIHF +G  A+ LSIPT+M+GL+LP AG+ L  LN+P WI+  FVI Q I+EI LEIHGC+ YR NK+KR  Y  E   Y  A Q    P   P +P    R F+  ++  +
Sbjct:    2 LSLIFAFIFVSSARGAFQEIDLTNCGVTKGCLRPS-VCADDHCEYAATWRLIDQDSVDYIEFELLGDVKSSDGFVTLVFSKDRHFGGDGFVGCYYDTYNMKTVVRAGYRPEASISNQLVSVDD-DPTLLVTEGENLGGEYSEVKQQLQCRFRRRVTPVRLSDRLKDLAPPNAYFLMIQRGSDPLGSAFGSLYPGGEAVSKENAVVTSPLYGVRIEDQMRASGVAKAHGCMMVLAWVFCSSVGVILSRYYKDMWPNSGLLGERVWFQLHRILMGVCVGLTCIAVILAFAFCYGYSTLSSYPDYIHPILGLIVLCLAFINPLTSFCRCHPNSKHRPYFNWIHFFIGTFAHCLSIPTMMLGLRLPAAGVHLRTLNYPLWILIFFVIFQFIVEITLEIHGCIFYRRNKNKRMAYLNELENYRIATQSGGAPTPRPAEPEPSGRIFKYFVISLH 448          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Cavefish
Match: frrs1b (ferric chelate reductase 1 [Source:NCBI gene;Acc:103030884])

HSP 1 Score: 123.25 bits (308), Expect = 1.185e-29
Identity = 123/436 (28.21%), Postives = 201/436 (46.10%), Query Frame = 2
Query:   89 VSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLV---TPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLA-KAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRH-NYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFYI 1378
            ++   C ++K+C +   AC + Q D +  + S    + S +  E++G      GY++   S DK MG+D V  C      S+++I A Y  +  R++ ++ ++ + +D   T G    G        + CRF R+V    P +N  NL +      +YL +A G    ENG         ++S   + F +GS   + GS    SPL  K H + M+IAWMT  S  V IARY+K  W    +  +  WF  HR L     +L  I  I+  ++ GG+SK     +  HP  G  V+ L LI P +AL R       R IFNW+H   G IA ++++  + +G+      L      +   I+  +VI  V+ ++ILE+H    +   +  +H     E  + E   ++ + P     Q  IK   F+ ++L  Y+
Sbjct:  202 ITSDGCGITKSCLREPAAC-DPQNDALCYFLSFAKEDDSVV-FELSG---PAPGYVSFALSTDKWMGEDDVYLCINE--GSQVSINAAY--VQGRTHPVIASENVLRD---TEGRLVDG-------VIQCRFRRVVRIPAPNQNRSNLDE-----AHYLFMAHGR--AENGRTHRHDRQPLISSNPV-FITGSPEDLTGS---RSPLLIKFHAVFMLIAWMTTVSTGVIIARYFKPNWPDTTLCGQRVWFQFHRALMLVTVLLTGIGFILPFIYRGGWSKR----AGSHPYLGCTVMALALIQPIMALFRPAPDSSRRYIFNWLHLGTGTIAQVIAVVAVCLGIHQQALLLPAP---WSTGIVAGYVIWFVLADLILEVHSRGLFPIGQFFKHFEVHTENIQTEDKEEILFVPSE--GQSCIKGPRFKEVVLVVYL 598          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Cavefish
Match: wu:fj05g07 (putative ferric-chelate reductase 1 [Source:NCBI gene;Acc:103033089])

HSP 1 Score: 90.8929 bits (224), Expect = 2.223e-19
Identity = 88/347 (25.36%), Postives = 153/347 (44.09%), Query Frame = 2
Query:   86 QVSFQKCAVSKACFKSTKAC---SEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLS-QGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKL 1111
             +S   C   K CF     C   ++  C ++           S + +E+ G      GYI+ GFS D+ MG+D +  C  +     + +   ++    R   +      D    +++G             + C F+      +N  +   ++ Q   Y+LL A GS +  +GL +    +  +S++ +D      N  I     +   +KAHG +M+IAWMT  S+ +  ARY K V   +    +  WF  H  L S   ++  IA I+       ++ +  +   +HP+ G +V+IL LI P  A  RC  +H+ R +FNW+H I+ ++  +L++  I  GL L
Sbjct:   20 SISSAGCGTEKVCFSQPPDCDPAADPSCYFMAV---TALPTASGISVELQG---RAEGYISFGFSDDQRMGNDDIYIC-GTDSNGTVQVQHAFSTGRSRPTIVPLGNVSDITASMSDG------------VIGCSFI-----SRNPISAGGMTEQNSTYFLLYAYGSTI--DGLIQFHGTNRFISDSRVDV----LNPQIVKRAHHPSASKAHGSLMLIAWMTTSSVGMITARYLKAVGKGKGCSSKDVWFLAHVSLMSFTVIITAIAFILE------FAHIKGWAGGVHPVLGCLVMILSLIQPVAAAFRCSPQHEKRFVFNWMHGIMALVIKVLAVAAIFTGLAL 330          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Cavefish
Match: frrs1a (ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-45])

HSP 1 Score: 77.411 bits (189), Expect = 9.342e-15
Identity = 104/404 (25.74%), Postives = 177/404 (43.81%), Query Frame = 2
Query:   71 SSAVIQVSFQK--CAVSKACFKSTKAC--SEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQ--LDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVT-PEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLA-KAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWI--IFI-FVICQVILEIILEIHGCMTYRPNKDK 1246
            ++AV+   F    C   K+C      C  + D   + +++++    E S ++ E++G      GY++   S DK MG+D V  C    G   +++ A Y   + R++  + +K    D  + V +G             + CRF R ++ PE    + +  S    YYL IA G+   E+GL        ++S      T G      GS    SPL  K HG +M+ AWM   S  +F+A ++K  W  +    +  WF  H  L     +   +  I+  ++ G +S+     +  H   G  V+ L +I P +A  R       R IFNW+H  VG  A +L+  TI  G+       +   L FP W   +F+ F+I  ++ ++IL ++     +P  ++
Sbjct:  211 TTAVLPQPFSSDGCGQEKSCLLDPVHCNPATDTHCFFLSYRT----EGSSVQFELSG---PAPGYVSFALSEDKWMGNDDVYLCVNDGG--RVSVEAAYA--TGRTHPEIADKAELSDVGWRVADG------------VIQCRFRRAISIPE----DPQRFSLNHSYYLFIAHGA--AEDGLIHKHKRQPLISAQRQAIT-GPPEIATGS---RSPLMMKYHGALMLFAWMVLGSTGIFMAGFFKPDWPEKTLFGQRIWFMVHHSLMMLTVIFTFVGFILPFIYRGHWSR----GASAHAGLGCTVMSLTVIQPIMAFFRPSPDSSRRWIFNWMHRGVGKTAELLAGITISYGMH-----QQSLLLPFP-WTTGVFVGFIILVILSKVILFVYRRNICKPGAER 571          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Cavefish
Match: wu:fj05g07 (wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307])

HSP 1 Score: 56.9954 bits (136), Expect = 2.631e-8
Identity = 86/343 (25.07%), Postives = 126/343 (36.73%), Query Frame = 2
Query:   92 SFQKCAVSKACFKSTKAC--SEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVW-NRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKL 1111
            S   C  +K CF +   C  S D   Y ++  S     +   EI     V  + GY+A+GFS D  MG+D +  C     +  I +   ++  +     I      D      NG             +SC F    T   +    +  S G  YY+ +A G            P  N                               G +M+IAWMT  S+ + IARY K          +  WF  H       F++I+     II  +  +S   ++    HP+ G +V+IL L  P  AL RC  + + R IFNW H I  +    L++  I  GL L
Sbjct:  186 SLTGCGSTKTCFSNPSDCDPSTDSSCYFMS--STPSGSQHRFEI-----VGPSSGYVAIGFSDDTEMGNDDIYIC-GKNSSGSIQLQHAFSTGTTTPTSIDLGSVSDISVSTLNG------------VISCSF----TSANSISTTRSSSTGSSYYIFLAYG------------PTQN-------------------------------GCLMLIAWMTTGSVGMLIARYLKKTAKGTRCCGKDFWFVAHV------FLMILSVAATIIAFILVFSYAKDWAGGAHPVLGVLVMILSLAQPIAALFRCGPQDERRYIFNWAHSINALAIKGLAVAAIFTGLFL 455          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005593.1 (pep scaffold:Pmarinus_7.0:GL493051:1963:3473:-1 gene:ENSPMAG00000005086.1 transcript:ENSPMAT00000005593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.815e-8
Identity = 26/70 (37.14%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  620 VVSETSIDFTSGSFNSVIGSSKINSP-LAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWF 823
            +VS  ++  T G+   V GS    SP + KAHG +M++AW+TC S+ + +AR++K +W  + I  +  WF
Sbjct:   21 LVSRVAVRLT-GTPTEVPGS---RSPTIIKAHGALMMVAWLTCASVGIVLARFFKPLWPTHYIWGQKVWF 86          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Nematostella
Match: EDO34476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP71])

HSP 1 Score: 100.908 bits (250), Expect = 1.451e-22
Identity = 111/444 (25.00%), Postives = 204/444 (45.95%), Query Frame = 2
Query:  104 CAVSKACFKSTKAC-SEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISK-----RSNKILTNKQLDKDFLVTNGPN----------YGGNFNRDIRRLS----CRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKL-HPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGF 1372
            C  +KAC    K C +   C Y++T+      E   +   M+ ++    G+ A+GF+    M D   + C +   TS  ++   + EI+      ++ ++  N       L+  G +          Y G  ++ +++ S    CRF R    +K +  + DL+  ++ YL+ A+G    +  L +H P     +   +  TS +   V     ++  L + H I+M IAW+ C S+++F+ARY ++VW        +WF  HRGL     V  V+ +++  V+ GG+S+     +K+ HP+ G IV+ L  I P +A  R +     R +FNW H  VG+I+  L++    +G+ LP   L+ S   +P     I     V L I+ EI+  +  +       N E + +   + V++  K      +P  + ++ + +++GF
Sbjct:  357 CGKTKACVSEPKNCRTSSDCQYLMTYTV----ENDDVIFHMSTSL----GWSAIGFNSKPRMDDTDALIC-SRTATSGDSVGVAHYEITGYGKPVKNTQVYHNTYNSHRLLLIAGVSQYLQRPSLAAYAG-VSQYLQQPSLAAYCRFSR----KKQSLGMMDLN--KKVYLIFARGQISAQGDLRQHSPREKSYTTDPVAITSLTDLKVTEGKDLS--LLRGHAILMSIAWLVCASLSMFVARYMREVWG-EIFGLKAWFQVHRGLMVLTLVFSVVGIVLAFVYAGGWSE-----TKIAHPLIGMIVLALACIQPVMAYFRPKPGTDKRVVFNWAHRSVGVISLALAVVNCFLGVLLPHFELQTSG-TYP----LIAYCAGVGLVILFEIY--LACKARSQSSANLEAKADIRNEDVEVKTK----QVKPVEQYKSLKKIVMGF 765          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Nematostella
Match: EDO34492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP75])

HSP 1 Score: 96.6709 bits (239), Expect = 3.058e-21
Identity = 129/480 (26.88%), Postives = 204/480 (42.50%), Query Frame = 2
Query:   86 QVSFQKCAVSKACFKSTKACSE-DQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGV--VACYASPGTSEINIVA--GYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSK--------LMEYPSKL------------------------------HPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLK----LPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFYIF 1381
            +V+   C  +K C+   + C +   C Y+VT+K+   N    +E E+T    +   ++A+GFS  K  G DG+  + C    G  E++  A  GY+   K +   L        F V  G         D  R  C+FLR ++P     NL+ L   R+++L+   G   G   + KH   + + S++ ID      +++I  ++  S L KAHG +M IAW+   ++A+F+ARY K  W    I  +  WF  HR       +L  + LI+I +HV G+S         ++ Y  +L                              HP  G   + L +I PF+AL R     + R IFNW H  VGI A  L++ T+ +       +   GLK        W++  + I  +I  +I EI      R +  K   + LEK+      Q+  +    P+     D     L+LGF I 
Sbjct:  333 KVNTAGCGETKGCYAEPQGCKDHTDCKYLVTYKT---NGAGNIEFELT----AKNDWVAIGFSY-KNKGMDGIDTMVCATVAGKVELHHYALKGYSLPEKTT---LNAGDTSLVFGVREG---------DSTR--CKFLRKISP--GTANLRALD--RKWHLVFGDGPVSGS--VQKH-TKTPIFSKSKIDL---RVSAIIRETEGISALVKAHGCVMSIAWLAFATVAIFMARYMKSAWKGEKIFGKLIWFQVHRAFMMVVVLLSCVGLILIFLHVEGWSDVCGAILCIVLCYCDRLGVKCELMYCVMLLRSLRCGALGRVQRSWGAHPYMGITAVGLAVIQPFMALLRPGPAAEKRFIFNWAHRFVGISALTLAVATLFLATLNYHFIRNLGLKNGF-----WVLIAYCI-GIIFVLIFEI----MQRASPSKSKGFTLEKST-GMVEQMGMQQ---PQLSLTSDGRKHRLVLGFVIL 766          
BLAST of Ferric-chelate reductase 1 vs. Ensembl Nematostella
Match: EDO43912 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX71])

HSP 1 Score: 65.855 bits (159), Expect = 1.212e-11
Identity = 85/330 (25.76%), Postives = 147/330 (44.55%), Query Frame = 2
Query:   74 SAVIQVSFQKCAVSKACFKSTKAC-SEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDK--LMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKE-GSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHF 1051
            S+ +++S   C  +K C      C     C+Y+VT+ + K  +  Y E+       +   ++++GF+ DK  ++G D ++    + G+S   I+ G+  +S ++   +T       F      N  G FN  I R  C F R   P  N     DLS   + YL+ A+G +V    L  H   S+  ++  +  T+G+ +           L   HG +M+IAW+   ++ +  ARY +  W  + I     WF  HR       +  +I+ I++ V+VGG+S++       H   G  V++L ++ P IA+ R           NWI F
Sbjct:   19 SSGLEISKSGCKETKGCVSFPYDCKGSSDCNYLVTYVAGK--DSVYFEMS------AKDDWVSIGFNQDKAGMVGTDAIICSRPASGSS---ILIGHYYLSSKNTPTITTPTPTGLF------NTSGEFNGGIIR--CSFTRNKVPSSNMK--YDLSN--KQYLVYARG-EVASGILQYHSWKSSSSNKVDVLATTGAESR-------KRALLLTHGALMLIAWVGFATVGMATARYMRTFWGDSKIMSLLVWFQIHRSCMVIVVLSTIISTILVFVYVGGWSEI-----GAHAYIGIAVLVLAVLQPMIAVFRPHPGDDKSHFPNWIWF 312          
BLAST of Ferric-chelate reductase 1 vs. Planmine SMEST
Match: SMESG000061404.1 (SMESG000061404.1)

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 447/449 (99.55%), Postives = 447/449 (99.55%), Query Frame = 2
Query:   32 MKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFYI 1378
            MKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVT GPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFVLIVIALIIIIVHVGGYSKLMEYPSKLHPIFGFIVIILFLINPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIK RNFRLLILGFYI
Sbjct:    1 MKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTTGPNYGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFVLIVIALIIIIVHVGGYSKLMEYPSKLHPIFGFIVIILFLINPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKGRNFRLLILGFYI 449          
BLAST of Ferric-chelate reductase 1 vs. Planmine SMEST
Match: SMESG000021389.1 (SMESG000021389.1)

HSP 1 Score: 387.497 bits (994), Expect = 1.066e-130
Identity = 207/453 (45.70%), Postives = 283/453 (62.47%), Query Frame = 2
Query:   32 MKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEI--SKRSNKILTNKQLDKDFLVTNGPN-YGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIG-SSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPI-KEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFY 1375
            +K+L  I SL+    A+  +SFQ C   KACFKS+K C+ D CD+ ++WK   Y    Y+E EM GTV     Y+ VGFS D  +G+DG V+C+    + ++ +VAG+ E+  +  SN   +N   D   LV N    YGG +N D +RL+CRFLR   P+   +  KDLS G  YYL  A+G++  + G      GS + S+  IDF+ GSF+ VIG SS+++S  AK HGI+M+IAW+ C S+ V +ARYYK++W    I KE  WF  HR LQ    +L  +A I+I   VGGYSKL   P   HPI G IV IL  +NP +ALCRC+   K+RP FNW HF +G IAY LS+PTIMIG+++ G G +L++L  PQWI+  FV+ Q  +EIILEIHGC+ YR NKDK+H YE+E  EY+ A+  N+ P   P  P+   R F+ ++LG +
Sbjct:    2 IKILVFIISLVFVCDALESMSFQTCESEKACFKSSKYCTYDSCDFAISWKPFSYMNNDYIEFEMVGTVFGDNSYMLVGFSDDTSLGNDGFVSCHVE--SKKVKVVAGFYEVGDTPESNIKFSN---DVSLLVANSDKRYGGVYNEDTKRLTCRFLRQTRPQNANNQYKDLSLGNEYYLFTARGNEASQYGYGPPTAGSLIFSKHPIDFSRGSFHGVIGESSRVDSSFAKTHGILMVIAWVFCSSVGVILARYYKEMWPYTGIAKEMVWFQFHRSLQGTCVLLTTVAFILIFASVGGYSKLDRSPYVAHPILGIIVFILAFLNPLVALCRCRPNSKDRPWFNWFHFFIGSIAYCLSVPTIMIGMRISGPGRQLAYLESPQWILIFFVLFQFAVEIILEIHGCLYYRRNKDKKHTYEMEMEEYQAALIANHAPQTKPIPPKQSGRMFKYVMLGMH 449          
BLAST of Ferric-chelate reductase 1 vs. Planmine SMEST
Match: SMESG000042103.1 (SMESG000042103.1)

HSP 1 Score: 204.527 bits (519), Expect = 3.400e-60
Identity = 144/403 (35.73%), Postives = 212/403 (52.61%), Query Frame = 2
Query:   98 QKCAVSKACFKSTKACSEDQCDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPN-YGGNFNRDIRRLSCRFLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNP-IKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGYSKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYRPNKDKRHNYELEKNEYEKAVQLN 1300
             +C  SK+C  +  +C    C+Y  +WK   +N   YLEIE+ G + S+  Y+A+GFS    M D+ VVACY    T+   I+AGYN   K  +  L +  LD +F V    + YG  +N  I  L CRFLRLV P  N   LKDLS   +YYLL AK + +  N L  H   +   S+ S + T    NSVI +S +   L K H  +MI  W+ C +  + IA +YK+ W++     E  WF  HR +Q+   + +    III ++VGGYS L   P   HP+ G +     L NP +AL RC   H +R IFN +H +VG+ AY+L++ T +IG++  G G     L++P  ++ +++   +IL +  EI   ++     DK   +    NE E +V  N
Sbjct:   26 SECGKSKSCL-TWSSCIWPNCEYAFSWKIKTFNSTKYLEIELIGRLTSSDAYLALGFSTVPKMKDNAVVACYKETDTT--GILAGYNGDHKFYS--LNDDSLDSNFFVKQMDDLYGAQYNATINVLQCRFLRLVQPTINVIKLKDLSV-TKYYLLSAKSAFLKHN-LTYH-SENKRYSQYSYNLTLDWVNSVIRNSNL---LVKFHACLMIFGWVFCSTNGIIIANFYKNYWSKTSWFGEKVWFQLHRLIQTICVICVSSGFIIIFIYVGGYSALSSLPYSAHPVMGIVATGFMLSNPIMALFRCAPNHPSRKIFNRLHLLVGVTAYVLALATAIIGIQFLGDG----TLSYPYILVAVYLGLIIILFLYGEIRKVLS-----DKTRVF----NETEMSVSSN 404          
BLAST of Ferric-chelate reductase 1 vs. Planmine SMEST
Match: SMESG000005729.1 (SMESG000005729.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.683e-13
Identity = 98/385 (25.45%), Postives = 163/385 (42.34%), Query Frame = 2
Query:   86 QVSFQKCAVSKACFKSTKACSEDQ-CDYIVTWKSVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTSEINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCRF---LRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSETSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYKDVWNRNPIKEGSWFNPHRGLQSCGFXXXXXXXXXXXXXXGGY------SKLMEYPSKLHPXXXXXXXXXXXXNPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILSIPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEI 1210
             ++   C  +K C     +C + + C Y+V+ K     + + ++ E+ G      GYIA+  S D +MGDD V+ C  +P +   ++  GY    KR   + T   +D +  + N      NF      L C+F     LV+P K     K+LS+    Y+ IA G+        K      ++S TSI   S   N +     +     K HG IMI+++M    IA+ I  +++  ++        WFN H  L    F          ++ + GY       +++   +K H IFG + I L LIN  +   R  +    R  F WIHF            T  + +K+ G      ++ F  W++FI +  +  L+++ EI
Sbjct:  191 SITIDGCGTTKNCLLYPLSCYDRRNCKYMVSSKV----DGNNVDFELVGL---NKGYIAMALSNDTIMGDDLVIVCANNPNSPTPSLQTGYTPSGKRKYLVTT---VDPN--IFNKKAGKMNFLNFENALVCKFRIPRILVSPVKELIP-KNLSES--LYIFIANGNTYHSTAYVKKHSDPPLISLTSIILYSTK-NGIFYLQNLEY-YKKVHGTIMILSFMILQPIAIIIVLHFRHNFSYRLKGRQLWFNVHVLLNLLYF----------LMSLAGYIYILCNKEILFQDAKFHGIFGTLAIGLSLINILMGFLRPDLTSDRRVYFKWIHF------------TNAMAIKISG------YITF--WLVFITINLRNNLKLLTEI 528          
The following BLAST results are available for this feature:
BLAST of Ferric-chelate reductase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FRRS11.165e-2628.57ferric chelate reductase 1 [Source:HGNC Symbol;Acc... [more]
FRRS12.199e-2528.46ferric chelate reductase 1 [Source:HGNC Symbol;Acc... [more]
FRRS1L6.343e-1026.42ferric chelate reductase 1 like [Source:HGNC Symbo... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C05D12.12.816e-2527.53pep chromosome:WBcel235:II:11412232:11415820:-1 ge... [more]
C05D12.12.816e-2527.53pep chromosome:WBcel235:II:11412253:11415729:-1 ge... [more]
C05D12.12.816e-2527.53pep chromosome:WBcel235:II:11412253:11415772:-1 ge... [more]
C13B4.13.411e-1625.45pep chromosome:WBcel235:II:14470371:14479627:-1 ge... [more]
C13B4.16.459e-1528.31pep chromosome:WBcel235:II:14470523:14479627:-1 ge... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG83999.301e-2328.36gene:FBgn0034067 transcript:FBtr0087207[more]
CG83993.621e-2229.86gene:FBgn0034067 transcript:FBtr0340018[more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
wu:fj05g073.992e-2229.57wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307][more]
frrs1b3.050e-2026.61ferric-chelate reductase 1b [Source:ZFIN;Acc:ZDB-G... [more]
frrs1a5.609e-1926.42ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-G... [more]
frrs1a3.212e-1426.57ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000052073.12.290e-2529.88putative ferric-chelate reductase 1 [Source:NCBI g... [more]
FRRS12.976e-2328.72ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
FRRS15.463e-2328.46ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
FRRS15.562e-2327.44ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
FRRS16.726e-2328.46ferric-chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Frrs11.214e-2928.31ferric-chelate reductase 1 [Source:MGI Symbol;Acc:... [more]
Frrs11.214e-2928.31ferric-chelate reductase 1 [Source:MGI Symbol;Acc:... [more]
Frrs1l2.345e-1025.94ferric-chelate reductase 1 like [Source:MGI Symbol... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K385|FRRS1_MOUSE1.448e-2828.42Ferric-chelate reductase 1 OS=Mus musculus OX=1009... [more]
sp|Q6ZNA5|FRRS1_HUMAN5.595e-2628.57Ferric-chelate reductase 1 OS=Homo sapiens OX=9606... [more]
sp|A2VE04|FRRS1_BOVIN9.040e-2428.38Ferric-chelate reductase 1 OS=Bos taurus OX=9913 G... [more]
sp|Q6INU7|FRRS1_XENLA2.575e-2327.34Putative ferric-chelate reductase 1 OS=Xenopus lae... [more]
sp|A4QP81|FRRS1_DANRE5.093e-2228.70Putative ferric-chelate reductase 1 OS=Danio rerio... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KUG78.486e-10843.45Ceramidase OS=Schistosoma mansoni OX=6183 PE=4 SV=... [more]
A0A4Z2DSA46.735e-10342.60Ferric-chelate reductase 1 OS=Schistosoma japonicu... [more]
A0A094ZJD11.379e-10242.56Ferric-chelate reductase 1 OS=Schistosoma haematob... [more]
A0A158R8R21.674e-10140.27Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0X3PKR91.107e-9938.75Ferric-chelate reductase 1 OS=Schistocephalus soli... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
frrs1b1.185e-2928.21ferric chelate reductase 1 [Source:NCBI gene;Acc:1... [more]
wu:fj05g072.223e-1925.36putative ferric-chelate reductase 1 [Source:NCBI g... [more]
frrs1a9.342e-1525.74ferric-chelate reductase 1a [Source:ZFIN;Acc:ZDB-G... [more]
wu:fj05g072.631e-825.07wu:fj05g07 [Source:ZFIN;Acc:ZDB-GENE-030131-7307][more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005593.15.815e-837.14pep scaffold:Pmarinus_7.0:GL493051:1963:3473:-1 ge... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO344761.451e-2225.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344923.058e-2126.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439121.212e-1125.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ferric-chelate reductase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferric-chelate reductase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000061404.10.000e+099.55SMESG000061404.1[more]
SMESG000021389.11.066e-13045.70SMESG000021389.1[more]
SMESG000042103.13.400e-6035.73SMESG000042103.1[more]
SMESG000005729.11.683e-1325.45SMESG000005729.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009212 ID=SMED30009212|Name=Ferric-chelate reductase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1470bp
GGCGTAGTTTTTAGATATAAAATATCACAAAATGAAATTATTGTTTCTTA
TAACTTCTCTGTTATGTTACTCATCGGCTGTGATTCAAGTTTCCTTTCAG
AAGTGTGCAGTTTCCAAAGCATGTTTTAAATCAACAAAAGCCTGTTCCGA
AGATCAATGTGATTATATTGTTACATGGAAATCAGTAAAATACAACGAAA
AAAGTTATTTGGAAATCGAAATGACTGGAACGGTTTTATCTACAGGTGGT
TACATTGCAGTGGGTTTTTCAGTGGATAAGTTGATGGGTGATGATGGAGT
CGTTGCTTGTTATGCCAGTCCGGGAACTTCTGAAATCAACATCGTTGCTG
GTTATAATGAAATATCAAAAAGAAGTAACAAAATATTAACGAACAAACAA
CTGGATAAAGATTTTCTCGTTACTAACGGTCCAAATTACGGTGGCAATTT
TAATAGAGATATCAGGAGGTTGTCTTGTCGATTTCTGCGTTTAGTAACTC
CGGAGAAAAACGCCGACAATCTAAAAGATTTAAGTCAAGGAAGACGATAT
TATCTACTTATTGCGAAAGGATCCGATGTGGGAGAAAATGGATTAAATAA
GCATTTCCCGGGTTCGAATGTAGTCAGTGAAACTTCGATTGATTTTACCA
GCGGTTCTTTTAACTCTGTGATTGGCTCATCGAAAATTAATTCTCCATTG
GCTAAAGCTCATGGGATTATTATGATTATTGCATGGATGACTTGTTGTTC
AATTGCGGTTTTTATCGCAAGATATTACAAAGACGTTTGGAATAGAAATC
CCATCAAAGAAGGTAGTTGGTTCAATCCACATAGAGGTTTGCAAAGCTGT
GGATTTGTGTTAATAGTCATTGCATTGATAATTATAATTGTTCACGTTGG
TGGCTATTCTAAACTCATGGAGTATCCTTCAAAATTACATCCAATATTTG
GATTTATTGTTATCATTTTATTTCTCATAAATCCTTTTATTGCTCTTTGT
CGATGCCAAGTACGACACAAAAATCGACCTATTTTCAATTGGATCCACTT
TATTGTTGGGATAATTGCTTATATTCTCAGTATTCCGACAATTATGATTG
GGCTTAAACTACCTGGAGCTGGACTAAAACTTTCTCATTTAAACTTCCCT
CAATGGATCATTTTTATATTTGTTATATGTCAAGTAATTCTTGAAATAAT
TCTCGAAATACATGGATGTATGACTTATAGACCAAATAAAGATAAACGTC
ACAATTACGAACTGGAGAAAAATGAATACGAAAAAGCTGTACAACTGAAT
TATAAGCCAGATCATATTCCTAAACAACCCAGAATAAAAGATCGAAATTT
TAGGTTACTGATTTTGGGCTTTTATATTTTTTTATGTATTATAGTTACAC
TGGCACTCTGTATTATAATAATAGTTTATTGACATGTATGTTTTAAATAT
TTTGAAAAATTATTGTTATT
back to top

protein sequence of SMED30009212-orf-1

>SMED30009212-orf-1 ID=SMED30009212-orf-1|Name=SMED30009212-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=467bp
MKLLFLITSLLCYSSAVIQVSFQKCAVSKACFKSTKACSEDQCDYIVTWK
SVKYNEKSYLEIEMTGTVLSTGGYIAVGFSVDKLMGDDGVVACYASPGTS
EINIVAGYNEISKRSNKILTNKQLDKDFLVTNGPNYGGNFNRDIRRLSCR
FLRLVTPEKNADNLKDLSQGRRYYLLIAKGSDVGENGLNKHFPGSNVVSE
TSIDFTSGSFNSVIGSSKINSPLAKAHGIIMIIAWMTCCSIAVFIARYYK
DVWNRNPIKEGSWFNPHRGLQSCGFVLIVIALIIIIVHVGGYSKLMEYPS
KLHPIFGFIVIILFLINPFIALCRCQVRHKNRPIFNWIHFIVGIIAYILS
IPTIMIGLKLPGAGLKLSHLNFPQWIIFIFVICQVILEIILEIHGCMTYR
PNKDKRHNYELEKNEYEKAVQLNYKPDHIPKQPRIKDRNFRLLILGFYIF
LCIIVTLALCIIIIVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006593Cyt_b561/ferric_Rdtase_TM
IPR005018DOMON_domain
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006593Cytochrome b561/ferric reductase transmembraneSMARTSM00665561_7coord: 226..358
e-value: 1.7E-23
score: 94.1
IPR006593Cytochrome b561/ferric reductase transmembranePFAMPF03188Cytochrom_B561coord: 227..358
e-value: 1.1E-10
score: 41.7
IPR006593Cytochrome b561/ferric reductase transmembranePROSITEPS50939CYTOCHROME_B561coord: 194..396
score: 21.948
NoneNo IPR availableGENE3DG3DSA:1.20.120.1770coord: 205..399
e-value: 1.7E-5
score: 26.1
NoneNo IPR availablePANTHERPTHR45828FAMILY NOT NAMEDcoord: 18..404
NoneNo IPR availablePANTHERPTHR45828:SF3FERRIC-CHELATE REDUCTASE 1coord: 18..404
NoneNo IPR availableCDDcd08760Cyt_b561_FRRS1_likecoord: 199..393
e-value: 9.64493E-35
score: 126.305
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.744
NoneNo IPR availableTMHMMTMhelixcoord: 443..465
NoneNo IPR availableTMHMMTMhelixcoord: 270..292
NoneNo IPR availableTMHMMTMhelixcoord: 371..393
NoneNo IPR availableTMHMMTMhelixcoord: 302..321
NoneNo IPR availableTMHMMTMhelixcoord: 227..249
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
IPR005018DOMON domainPFAMPF03351DOMONcoord: 42..180
e-value: 8.9E-9
score: 35.6
IPR005018DOMON domainPROSITEPS50836DOMONcoord: 43..180
score: 15.12