musculin

Overview
Namemusculin (AGZ94913.1)
Smed IDSMED30009207
Length (bp)925
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of musculin (SMED30009207) t-SNE clustered cells

Violin plots show distribution of expression levels for musculin (SMED30009207) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of musculin (SMED30009207) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for musculin (SMED30009207) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009207

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30009207h1SMcG0004451 SmedASXL_004619SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
anterior pole progenitor cellSMED30009207h1SMcG0004451 SMED30009207smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009207h1SMcG0004451 dd_Smed_v4_16070_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30009207h1SMcG0004451 KF487098smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30009207h1SMcG0004451 KF487098smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30009207h1SMcG0004451 KF487098smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30009207h1SMcG0004451 KF487098smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of musculin vs. Ensembl Human
Match: MSC (musculin [Source:HGNC Symbol;Acc:HGNC:7321])

HSP 1 Score: 63.929 bits (154), Expect = 1.988e-11
Identity = 43/66 (65.15%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  413 GANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
             A    +QR+AAN+RER+RMRVLS AF  LK++LPWVP DTKLSKLDTL+LA+ YIA+L+ +L ED
Sbjct:  101 AAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQED 166          
BLAST of musculin vs. Ensembl Human
Match: TCF21 (transcription factor 21 [Source:HGNC Symbol;Acc:HGNC:11632])

HSP 1 Score: 63.1586 bits (152), Expect = 2.035e-11
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   80 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. Ensembl Human
Match: TCF21 (transcription factor 21 [Source:HGNC Symbol;Acc:HGNC:11632])

HSP 1 Score: 63.1586 bits (152), Expect = 2.035e-11
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   80 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. Ensembl Zebrafish
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:558148])

HSP 1 Score: 65.4698 bits (158), Expect = 2.028e-12
Identity = 46/80 (57.50%), Postives = 58/80 (72.50%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMV 673
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D  G     P    ++  P+MV
Sbjct:   77 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYGNGYIHP---VNLTWPFMV 153          
BLAST of musculin vs. Ensembl Zebrafish
Match: msc (musculin (activated B-cell factor-1) [Source:ZFIN;Acc:ZDB-GENE-090806-3])

HSP 1 Score: 63.5438 bits (153), Expect = 6.873e-12
Identity = 42/69 (60.87%), Postives = 55/69 (79.71%), Query Frame = 2
Query:  431 AQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPP 637
            +QR+AAN+RER+RMRVLS AF  LK++LPWVP DTKLSKLDTL+LA+ YI++L+ +L +D     L  P
Sbjct:   62 SQRNAANARERARMRVLSKAFSRLKTSLPWVPADTKLSKLDTLRLASSYISHLRQLLQDDTYHNNLAHP 130          
BLAST of musculin vs. Ensembl Zebrafish
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:558148])

HSP 1 Score: 63.1586 bits (152), Expect = 1.340e-11
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   77 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 135          
BLAST of musculin vs. Ensembl Xenopus
Match: msc (musculin [Source:NCBI gene;Acc:100124790])

HSP 1 Score: 66.6254 bits (161), Expect = 1.059e-12
Identity = 46/84 (54.76%), Postives = 61/84 (72.62%), Query Frame = 2
Query:  431 AQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSS 682
            +QR AAN+RER+RMRVLS AF  LK++LPWVP DTKLSKLDTL+LA+ YIA+L+ +L ED    +   P ++  +  PY  + S
Sbjct:   81 SQRHAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENSYVHPVNLVRMKLPYSQHQS 164          
BLAST of musculin vs. Ensembl Xenopus
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:100126209])

HSP 1 Score: 63.929 bits (154), Expect = 1.119e-11
Identity = 48/83 (57.83%), Postives = 58/83 (69.88%), Query Frame = 2
Query:  389 GKRRGRKPGANSTLA---------QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            GKRR + P   S L          QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   57 GKRR-KAPSKKSPLGNINQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. Ensembl Mouse
Match: Tcf21 (transcription factor 21 [Source:MGI Symbol;Acc:MGI:1202715])

HSP 1 Score: 63.1586 bits (152), Expect = 1.210e-11
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   80 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. Ensembl Mouse
Match: Tcf21 (transcription factor 21 [Source:MGI Symbol;Acc:MGI:1202715])

HSP 1 Score: 63.1586 bits (152), Expect = 1.317e-11
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   80 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. Ensembl Mouse
Match: Msc (musculin [Source:MGI Symbol;Acc:MGI:1333884])

HSP 1 Score: 63.5438 bits (153), Expect = 1.596e-11
Identity = 43/65 (66.15%), Postives = 54/65 (83.08%), Query Frame = 2
Query:  416 ANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            A    +QR+AAN+RER+RMRVLS AF  LK++LPWVP DTKLSKLDTL+LA+ YIA+L+ +L ED
Sbjct:   97 AECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQED 161          
BLAST of musculin vs. UniProt/SwissProt
Match: sp|A8E5T6|TCF21_XENTR (Transcription factor 21 OS=Xenopus tropicalis OX=8364 GN=tcf21 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.927e-11
Identity = 48/83 (57.83%), Postives = 58/83 (69.88%), Query Frame = 2
Query:  389 GKRRGRKPGANSTLA---------QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            GKRR + P   S L          QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   57 GKRR-KAPSKKSPLGNINQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. UniProt/SwissProt
Match: sp|Q6GNB7|TCF21_XENLA (Transcription factor 21 OS=Xenopus laevis OX=8355 GN=tcf21 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 7.725e-11
Identity = 46/80 (57.50%), Postives = 59/80 (73.75%), Query Frame = 2
Query:  371 PLLTVNGKRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            PL T+N  + G++        QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   68 PLGTIN--QEGKQ-------VQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. UniProt/SwissProt
Match: sp|O35437|TCF21_MOUSE (Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 9.215e-11
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   80 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 138          
BLAST of musculin vs. UniProt/SwissProt
Match: sp|O60682|MUSC_HUMAN (Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 9.549e-11
Identity = 43/66 (65.15%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  413 GANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
             A    +QR+AAN+RER+RMRVLS AF  LK++LPWVP DTKLSKLDTL+LA+ YIA+L+ +L ED
Sbjct:  101 AAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQED 166          
BLAST of musculin vs. UniProt/SwissProt
Match: sp|Q32PV5|TCF21_DANRE (Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 9.726e-11
Identity = 41/59 (69.49%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   77 QRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 135          
BLAST of musculin vs. TrEMBL
Match: U5YQC3 (Musculin (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 5.921e-85
Identity = 140/141 (99.29%), Postives = 140/141 (99.29%), Query Frame = 2
Query:  392 KRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELIDI 814
            KRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPKDTKLSKLDTLKLAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNT LQELIDI
Sbjct:    1 KRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPKDTKLSKLDTLKLAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTFLQELIDI 141          
BLAST of musculin vs. TrEMBL
Match: A0A023ZT92 (Musculin (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.715e-66
Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 2
Query:  470 MRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELIDID 817
            MRVLSSAFIDLKSALPWVPKDTKLSKLDTLKLAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELIDID
Sbjct:    1 MRVLSSAFIDLKSALPWVPKDTKLSKLDTLKLAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELIDID 116          
BLAST of musculin vs. TrEMBL
Match: G4VEB5 (Putative musculin OS=Schistosoma mansoni OX=6183 GN=Smp_022610 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.629e-26
Identity = 75/127 (59.06%), Postives = 89/127 (70.08%), Query Frame = 2
Query:  374 LLTVNGKRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKIN 754
            L+T NGKRRGRKPG NST+AQRSAAN+RERSRMRVLS AF++LK ALPWVPKDTKLSKLDTLKLAAGYIAYL+ +L    S T +  P           V  + +  I RT +  +    QSN ++N
Sbjct:   15 LITQNGKRRGRKPGLNSTVAQRSAANARERSRMRVLSGAFVELKGALPWVPKDTKLSKLDTLKLAAGYIAYLRRILDTSESHTIIARP----------SVEITEESRIIRTATSLKLSTSQSNFELN 131          
BLAST of musculin vs. TrEMBL
Match: A0A183KKL9 (BHLH domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS15580 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.615e-26
Identity = 76/145 (52.41%), Postives = 95/145 (65.52%), Query Frame = 2
Query:  374 LLTVNGKRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELI 808
            L+T NGKRRGRKPG NST+AQRSAAN+RERSRMRVLS AF++LK ALPWVPKDTKLSKLDTLKLAAGYIAYL+ +L    + T +  P           V  + +  + RT +  +    QSN ++N    + ++P    L  L 
Sbjct:   15 LITPNGKRRGRKPGLNSTVAQRSAANARERSRMRVLSGAFVELKGALPWVPKDTKLSKLDTLKLAAGYIAYLRRILDTSETHTIMARP----------SVEITEESRLVRTATSLKLSTSQSNFELNSNLHSNTLPDTIKLFNLF 149          
BLAST of musculin vs. TrEMBL
Match: A0A2H1C9D5 (Helix-loop-helix DNA-binding domain protein OS=Fasciola hepatica OX=6192 GN=D915_08809 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 8.320e-25
Identity = 65/84 (77.38%), Postives = 73/84 (86.90%), Query Frame = 2
Query:  350 TIVECPPPLLTVNGKRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVL 601
            T+   P  L+T  GKRRGRKPG NST+AQRSAAN+RERSRMRVLS AF++LK ALPWVPKDTKLSKLDTLKLAAGYIAYL+ +L
Sbjct:    4 TLTAGPGLLVTSGGKRRGRKPGLNSTVAQRSAANARERSRMRVLSGAFVELKGALPWVPKDTKLSKLDTLKLAAGYIAYLRRIL 87          
BLAST of musculin vs. Ensembl Cavefish
Match: msc (musculin [Source:NCBI gene;Acc:103036829])

HSP 1 Score: 66.2402 bits (160), Expect = 4.857e-13
Identity = 44/67 (65.67%), Postives = 53/67 (79.10%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPP 634
            QRSAAN+RER+RMRVL  AF  L++ LPWVP DTKLSKLDTL+LAA YI +L+ +L ED   +TL P
Sbjct:   56 QRSAANARERARMRVLGRAFTRLRTTLPWVPPDTKLSKLDTLRLAASYITHLRQLLQEDTHTSTLHP 122          
BLAST of musculin vs. Ensembl Cavefish
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:103031663])

HSP 1 Score: 65.0846 bits (157), Expect = 2.384e-12
Identity = 42/59 (71.19%), Postives = 50/59 (84.75%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LAA YIA+L+ +L  D
Sbjct:   83 QRNAANARERARMRVLSKAFSRLKTTLPWVPADTKLSKLDTLRLAASYIAHLRQILASD 141          
BLAST of musculin vs. Ensembl Cavefish
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:103040145])

HSP 1 Score: 47.7506 bits (112), Expect = 2.270e-6
Identity = 35/86 (40.70%), Postives = 55/86 (63.95%), Query Frame = 2
Query:  392 KRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVY 649
            KRR    G    + QR+AAN+RER R + +++AF  L++ +P  P D KLSK++TL+LA+ YI++L +VL+   +G    P  S +
Sbjct:   48 KRRRNTTGGVLIVKQRNAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLTGDAGEHAQPCLSAH 133          
BLAST of musculin vs. Ensembl Sea Lamprey
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:558148])

HSP 1 Score: 61.6178 bits (148), Expect = 1.004e-11
Identity = 39/60 (65.00%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  431 AQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
             QR+AAN+RER+RMRVLS AF  LK+ LPWVP DTKLSKLDTL+LA+ YI +L+ +L ++
Sbjct:   96 GQRNAANARERARMRVLSKAFSRLKTTLPWVPADTKLSKLDTLRLASSYIGHLRQILADE 155          
BLAST of musculin vs. Ensembl Sea Lamprey
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 44.2838 bits (103), Expect = 3.992e-6
Identity = 30/59 (50.85%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            QR+AAN RER RM  ++SAF +L+  +P  P + +LSK+DTL+LA  YIA L+ +L+ D
Sbjct:   34 QRTAANVRERRRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLRDILLSD 92          
BLAST of musculin vs. Ensembl Medaka
Match: tcf21 (transcription factor 21 [Source:NCBI gene;Acc:101172550])

HSP 1 Score: 63.5438 bits (153), Expect = 8.213e-12
Identity = 48/85 (56.47%), Postives = 60/85 (70.59%), Query Frame = 2
Query:  389 GKRRGRKPGANSTLA-----------QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVED 610
            GKRR  K G+  + A           QR+AAN+RER+RMRVLS AF  LK++LPWVP DTKLSKLDTL+LA+ YIA+L+ +L  D
Sbjct:   48 GKRR--KTGSRKSAAKGGAQQEGKQVQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQILAND 130          
BLAST of musculin vs. Ensembl Medaka
Match: msc (musculin [Source:NCBI gene;Acc:101174781])

HSP 1 Score: 59.6918 bits (143), Expect = 1.705e-10
Identity = 42/80 (52.50%), Postives = 60/80 (75.00%), Query Frame = 2
Query:  434 QRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMV 673
            QR+AAN+RER+RMRVLS AF  LK++LPWVP DTKLSKLDTL+LA+ YI++L+ +L +    ++   P    ++  P+M+
Sbjct:   71 QRNAANARERARMRVLSKAFSRLKTSLPWVPADTKLSKLDTLRLASSYISHLRQLLQDGRFESSFAHP---VNLTWPFMM 147          
BLAST of musculin vs. Planmine SMEST
Match: SMESG000018258.1 (SMESG000018258.1)

HSP 1 Score: 370.163 bits (949), Expect = 8.394e-131
Identity = 193/193 (100.00%), Postives = 193/193 (100.00%), Query Frame = 2
Query:  317 MSTVVVKKASLTIVECPPPLLTVNGKRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPXXXXXXXXXXXXXAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELIDIDSSTQLDSANNQTHHFFYRNNKTNYFL 895
            MSTVVVKKASLTIVECPPPLLTVNGKRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPKDTKLSKLDTLKLAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELIDIDSSTQLDSANNQTHHFFYRNNKTNYFL
Sbjct:    1 MSTVVVKKASLTIVECPPPLLTVNGKRRGRKPGANSTLAQRSAANSRERSRMRVLSSAFIDLKSALPWVPKDTKLSKLDTLKLAAGYIAYLKSVLVEDFSGTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTTNCSVPSNTLLQELIDIDSSTQLDSANNQTHHFFYRNNKTNYFL 193          
The following BLAST results are available for this feature:
BLAST of musculin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MSC1.988e-1165.15musculin [Source:HGNC Symbol;Acc:HGNC:7321][more]
TCF212.035e-1169.49transcription factor 21 [Source:HGNC Symbol;Acc:HG... [more]
TCF212.035e-1169.49transcription factor 21 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of musculin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of musculin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of musculin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tcf212.028e-1257.50transcription factor 21 [Source:NCBI gene;Acc:5581... [more]
msc6.873e-1260.87musculin (activated B-cell factor-1) [Source:ZFIN;... [more]
tcf211.340e-1169.49transcription factor 21 [Source:NCBI gene;Acc:5581... [more]
back to top
BLAST of musculin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
msc1.059e-1254.76musculin [Source:NCBI gene;Acc:100124790][more]
tcf211.119e-1157.83transcription factor 21 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of musculin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tcf211.210e-1169.49transcription factor 21 [Source:MGI Symbol;Acc:MGI... [more]
Tcf211.317e-1169.49transcription factor 21 [Source:MGI Symbol;Acc:MGI... [more]
Msc1.596e-1166.15musculin [Source:MGI Symbol;Acc:MGI:1333884][more]
back to top
BLAST of musculin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8E5T6|TCF21_XENTR5.927e-1157.83Transcription factor 21 OS=Xenopus tropicalis OX=8... [more]
sp|Q6GNB7|TCF21_XENLA7.725e-1157.50Transcription factor 21 OS=Xenopus laevis OX=8355 ... [more]
sp|O35437|TCF21_MOUSE9.215e-1169.49Transcription factor 21 OS=Mus musculus OX=10090 G... [more]
sp|O60682|MUSC_HUMAN9.549e-1165.15Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2[more]
sp|Q32PV5|TCF21_DANRE9.726e-1169.49Transcription factor 21 OS=Danio rerio OX=7955 GN=... [more]
back to top
BLAST of musculin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5YQC35.921e-8599.29Musculin (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A023ZT922.715e-66100.00Musculin (Fragment) OS=Schmidtea mediterranea OX=7... [more]
G4VEB52.629e-2659.06Putative musculin OS=Schistosoma mansoni OX=6183 G... [more]
A0A183KKL93.615e-2652.41BHLH domain-containing protein OS=Schistosoma cura... [more]
A0A2H1C9D58.320e-2577.38Helix-loop-helix DNA-binding domain protein OS=Fas... [more]
back to top
BLAST of musculin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
msc4.857e-1365.67musculin [Source:NCBI gene;Acc:103036829][more]
tcf212.384e-1271.19transcription factor 21 [Source:NCBI gene;Acc:1030... [more]
tcf152.270e-640.70transcription factor 15 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of musculin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tcf211.004e-1165.00transcription factor 21 [Source:NCBI gene;Acc:5581... [more]
si:dkey-34f9.33.992e-650.85si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
back to top
BLAST of musculin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of musculin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of musculin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tcf218.213e-1256.47transcription factor 21 [Source:NCBI gene;Acc:1011... [more]
msc1.705e-1052.50musculin [Source:NCBI gene;Acc:101174781][more]
back to top
BLAST of musculin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000018258.18.394e-131100.00SMESG000018258.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009207
GenBankAGZ94913.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009207 ID=SMED30009207|Name=musculin|organism=Schmidtea mediterranea sexual|type=transcript|length=925bp
AAAATAAGCATGTTGATAGTTTTTATTTCTAACCCTTGATAGCAAAAAGA
ACATATTTATAAATTAGAAAACAATGATGAAACTCCACCTGCATGATGCA
AACAAAACGGTAAACATTCTCAGTGTGCGTCATGGTGATTTAACGAGCGT
GTACTATGTCATCAATTTGATGATAAACAATCTCAGCAGGATTTAGTATC
AATTTCTTGATTCTTATTGGCTGGTGTGTTGCATCATTGAATATTTGCGA
TTGGTTGGGACACAATCATTAATAGTTTTATTTCGATTTTTAGCACCGAA
CCCTATTTAATTTATTATGTCAACAGTTGTAGTTAAAAAAGCATCATTAA
CCATTGTCGAATGTCCACCACCTCTTCTAACAGTTAATGGAAAACGTCGT
GGTCGTAAACCTGGTGCAAACAGTACACTTGCACAAAGAAGTGCCGCAAA
CTCAAGAGAAAGGTCTCGAATGAGAGTTTTATCAAGTGCATTTATCGATT
TGAAAAGTGCTCTACCATGGGTGCCTAAAGATACGAAACTTTCCAAACTC
GACACTCTTAAACTAGCAGCTGGATATATTGCTTATTTGAAGAGTGTTTT
AGTCGAAGATTTTTCAGGGACAACTTTACCACCTCCTTGGTCAGTGTATG
ATATTTATTCTCCATATATGGTTAACTCATCCAACAAGTGCCCAATACCA
AGGACATGGTCACCAACCCAGCATCAAAACTGTCAATCAAACATGAAAAT
TAACTGCCCTACAACTAACTGTTCAGTTCCAAGCAATACATTGCTCCAGG
AACTAATTGACATCGACTCTTCAACTCAGTTAGATTCTGCAAATAATCAG
ACTCATCATTTCTTTTATCGAAATAATAAGACAAATTATTTTTTATGAAA
TACAGATTTCGATTTTACAAAAAAA
back to top

protein sequence of SMED30009207-orf-1

>SMED30009207-orf-1 ID=SMED30009207-orf-1|Name=SMED30009207-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MSTVVVKKASLTIVECPPPLLTVNGKRRGRKPGANSTLAQRSAANSRERS
RMRVLSSAFIDLKSALPWVPKDTKLSKLDTLKLAAGYIAYLKSVLVEDFS
GTTLPPPWSVYDIYSPYMVNSSNKCPIPRTWSPTQHQNCQSNMKINCPTT
NCSVPSNTLLQELIDIDSSTQLDSANNQTHHFFYRNNKTNYFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0000420parapharyngeal region
PLANA:0002142parenchyma
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 45..97
e-value: 3.0E-13
score: 60.0
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 40..92
e-value: 6.6E-13
score: 48.4
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 39..91
score: 14.907
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 40..95
e-value: 1.03472E-14
score: 63.7723
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 33..96
e-value: 8.9E-19
score: 68.9
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 40..97
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..47
NoneNo IPR availablePANTHERPTHR23349:SF72HLH54Fcoord: 29..163
NoneNo IPR availablePANTHERPTHR23349BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, TWISTcoord: 29..163