FGFR4

Overview
NameFGFR4 (AFD29627.1)
Smed IDSMED30009204
Length (bp)2923
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FGFR4 (SMED30009204) t-SNE clustered cells

Violin plots show distribution of expression levels for FGFR4 (SMED30009204) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FGFR4 (SMED30009204) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FGFR4 (SMED30009204) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009204

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009204SMESG000054557.1 SmedASXL_016233SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009204SMESG000054557.1 SmedASXL_016233SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30009204SMESG000054557.1 dd_Smed_v4_11024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009204SMESG000054557.1 dd_Smed_v4_11024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009204SMESG000054557.1 dd_Smed_v4_11024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009204SMESG000054557.1 dd_Smed_v4_11024_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
sigma neoblastSMED30009204SMESG000054557.1 JQ425159.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30009204SMESG000054557.1 JQ425159.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30009204SMESG000054557.1 dd_Smed_v4_11024_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009204SMESG000054557.1 SMED30009204smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30009204SMESG000054557.1 SMED30009204smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30009204SMESG000054557.1 SMED_38138_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30009204SMESG000054557.1 SMED_38138_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FGFR4 vs. Ensembl Human
Match: FGFR4 (fibroblast growth factor receptor 4 [Source:HGNC Symbol;Acc:HGNC:3691])

HSP 1 Score: 288.5 bits (737), Expect = 7.004e-84
Identity = 146/300 (48.67%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEFPRD+L +  K LGEG FG V   E    D A+    + VAVKM++D+ SD ++ D V EME+MK IGRH N+I LLG+CTQ GPL VIVE A  GNLR+F+R++         +        L+  +L + ++Q+A GM YL SR  +HRDL+ARN+LV E   MKIADFGL R V +  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+GILLWEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+ +   RP F ++VE L  +L  +S+E
Sbjct:  415 PLDPLWEFPRDRL-VLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE 713          
BLAST of FGFR4 vs. Ensembl Human
Match: FGFR4 (fibroblast growth factor receptor 4 [Source:HGNC Symbol;Acc:HGNC:3691])

HSP 1 Score: 288.886 bits (738), Expect = 1.326e-83
Identity = 146/300 (48.67%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEFPRD+L +  K LGEG FG V   E    D A+    + VAVKM++D+ SD ++ D V EME+MK IGRH N+I LLG+CTQ GPL VIVE A  GNLR+F+R++         +        L+  +L + ++Q+A GM YL SR  +HRDL+ARN+LV E   MKIADFGL R V +  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+GILLWEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+ +   RP F ++VE L  +L  +S+E
Sbjct:  455 PLDPLWEFPRDRL-VLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE 753          
BLAST of FGFR4 vs. Ensembl Human
Match: FGFR4 (fibroblast growth factor receptor 4 [Source:HGNC Symbol;Acc:HGNC:3691])

HSP 1 Score: 288.886 bits (738), Expect = 1.326e-83
Identity = 146/300 (48.67%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEFPRD+L +  K LGEG FG V   E    D A+    + VAVKM++D+ SD ++ D V EME+MK IGRH N+I LLG+CTQ GPL VIVE A  GNLR+F+R++         +        L+  +L + ++Q+A GM YL SR  +HRDL+ARN+LV E   MKIADFGL R V +  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+GILLWEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+ +   RP F ++VE L  +L  +S+E
Sbjct:  455 PLDPLWEFPRDRL-VLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE 753          
BLAST of FGFR4 vs. Ensembl Human
Match: FGFR2 (fibroblast growth factor receptor 2 [Source:HGNC Symbol;Acc:HGNC:3689])

HSP 1 Score: 280.411 bits (716), Expect = 1.438e-82
Identity = 144/300 (48.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPRDKL +  K LGEG FG V   E +  D  K      VAVKM++DD ++ ++ D V EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E +T   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E+  MKIADFGL R ++   YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   ++E
Sbjct:  241 PEDPKWEFPRDKLTL-GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNE 539          
BLAST of FGFR4 vs. Ensembl Human
Match: FGFR2 (fibroblast growth factor receptor 2 [Source:HGNC Symbol;Acc:HGNC:3689])

HSP 1 Score: 283.108 bits (723), Expect = 1.887e-82
Identity = 145/305 (47.54%), Postives = 203/305 (66.56%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNI 2730
            P DP+WEFPRDKL +  K LGEG FG V   E +  D  K      VAVKM++DD ++ ++ D V EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E +T   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E+  MKIADFGL R ++   YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   ++E E+ +
Sbjct:  380 PEDPKWEFPRDKLTL-GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEEKKV 683          
BLAST of FGFR4 vs. Ensembl Celegans
Match: egl-15 (Myoblast growth factor receptor egl-15 [Source:UniProtKB/Swiss-Prot;Acc:Q10656])

HSP 1 Score: 238.81 bits (608), Expect = 2.558e-65
Identity = 138/311 (44.37%), Postives = 185/311 (59.49%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVY-----EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXX---------------------IENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDIL 2697
            DP WE  R KL + +  LGEGAFG V+     E   N+IA       VAVK ++    +  + D V EME  K IG H NV++L+G CT  GPL V+VEL  +GNLRDF+R+   K  K KK+                     I NLT   L  +++Q+A GM +LAS+ ++HRDL+ARN+LVG+ + +KI+DFGL+R V  + YYRK+ +G LP+KWMA EAL    YT +SDVWSYG+LLWEI TLG  PY +I   ++   +K+G++   P L   E+Y LM  CW    E RP F  IV+ L  +L
Sbjct:  578 DPVWEVERSKLSLVHM-LGEGAFGEVWKATYKETENNEIA-------VAVKKLKMSAHEKELIDLVSEMETFKVIGEHENVLRLIGCCTGAGPLYVVVELCKHGNLRDFLRAHRPKEEKAKKSSQELTDYLEPRKASDKDDIELIPNLTQRHLVQFAWQVAQGMNFLASKKIIHRDLAARNVLVGDGHVLKISDFGLSRDVHCNDYYRKRGNGRLPIKWMALEALDSNVYTVESDVWSYGVLLWEIMTLGGTPYPTIAMPELYANLKEGYRMEPPHLCPQEVYHLMCSCWREKLEERPSFKTIVDYLDWML 880          
BLAST of FGFR4 vs. Ensembl Celegans
Match: egl-15 (Myoblast growth factor receptor egl-15 [Source:UniProtKB/Swiss-Prot;Acc:Q10656])

HSP 1 Score: 238.81 bits (608), Expect = 2.558e-65
Identity = 138/311 (44.37%), Postives = 185/311 (59.49%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVY-----EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXX---------------------IENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDIL 2697
            DP WE  R KL + +  LGEGAFG V+     E   N+IA       VAVK ++    +  + D V EME  K IG H NV++L+G CT  GPL V+VEL  +GNLRDF+R+   K  K KK+                     I NLT   L  +++Q+A GM +LAS+ ++HRDL+ARN+LVG+ + +KI+DFGL+R V  + YYRK+ +G LP+KWMA EAL    YT +SDVWSYG+LLWEI TLG  PY +I   ++   +K+G++   P L   E+Y LM  CW    E RP F  IV+ L  +L
Sbjct:  578 DPVWEVERSKLSLVHM-LGEGAFGEVWKATYKETENNEIA-------VAVKKLKMSAHEKELIDLVSEMETFKVIGEHENVLRLIGCCTGAGPLYVVVELCKHGNLRDFLRAHRPKEEKAKKSSQELTDYLEPRKASDKDDIELIPNLTQRHLVQFAWQVAQGMNFLASKKIIHRDLAARNVLVGDGHVLKISDFGLSRDVHCNDYYRKRGNGRLPIKWMALEALDSNVYTVESDVWSYGVLLWEIMTLGGTPYPTIAMPELYANLKEGYRMEPPHLCPQEVYHLMCSCWREKLEERPSFKTIVDYLDWML 880          
BLAST of FGFR4 vs. Ensembl Celegans
Match: egl-15 (Myoblast growth factor receptor egl-15 [Source:UniProtKB/Swiss-Prot;Acc:Q10656])

HSP 1 Score: 238.81 bits (608), Expect = 2.558e-65
Identity = 138/311 (44.37%), Postives = 185/311 (59.49%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVY-----EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXX---------------------IENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDIL 2697
            DP WE  R KL + +  LGEGAFG V+     E   N+IA       VAVK ++    +  + D V EME  K IG H NV++L+G CT  GPL V+VEL  +GNLRDF+R+   K  K KK+                     I NLT   L  +++Q+A GM +LAS+ ++HRDL+ARN+LVG+ + +KI+DFGL+R V  + YYRK+ +G LP+KWMA EAL    YT +SDVWSYG+LLWEI TLG  PY +I   ++   +K+G++   P L   E+Y LM  CW    E RP F  IV+ L  +L
Sbjct:  578 DPVWEVERSKLSLVHM-LGEGAFGEVWKATYKETENNEIA-------VAVKKLKMSAHEKELIDLVSEMETFKVIGEHENVLRLIGCCTGAGPLYVVVELCKHGNLRDFLRAHRPKEEKAKKSSQELTDYLEPRKASDKDDIELIPNLTQRHLVQFAWQVAQGMNFLASKKIIHRDLAARNVLVGDGHVLKISDFGLSRDVHCNDYYRKRGNGRLPIKWMALEALDSNVYTVESDVWSYGVLLWEIMTLGGTPYPTIAMPELYANLKEGYRMEPPHLCPQEVYHLMCSCWREKLEERPSFKTIVDYLDWML 880          
BLAST of FGFR4 vs. Ensembl Celegans
Match: egl-15 (Myoblast growth factor receptor egl-15 [Source:UniProtKB/Swiss-Prot;Acc:Q10656])

HSP 1 Score: 238.81 bits (608), Expect = 2.558e-65
Identity = 138/311 (44.37%), Postives = 185/311 (59.49%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVY-----EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXX---------------------IENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDIL 2697
            DP WE  R KL + +  LGEGAFG V+     E   N+IA       VAVK ++    +  + D V EME  K IG H NV++L+G CT  GPL V+VEL  +GNLRDF+R+   K  K KK+                     I NLT   L  +++Q+A GM +LAS+ ++HRDL+ARN+LVG+ + +KI+DFGL+R V  + YYRK+ +G LP+KWMA EAL    YT +SDVWSYG+LLWEI TLG  PY +I   ++   +K+G++   P L   E+Y LM  CW    E RP F  IV+ L  +L
Sbjct:  578 DPVWEVERSKLSLVHM-LGEGAFGEVWKATYKETENNEIA-------VAVKKLKMSAHEKELIDLVSEMETFKVIGEHENVLRLIGCCTGAGPLYVVVELCKHGNLRDFLRAHRPKEEKAKKSSQELTDYLEPRKASDKDDIELIPNLTQRHLVQFAWQVAQGMNFLASKKIIHRDLAARNVLVGDGHVLKISDFGLSRDVHCNDYYRKRGNGRLPIKWMALEALDSNVYTVESDVWSYGVLLWEIMTLGGTPYPTIAMPELYANLKEGYRMEPPHLCPQEVYHLMCSCWREKLEERPSFKTIVDYLDWML 880          
BLAST of FGFR4 vs. Ensembl Celegans
Match: egl-15 (Myoblast growth factor receptor egl-15 [Source:UniProtKB/Swiss-Prot;Acc:Q10656])

HSP 1 Score: 238.81 bits (608), Expect = 2.558e-65
Identity = 138/311 (44.37%), Postives = 185/311 (59.49%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVY-----EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXX---------------------IENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDIL 2697
            DP WE  R KL + +  LGEGAFG V+     E   N+IA       VAVK ++    +  + D V EME  K IG H NV++L+G CT  GPL V+VEL  +GNLRDF+R+   K  K KK+                     I NLT   L  +++Q+A GM +LAS+ ++HRDL+ARN+LVG+ + +KI+DFGL+R V  + YYRK+ +G LP+KWMA EAL    YT +SDVWSYG+LLWEI TLG  PY +I   ++   +K+G++   P L   E+Y LM  CW    E RP F  IV+ L  +L
Sbjct:  578 DPVWEVERSKLSLVHM-LGEGAFGEVWKATYKETENNEIA-------VAVKKLKMSAHEKELIDLVSEMETFKVIGEHENVLRLIGCCTGAGPLYVVVELCKHGNLRDFLRAHRPKEEKAKKSSQELTDYLEPRKASDKDDIELIPNLTQRHLVQFAWQVAQGMNFLASKKIIHRDLAARNVLVGDGHVLKISDFGLSRDVHCNDYYRKRGNGRLPIKWMALEALDSNVYTVESDVWSYGVLLWEIMTLGGTPYPTIAMPELYANLKEGYRMEPPHLCPQEVYHLMCSCWREKLEERPSFKTIVDYLDWML 880          
BLAST of FGFR4 vs. Ensembl Fly
Match: btl (gene:FBgn0285896 transcript:FBtr0100676)

HSP 1 Score: 278.485 bits (711), Expect = 1.193e-78
Identity = 142/309 (45.95%), Postives = 196/309 (63.43%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTF--TKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXX------------XIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVD--YYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSIL-PEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEP 2718
            P D  WE PR +L +    LGEGAFG V       + + P    T VAVKM++++ +D+++   V+EME+MK IG+H N+I LLG C+Q GPL VIVE AP+GNL+DF++       +++             + ++L    L+ ++FQIA GM YLASR  +HRDL+ARN+LV + Y MKIADFGL R +    YYRK T+G LP+KWMAPE+L EKKY ++SDVWSYG+LLWEI T GD PY  IL  E++   +  G +  +P   +  IY +M+ CW+  +  RP F E+VE+   ILQ+ S  P
Sbjct:  700 PLDSNWEIPRQQLSL-GSILGEGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEHTDTDMASLVREMEVMKMIGKHINIINLLGCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFESCARPTFAELVESFDGILQQASSNP 1007          
BLAST of FGFR4 vs. Ensembl Fly
Match: btl (gene:FBgn0285896 transcript:FBtr0075778)

HSP 1 Score: 278.485 bits (711), Expect = 1.193e-78
Identity = 142/309 (45.95%), Postives = 196/309 (63.43%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTF--TKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXX------------XIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVD--YYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSIL-PEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEP 2718
            P D  WE PR +L +    LGEGAFG V       + + P    T VAVKM++++ +D+++   V+EME+MK IG+H N+I LLG C+Q GPL VIVE AP+GNL+DF++       +++             + ++L    L+ ++FQIA GM YLASR  +HRDL+ARN+LV + Y MKIADFGL R +    YYRK T+G LP+KWMAPE+L EKKY ++SDVWSYG+LLWEI T GD PY  IL  E++   +  G +  +P   +  IY +M+ CW+  +  RP F E+VE+   ILQ+ S  P
Sbjct:  700 PLDSNWEIPRQQLSL-GSILGEGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEHTDTDMASLVREMEVMKMIGKHINIINLLGCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFESCARPTFAELVESFDGILQQASSNP 1007          
BLAST of FGFR4 vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083550)

HSP 1 Score: 265.774 bits (678), Expect = 3.375e-76
Identity = 140/302 (46.36%), Postives = 187/302 (61.92%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFV---------RXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSIL-PEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISD 2712
            P D  WE PR  L +    LGEGAFG V     N+         VAVKM+++  +D ++   V+EME+MK IGRH N+I LLG C+QNGPL VIVE AP+GNL+DF+         + +++           +T   L  ++ QIA GM YLASR  +HRDL+ARN+LV + Y +KIADFGL R +    YYRK T+G LP+KWMAPE+L EK Y +KSDVWSYGILLWEI T G  PY +I+  E++   +  G +  +P   +  IY LM+ CW+ + ++RP F EIVE +  +LQ   D
Sbjct:  404 PLDSNWELPRSHL-VLGATLGEGAFGRVVMAEVNNAI-------VAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKED 697          
BLAST of FGFR4 vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083549)

HSP 1 Score: 265.774 bits (678), Expect = 3.375e-76
Identity = 140/302 (46.36%), Postives = 187/302 (61.92%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFV---------RXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSIL-PEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISD 2712
            P D  WE PR  L +    LGEGAFG V     N+         VAVKM+++  +D ++   V+EME+MK IGRH N+I LLG C+QNGPL VIVE AP+GNL+DF+         + +++           +T   L  ++ QIA GM YLASR  +HRDL+ARN+LV + Y +KIADFGL R +    YYRK T+G LP+KWMAPE+L EK Y +KSDVWSYGILLWEI T G  PY +I+  E++   +  G +  +P   +  IY LM+ CW+ + ++RP F EIVE +  +LQ   D
Sbjct:  404 PLDSNWELPRSHL-VLGATLGEGAFGRVVMAEVNNAI-------VAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKED 697          
BLAST of FGFR4 vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083548)

HSP 1 Score: 265.774 bits (678), Expect = 3.375e-76
Identity = 140/302 (46.36%), Postives = 187/302 (61.92%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFV---------RXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSIL-PEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISD 2712
            P D  WE PR  L +    LGEGAFG V     N+         VAVKM+++  +D ++   V+EME+MK IGRH N+I LLG C+QNGPL VIVE AP+GNL+DF+         + +++           +T   L  ++ QIA GM YLASR  +HRDL+ARN+LV + Y +KIADFGL R +    YYRK T+G LP+KWMAPE+L EK Y +KSDVWSYGILLWEI T G  PY +I+  E++   +  G +  +P   +  IY LM+ CW+ + ++RP F EIVE +  +LQ   D
Sbjct:  404 PLDSNWELPRSHL-VLGATLGEGAFGRVVMAEVNNAI-------VAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKED 697          
BLAST of FGFR4 vs. Ensembl Zebrafish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 273.092 bits (697), Expect = 1.495e-82
Identity = 143/298 (47.99%), Postives = 191/298 (64.09%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRIS 2709
            P DP+WEF R KL +  K LGEG FG V   E +  D  K      VAVKM++DD +D ++ D V EME+MK IG+H N+I LLG CTQ+GPL V+VE A  GNLR+++R++         +      E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWSYG+LLWEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE    +L   S
Sbjct:   30 PSDPKWEFTRTKLTL-GKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDHDRVLSMTS 326          
BLAST of FGFR4 vs. Ensembl Zebrafish
Match: fgfr1a (fibroblast growth factor receptor 1a [Source:NCBI gene;Acc:30705])

HSP 1 Score: 280.026 bits (715), Expect = 1.368e-81
Identity = 139/300 (46.33%), Postives = 197/300 (65.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFG--MVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXX-----XXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE  RD+L +  K LGEG FG  M+ E +  D  K    TKVAVKM++ D ++ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R +     +      +  +EN++   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L   L   S++
Sbjct:  339 PQDPRWEVQRDRL-VLGKPLGEGCFGQVMMAEAMGMDKEKPNRITKVAVKMLKSDATEKDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPLYVIVEFAAKGNLREYLRVRRPPGMEYCYNPDQVPVENMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDRPSTCTHELYMMMRDCWHAVPSQRPTFKQLVEDLDRTLSMTSNQ 637          
BLAST of FGFR4 vs. Ensembl Zebrafish
Match: fgfr1a (fibroblast growth factor receptor 1a [Source:NCBI gene;Acc:30705])

HSP 1 Score: 280.026 bits (715), Expect = 1.368e-81
Identity = 139/300 (46.33%), Postives = 197/300 (65.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFG--MVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXX-----XXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE  RD+L +  K LGEG FG  M+ E +  D  K    TKVAVKM++ D ++ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R +     +      +  +EN++   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L   L   S++
Sbjct:  339 PQDPRWEVQRDRL-VLGKPLGEGCFGQVMMAEAMGMDKEKPNRITKVAVKMLKSDATEKDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPLYVIVEFAAKGNLREYLRVRRPPGMEYCYNPDQVPVENMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDRPSTCTHELYMMMRDCWHAVPSQRPTFKQLVEDLDRTLSMTSNQ 637          
BLAST of FGFR4 vs. Ensembl Zebrafish
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 279.641 bits (714), Expect = 5.398e-81
Identity = 147/300 (49.00%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEF RDKL +  K LGEG FG V   E L  D  K      VAVKM++DD ++ ++ D V EME+MK IGRH N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+  + +RP F ++VE L  IL   ++E
Sbjct:  399 PEDPRWEFSRDKLTL-GKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLVSCTYQVARGMEYLASQKCIHRDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMKDCWHAISSHRPTFKQLVEDLDRILTLATNE 697          
BLAST of FGFR4 vs. Ensembl Zebrafish
Match: fgfr1a (fibroblast growth factor receptor 1a [Source:NCBI gene;Acc:30705])

HSP 1 Score: 280.411 bits (716), Expect = 9.906e-81
Identity = 139/300 (46.33%), Postives = 197/300 (65.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFG--MVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXX-----XXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE  RD+L +  K LGEG FG  M+ E +  D  K    TKVAVKM++ D ++ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R +     +      +  +EN++   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L   L   S++
Sbjct:  452 PQDPRWEVQRDRL-VLGKPLGEGCFGQVMMAEAMGMDKEKPNRITKVAVKMLKSDATEKDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPLYVIVEFAAKGNLREYLRVRRPPGMEYCYNPDQVPVENMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDRPSTCTHELYMMMRDCWHAVPSQRPTFKQLVEDLDRTLSMTSNQ 750          
BLAST of FGFR4 vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:549077])

HSP 1 Score: 276.559 bits (706), Expect = 7.780e-80
Identity = 140/300 (46.67%), Postives = 196/300 (65.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILS-----TYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P D +WEFPRD+L +  K LGEG FG V   EG   D  +      VAVKM++D+ +D ++ D + EME+MK IG+H N+I LLG+CTQ GPL VIVE A  GNLR+F+R++     +   +I  +   +LS     + ++Q+A GM YL S+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K ++G LPVKWMAPEAL ++ YT +SD+WS+G+L WEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+     RP F ++VE L  IL  +S+E
Sbjct:  384 PLDAKWEFPRDRL-VLGKPLGEGCFGQVVRAEGYGIDKERPEKPVTVAVKMLKDNGTDKDLSDLISEMELMKVIGKHKNIINLLGVCTQEGPLFVIVEYASKGNLREFLRARRPPTPEDAFDITKVPEELLSFKDLVSCAYQVARGMEYLESKRCIHRDLAARNVLVAEDNVMKIADFGLARGVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDIWSFGVLTWEIFTLGGSPYPGIPVEELFKLLREGHRMDKPSNCTHELYMLMRECWHAVPSQRPTFKQLVEQLDRILTAVSEE 682          
BLAST of FGFR4 vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 273.863 bits (699), Expect = 1.141e-79
Identity = 142/300 (47.33%), Postives = 195/300 (65.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILS-----TYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE  RD+L I  K LGEG FG V   E +  D  K    TKVAVKM++ D S+ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   N       +LS     + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   S++
Sbjct:  292 PEDPRWEVARDRL-ILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDASEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVEDLDRILALSSNQ 590          
BLAST of FGFR4 vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 273.863 bits (699), Expect = 1.476e-79
Identity = 142/300 (47.33%), Postives = 195/300 (65.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILS-----TYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE  RD+L I  K LGEG FG V   E +  D  K    TKVAVKM++ D S+ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   N       +LS     + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   S++
Sbjct:  303 PEDPRWEVARDRL-ILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDASEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVEDLDRILALSSNQ 601          
BLAST of FGFR4 vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 273.863 bits (699), Expect = 1.848e-79
Identity = 142/300 (47.33%), Postives = 195/300 (65.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILS-----TYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE  RD+L I  K LGEG FG V   E +  D  K    TKVAVKM++ D S+ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   N       +LS     + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   S++
Sbjct:  320 PEDPRWEVARDRL-ILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDASEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVEDLDRILALSSNQ 618          
BLAST of FGFR4 vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:549077])

HSP 1 Score: 276.559 bits (706), Expect = 3.042e-79
Identity = 140/300 (46.67%), Postives = 196/300 (65.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILS-----TYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P D +WEFPRD+L +  K LGEG FG V   EG   D  +      VAVKM++D+ +D ++ D + EME+MK IG+H N+I LLG+CTQ GPL VIVE A  GNLR+F+R++     +   +I  +   +LS     + ++Q+A GM YL S+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K ++G LPVKWMAPEAL ++ YT +SD+WS+G+L WEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+     RP F ++VE L  IL  +S+E
Sbjct:  450 PLDAKWEFPRDRL-VLGKPLGEGCFGQVVRAEGYGIDKERPEKPVTVAVKMLKDNGTDKDLSDLISEMELMKVIGKHKNIINLLGVCTQEGPLFVIVEYASKGNLREFLRARRPPTPEDAFDITKVPEELLSFKDLVSCAYQVARGMEYLESKRCIHRDLAARNVLVAEDNVMKIADFGLARGVHDIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDIWSFGVLTWEIFTLGGSPYPGIPVEELFKLLREGHRMDKPSNCTHELYMLMRECWHAVPSQRPTFKQLVEQLDRILTAVSEE 748          
BLAST of FGFR4 vs. Ensembl Mouse
Match: Fgfr2 (fibroblast growth factor receptor 2 [Source:MGI Symbol;Acc:MGI:95523])

HSP 1 Score: 281.182 bits (718), Expect = 8.519e-83
Identity = 144/300 (48.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPRDKL +  K LGEG FG V   E +  D  K      VAVKM++DD ++ ++ D V EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E +T   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E+  MKIADFGL R ++   YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   ++E
Sbjct:  257 PEDPKWEFPRDKLTL-GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNE 555          
BLAST of FGFR4 vs. Ensembl Mouse
Match: Fgfr2 (fibroblast growth factor receptor 2 [Source:MGI Symbol;Acc:MGI:95523])

HSP 1 Score: 281.182 bits (718), Expect = 9.019e-83
Identity = 144/300 (48.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPRDKL +  K LGEG FG V   E +  D  K      VAVKM++DD ++ ++ D V EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E +T   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E+  MKIADFGL R ++   YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   ++E
Sbjct:  256 PEDPKWEFPRDKLTL-GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNE 554          
BLAST of FGFR4 vs. Ensembl Mouse
Match: Fgfr4 (fibroblast growth factor receptor 4 [Source:MGI Symbol;Acc:MGI:95525])

HSP 1 Score: 285.419 bits (729), Expect = 1.338e-82
Identity = 145/300 (48.33%), Postives = 197/300 (65.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEFPRD+L +  K LGEG FG V   E    D ++    + VAVKM++D+ SD ++ D V EME+MK IGRH N+I LLG+CTQ GPL VIVE A  GNLR+F+R++         +        L+   L + ++Q+A GM YL SR  +HRDL+ARN+LV E   MKIADFGL R V +  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+GILLWEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+ +   RP F ++VE L  +L  +S+E
Sbjct:  452 PLDPLWEFPRDRL-VLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE 750          
BLAST of FGFR4 vs. Ensembl Mouse
Match: Fgfr2 (fibroblast growth factor receptor 2 [Source:MGI Symbol;Acc:MGI:95523])

HSP 1 Score: 280.796 bits (717), Expect = 8.256e-82
Identity = 144/300 (48.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPRDKL +  K LGEG FG V   E +  D  K      VAVKM++DD ++ ++ D V EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E +T   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E+  MKIADFGL R ++   YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   ++E
Sbjct:  355 PEDPKWEFPRDKLTL-GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNE 653          
BLAST of FGFR4 vs. Ensembl Mouse
Match: Fgfr2 (fibroblast growth factor receptor 2 [Source:MGI Symbol;Acc:MGI:95523])

HSP 1 Score: 280.796 bits (717), Expect = 8.400e-82
Identity = 144/300 (48.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPRDKL +  K LGEG FG V   E +  D  K      VAVKM++DD ++ ++ D V EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E +T   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E+  MKIADFGL R ++   YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   ++E
Sbjct:  353 PEDPKWEFPRDKLTL-GKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNE 651          
BLAST of FGFR4 vs. UniProt/SwissProt
Match: sp|Q8MY86|FGFR1_DUGJA (Fibroblast growth factor receptor 1 OS=Dugesia japonica OX=6161 GN=FGFR1 PE=2 SV=1)

HSP 1 Score: 912.909 bits (2358), Expect = 0.000e+0
Identity = 535/873 (61.28%), Postives = 642/873 (73.54%), Query Frame = 1
Query:  181 MSGXXXXXXXXXXXXGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQMTWLAMEWLKDGTFLGKKVXXXXXXXXXXXXXXXNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLL---EISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNK---RYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNXXXXXXXXXXXXXRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGXXXXXXXXXXXXXXXPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLKLDSDYLEP 2781
            MSGLFFLL ELLIL G++N+ SKK   C P + K++N LN RT  ++ L C   V+  C+ + L M W KD   LGKK++   KMKY Y+KK   ++D+GNYTC V N+ G SS+ +L+ VTE        ENFH   + +L   EIS    Y+HPEM   N  HV+    I + C+      +   +SWYQHS   +Y N ++L  D +  I +++ESC  Y + +I  D IC+ S   +I      ++  TC+IES+ + + K K+T+ +L+D    R  L F    TVC GSNFT+ C TN PRP+L ++KL P   ++   + L  S L     + DS RS +S      S+ FN SGRY C+++  +P    +E+M+L+V+ CS N        + S+ ++I       ++  +L  ++   FL   N    R HF IRKT+I+EYESPIYKSFINGTKNFKTDVLHTN LLPDSNPLLPPIIKIKPIKRLSQ +D  YGEQ PSTSTDRTRLESTR SQLEN+VFEC +G+NS+  KYGLR+SSS EFFSLYEFPCD +WEFPR+KLKITNKKLGEGAFGMVYEG+ NDI  +    KVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQ GPLRVIVELAPYGNLRDFVR+KN KYSK KK I N T+SIL TYS QIA GMTYLASRSVVHRDLSARNILVGEH+EMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGD+PYS+ILPEKVVD+I+KGFQNP+PELANFEIY LMQHCW++S+ENRP+FFEIVE L DI+QRI DEPE+NIYHSE+NYLK++SDYLEP
Sbjct:    1 MSGLFFLLSELLILLGKINSVSKKS-LCHPELFKIDNKLNWRTSEEMVLTCKAVVNEKCKKSKLQMRWYKDNELLGKKIERGLKMKYRYRKKL-KLNDSGNYTCFVFNKNGNSSVFFLINVTEK-------ENFHVNENKILDGSEISNNTLYLHPEMGMENY-HVIPNDEIVMQCRFFSPISINLTVSWYQHSCDSNYHNAQLLVKDSKFNISSNKESCQSYLS-HIPLDSICLYSWLRFIATSD-DQSCITCLIESDNNSIEKTKFTFTVLVDAG-HRPHLTFAPSSTVCQGSNFTMKCETNVPRPILYIYKLDPSFNIENPIIHLSNSTLFVNNYNEDSKRSSQSAEVLIKSMDFNYSGRYLCSLA-ELP---LFEIMHLSVIKCSNNFF------MNSVPLSIFLVIGFFVAIILLSLIIYCFFLQYKNAVDSRKHFSIRKTVIVEYESPIYKSFINGTKNFKTDVLHTNSLLPDSNPLLPPIIKIKPIKRLSQFRDGNYGEQLPSTSTDRTRLESTRHSQLENEVFECGSGNNSLSLKYGLRKSSSFEFFSLYEFPCDAKWEFPREKLKITNKKLGEGAFGMVYEGIANDIGNRSNPIKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQKGPLRVIVELAPYGNLRDFVRAKNKKYSKSKKIIGNFTSSILCTYSLQIARGMTYLASRSVVHRDLSARNILVGEHFEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDSPYSAILPEKVVDLIRKGFQNPKPELANFEIYRLMQHCWSLSSENRPNFFEIVEILIDIIQRIDDEPEENIYHSELNYLKMESDYLEP 850          
BLAST of FGFR4 vs. UniProt/SwissProt
Match: sp|P22455|FGFR4_HUMAN (Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4 PE=1 SV=2)

HSP 1 Score: 288.886 bits (738), Expect = 6.367e-83
Identity = 146/300 (48.67%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEFPRD+L +  K LGEG FG V   E    D A+    + VAVKM++D+ SD ++ D V EME+MK IGRH N+I LLG+CTQ GPL VIVE A  GNLR+F+R++         +        L+  +L + ++Q+A GM YL SR  +HRDL+ARN+LV E   MKIADFGL R V +  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+GILLWEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+ +   RP F ++VE L  +L  +S+E
Sbjct:  455 PLDPLWEFPRDRL-VLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE 753          
BLAST of FGFR4 vs. UniProt/SwissProt
Match: sp|Q498D6|FGFR4_RAT (Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.065e-81
Identity = 145/300 (48.33%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEFPRD+L +  K LGEG FG V   E L  D ++    + VAVKM++D+ SD ++ D + EME+MK IGRH N+I LLG+CTQ GPL VIVE A  GNLR+F+R++         +        L+   L + ++Q+A GM YL SR  +HRDL+ARN+LV E   MKIADFGL R V +  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+GILLWEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+ +   RP F ++VE L  +L  +S+E
Sbjct:  453 PLDPLWEFPRDRL-VLGKPLGEGCFGQVVRAEALGMDSSRPDQTSTVAVKMLKDNASDKDLADLISEMEMMKLIGRHKNIINLLGVCTQEGPLYVIVEYAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE 751          
BLAST of FGFR4 vs. UniProt/SwissProt
Match: sp|Q26614|FGFR_STRPU (Fibroblast growth factor receptor OS=Strongylocentrotus purpuratus OX=7668 GN=FGFR PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.315e-81
Identity = 148/317 (46.69%), Postives = 200/317 (63.09%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDI-----------LQRISDEPEQNIYHSE 2742
            P DPEWEFPRD+L +  K +GEGAFG V  G    I  +   + VAVKM++ +  D    D + E+ +MK IG++PN+I LLG CTQ GP  VIVE A +GNLRDF+RS+      +K  +    + LT   L + ++Q+A GM +LAS+  +HRDL+ARN+LV E +EMKI DFGL R + Y  +YRK TDG LPVKWMAPEAL ++ +TT+SDVWS+GILLWEI TLG  PY S+  E++ D ++ G +  +P+  + EIY ++  CW  S   RP F E+VE L  I           L+ + D P +    SE
Sbjct:  627 PLDPEWEFPRDRLTV-GKTIGEGAFGKVVIGEAVGIVCQEKTSTVAVKMLKANAMDREFSDLISELAMMKMIGKNPNIINLLGCCTQEGPPYVIVEFAHHGNLRDFLRSRRPPEEYEKSILLTTSQTLTNKDLMSMAYQVARGMDFLASKKCIHRDLAARNVLVTEDFEMKICDFGLARDIHYIDFYRKTTDGRLPVKWMAPEALFDRMFTTQSDVWSFGILLWEIMTLGGTPYPSVPVEQMFDYLRSGKRLEKPQNTSLEIYHILCECWRTSPGQRPTFCELVEDLDRIISVSSNQDYLDLEAVGDAPVKTFQESE 942          
BLAST of FGFR4 vs. UniProt/SwissProt
Match: sp|Q03142|FGFR4_MOUSE (Fibroblast growth factor receptor 4 OS=Mus musculus OX=10090 GN=Fgfr4 PE=1 SV=3)

HSP 1 Score: 281.952 bits (720), Expect = 1.569e-80
Identity = 144/300 (48.00%), Postives = 196/300 (65.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEFPRD+L +  K LGEG FG V   E    D ++    + VAVKM++D+ SD ++ D V EME+MK IGRH N+I LLG+CTQ GPL VIVE A  GNLR+F+R++         +        L+   L + ++Q+A GM YL SR  +HRDL+ARN+LV E   MKIADFGL R V +  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+ ILLWEIFTLG +PY  I  E++  ++++G +  +P     E+Y LM+ CW+ +   RP F ++VE L  +L  +S+E
Sbjct:  452 PLDPLWEFPRDRL-VLGKPLGEGCFGQVVRAEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE 750          
BLAST of FGFR4 vs. TrEMBL
Match: H9CXV6 (FGFR4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1603.57 bits (4151), Expect = 0.000e+0
Identity = 837/838 (99.88%), Postives = 838/838 (100.00%), Query Frame = 1
Query:  271 SMDKMNNDLNLRTDGKLELMCMVKVDISCQMTWLAMEWLKDGTFLGKKVXXXXXXXXXXXXXXXNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNXXXXXXXXXXXXXRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGXXXXXXXXXXXXXXXPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLKLDSDYLEPT 2784
            SMDKMNNDLNLRTDGKLELMCMVKVDISCQ+TWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLKLDSDYLEPT
Sbjct:    1 SMDKMNNDLNLRTDGKLELMCMVKVDISCQVTWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLKLDSDYLEPT 838          
BLAST of FGFR4 vs. TrEMBL
Match: T1G069 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20214467 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 6.256e-92
Identity = 157/300 (52.33%), Postives = 210/300 (70.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P D  WEFPR+KL++++  LGEGAFG VY    +  D +     TKVAVKM++++ SD +V D V+EME+MK IGRH NV+ LLG CTQNGPL VI+E A  GNLRDF+R K  K  + +  +     + LT   L T++ QIA GM +LAS+  +HRDL+ARN+LV E Y +K+ADFGLTR V    YY+KKTDG LPVKWMAPEAL ++K T KSDVWSYGILLWE+F+LG  PY S+  EK+  ++K G++   P  ++ EIYSLM  CW+ S ++RP F +IV +L  +L+ + ++
Sbjct:    6 PLDKAWEFPREKLQVSSI-LGEGAFGTVYMATAVGVDSSNPEASTKVAVKMLKENASDQDVVDLVQEMEMMKIIGRHKNVLSLLGCCTQNGPLFVILEYAANGNLRDFLRDKRPKNFRLQNCVVEVPLDYLTYKDLVTFALQIAKGMEFLASKMCIHRDLAARNVLVCEDYTLKVADFGLTRNVLKSDYYKKKTDGRLPVKWMAPEALFDRKCTVKSDVWSYGILLWELFSLGGNPYPSVPVEKIFQLLKAGYRMEAPVYSSNEIYSLMLSCWHQSPDHRPSFNKIVNSLHSVLRSVENQ 304          
BLAST of FGFR4 vs. TrEMBL
Match: V4ADF1 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_91761 PE=3 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 4.190e-90
Identity = 157/302 (51.99%), Postives = 203/302 (67.22%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXX---------------XXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDIL 2697
            P D +WEFPR++L +  ++LGEGAFG+V +     IA  P  T VAVKM++DD +D  + D ++EME+MK +G H N+I LLG CTQ GPL VIVE AP+GNLRDF++ +    S                    ++ LT   L ++S+QIA GM YL S+  +HRDL+ARNILV E Y +KIADFGLTR V +  YY+K TDG LPVKWMAPEAL +K+YT+KSDVWSYG+LLWE+FTLG  PY SI  E + D+++KG +  +P  A  EIYS+M  CWN S   RP F ++V TL  IL
Sbjct:  300 PLDADWEFPRERLGL-GERLGEGAFGLVMKAKAMGIANNPGQTTVAVKMLKDDSTDREMTDLMQEMEVMKVMGSHKNIINLLGCCTQRGPLFVIVEYAPHGNLRDFLKLRRPPNSTSCPSTPGYEKPVIDFNSVEVKPLTPKDLISFSYQIARGMEYLESKHCIHRDLAARNILVAEDYVLKIADFGLTRNVKHLDYYKKTTDGRLPVKWMAPEALFDKRYTSKSDVWSYGVLLWEVFTLGGNPYPSIPVEGLFDLLRKGHRMQKPPYAPSEIYSIMLQCWNDSPNVRPSFSQLVATLDTIL 600          
BLAST of FGFR4 vs. TrEMBL
Match: A0A1B6FVV8 (Protein kinase domain-containing protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.41022 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 6.749e-89
Identity = 151/300 (50.33%), Postives = 196/300 (65.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIEN------LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILP-EKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P D +WEFPRD+L +  K LGEGAFG V       I ++   T  AVKM+++  +D+ + D V EME+MK IG+H N+I LLG CTQ+GPL VIVE AP+GNLRDF+R        +     N      LT   L +++FQ+A GM YLASR  +HRDL+ARN+LV ++Y +KIADFGL R +    YYRK TDG LPVKWMAPEAL  + YTT+SDVWSYG+LLWEI TLG  PY S+   EK+  +++ G +  +P   + EIY LM+ CW+     RP F E+VE L  IL   ++E
Sbjct:    7 PLDCDWEFPRDQLTL-GKTLGEGAFGKVIRAEAQGILQQGIATVAAVKMLKEGHTDTEMMDLVSEMEMMKMIGKHRNIINLLGCCTQDGPLFVIVEFAPHGNLRDFLRQHRPSSGYEPAIGANVKDRNTLTQKDLVSFAFQVARGMEYLASRRCIHRDLAARNVLVSDNYILKIADFGLARDIHSHDYYRKTTDGRLPVKWMAPEALFHRVYTTQSDVWSYGVLLWEIMTLGGTPYPSVPSMEKLFQLLRSGHRMEKPPCCSLEIYMLMRDCWSYQPNERPMFSELVEDLDRILTITANE 305          
BLAST of FGFR4 vs. TrEMBL
Match: A0A0L8HUQ1 (Protein kinase domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22006379mg PE=3 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.477e-88
Identity = 149/302 (49.34%), Postives = 204/302 (67.55%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVR-----XXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQN 2727
            P D  WEF  D+L I  K+LG GAFG+V +     I        VAVKM+++D ++  + D V+EME+MK IG H N+I LLG CTQNGPL VIV  AP+GNLRDF+R      ++    ++     +LT   L ++ +Q+A GM YL S++ +HRDL+ARN+LV E+Y +KIADFGLTR +    YY+K T+G LPVKWMAPEAL +KKYTTKSDVWSYGIL WEIFTLG  PY SI  E++  +++ G++  QP  ++ E+YS+MQ CW    E+RP F  +V+ +  IL  + +EP+++
Sbjct:   30 PLDKNWEFSPDRL-IMGKQLGSGAFGVVVKAEAIGIGGCKGRVSVAVKMLKEDATERELADLVQEMEVMKVIGAHKNIINLLGCCTQNGPLMVIVVYAPHGNLRDFLRDHRPPVRSGDTYERPVATRSLTQKDLISFCYQVARGMEYLVSKNCIHRDLAARNVLVAENYVLKIADFGLTRHLQNIDYYKKTTNGRLPVKWMAPEALFDKKYTTKSDVWSYGILQWEIFTLGGNPYPSIPVEELFKLLRDGYRMEQPPYSSDEMYSIMQKCWTQKPEDRPTFSTLVQEIDKILTSLLNEPDES 330          
BLAST of FGFR4 vs. Ensembl Cavefish
Match: fgfr1a (fibroblast growth factor receptor 1a [Source:NCBI gene;Acc:30705])

HSP 1 Score: 283.108 bits (723), Expect = 1.854e-82
Identity = 142/300 (47.33%), Postives = 198/300 (66.00%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEG--LTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXX-----XXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE PRDKL +  K LGEG FG V  G  L  D  K    TKVAVKM++ D ++ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +      +  +EN++   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L   L   S++
Sbjct:  378 PQDPRWELPRDKL-VLGKPLGEGCFGQVVMGEVLGMDKDKPNRITKVAVKMLKSDATEKDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPLYVIVEFASKGNLREYLRARRPPGMEYCYNPDQVPVENMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDRPTTCTHELYMMMRDCWHAIPSQRPTFKQLVEDLDRTLSMTSNQ 676          
BLAST of FGFR4 vs. Ensembl Cavefish
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 276.944 bits (707), Expect = 8.522e-80
Identity = 146/300 (48.67%), Postives = 196/300 (65.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WEF RDKL +  K LGEG FG V   E L  D  K      VAVKM++DD ++ ++ D V EME+MK IGRH N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +   +I     E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     ++Y +M+ CW+  +  RP F ++VE L  IL   + E
Sbjct:  433 PEDPRWEFSRDKLTL-GKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLVSCTYQVARGMEYLASQKCIHRDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNDLYMMMKDCWHAISSQRPTFKQLVEDLDRILTLATHE 731          
BLAST of FGFR4 vs. Ensembl Cavefish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 277.33 bits (708), Expect = 1.320e-79
Identity = 144/300 (48.00%), Postives = 193/300 (64.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPR KL +  K LGEG FG V   E +  D  K      VAVKM++DD +D ++ D V EME+MK IG+H N+I LLG CTQ+GPL V+VE A  GNLR+++R++         +      E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWSYG+LLWEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE    +L   S +
Sbjct:  463 PSDPKWEFPRSKLTL-GKALGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDHDRVLSMTSTD 761          
BLAST of FGFR4 vs. Ensembl Cavefish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 277.33 bits (708), Expect = 1.363e-79
Identity = 144/300 (48.00%), Postives = 193/300 (64.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPR KL +  K LGEG FG V   E +  D  K      VAVKM++DD +D ++ D V EME+MK IG+H N+I LLG CTQ+GPL V+VE A  GNLR+++R++         +      E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWSYG+LLWEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE    +L   S +
Sbjct:  462 PSDPKWEFPRSKLTL-GKALGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDHDRVLSMTSTD 760          
BLAST of FGFR4 vs. Ensembl Cavefish
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:103029904])

HSP 1 Score: 276.174 bits (705), Expect = 2.101e-78
Identity = 141/300 (47.00%), Postives = 196/300 (65.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAK--KPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPR+ L +  K LGEG FG V       I K  +   T VAVKM++DD +D ++ D + EME+MK + +H N+I LLG+CTQ+GPL V+VE A  G+LR+++R++         ++     E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+L+WEIFTLG +PY  I  E++  ++K+G +  +P     E+Y  M+ CW+     RP F ++VE L  +L  ISDE
Sbjct:  582 PYDPDWEFPRENLTL-GKPLGEGCFGQVVRADAYGINKDNQDQATTVAVKMLKDDATDKDLADLISEMELMKGMDKHKNIINLLGVCTQDGPLYVLVEYASKGSLREYLRARRPPGMDYTFDVTKVPEEQLTFKDLLSCAYQVARGMEYLASKRCIHRDLAARNVLVTEDNVMKIADFGLARGVHQIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPSNCTHELYMKMRECWHAVPTQRPTFKQLVEELDRVLLSISDE 880          
BLAST of FGFR4 vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 282.337 bits (721), Expect = 7.023e-84
Identity = 143/299 (47.83%), Postives = 197/299 (65.89%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXX------XXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            DP WEF R+ L +  K LGEG FG V   E L  D  K     +VAVKM+++D +D +++D V EME+MK+IG+H N+I LLG CTQ GPL VIVE A  GNLR+F+R++                 E L+   L ++++Q+A GM YLAS+  +HRDL+ARN+LV +   MKIADFGL R V+Y  YY+K ++G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  I  E++  ++K+G +  +P L + E+Y +M+ CW     +RP F ++VE L  IL   + E
Sbjct:  266 DPRWEFSREWLTL-GKPLGEGCFGQVVMAEALGIDKEKPNRSLRVAVKMLKEDATDKDLYDLVSEMEMMKNIGKHKNIINLLGACTQGGPLYVIVEFAAKGNLREFLRARRPPGTEYTFEGAAAAQGEQLSIKELVSFTYQVARGMEYLASKKCIHRDLAARNVLVTDDNVMKIADFGLARDVNYIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDRPALCSTELYMMMKDCWAAVPSHRPTFKQLVEDLDRILTMTAQE 563          
BLAST of FGFR4 vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 252.292 bits (643), Expect = 2.482e-73
Identity = 134/268 (50.00%), Postives = 174/268 (64.93%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXX-------XXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIY 2613
            P DP WEFPRD+L +  K LGEG FG V   +GL  D  K      VAVKM++DD +D  + D V EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++                  E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT + DVWS+G+LLWEIFTLG +PY  I  E++  ++K+G +  +P     E+Y
Sbjct:  320 PEDPRWEFPRDRLTL-GKPLGEGCFGQVVMADGLGVDKEKPNKPATVAVKMLKDDATDKELSDLVSEMEVMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGVGYSFDPIGYSDPSEQLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQCDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPSNCPNELY 586          
BLAST of FGFR4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008763.1 (pep scaffold:Pmarinus_7.0:GL480478:1796:23946:1 gene:ENSPMAG00000007909.1 transcript:ENSPMAT00000008763.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 2.892e-66
Identity = 122/267 (45.69%), Postives = 172/267 (64.42%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQN-GPLRVIVELAPYGNLRDFVRX---------XXXXXXXXXXXIEN-----LTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYY----YRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPE 2592
            DP+WEFPR  L +  K LGEG FG V +     +  K  +T VAVKM+++  S S + D + E+ ++K +  HPN+I+L G CTQ+ GPL +IVE A YG+LR F+R               ++  + ++N     LT   L ++++QI+ GMTYLA   +VHRDL+ARN+LV E  +MKI+DFGL+R  D Y    Y K+T G +PVKWMA E+L E  YT++SDVWS+GILLWEI TLG  PY  I PE++ +++K G++  +PE
Sbjct:  198 DPKWEFPRKNLAL-GKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKECASHSELRDLLSELNLLKQV-NHPNIIRLHGACTQDEGPLYLIVEYAKYGSLRSFLRVRRKAEFAVPAGGASNRNSRLLDNPDERGLTLGDLVSFAWQISRGMTYLADMKLVHRDLAARNVLVAEGRKMKISDFGLSR--DVYEGDSYVKRTKGRIPVKWMAIESLFEHMYTSQSDVWSFGILLWEIMTLGGTPYPGIPPERLFNLLKTGYRMEKPE 460          
BLAST of FGFR4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 5.846e-59
Identity = 117/315 (37.14%), Postives = 177/315 (56.19%), Query Frame = 1
Query: 1855 EWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASI---------------LSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMN 2748
            EWE  RDK+K+  ++LG+G FGMVYEGL   I K    T+VA+K + +  +    ++F+ E  +MK    H +V++LLG+ +Q  P+ VI+EL   G+L+ ++RS            E+ T +I               +   + +IA+GM YL ++  VHRDL+ARN +V E + +KI DFG+TR +    YYRK   G+LPV+WM+PE+L +  +TT SDVWS+G++LWEI T  + PY  +  E+V+  +  G     P      +  L++ CW  +   RP F EI++ L   L       E + YHSE N
Sbjct:    5 EWEVERDKVKMM-RELGQGTFGMVYEGLARGIVKGEDETRVAIKTVNETATMRERYEFLNEASVMKSFNCH-HVVRLLGVVSQAQPILVIMELMTRGDLKSYLRSLRPDA-------EDFTETIVLEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEILDGLAPDLH--PSFHEFSFYHSEEN 308          
BLAST of FGFR4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.994 bits (528), Expect = 1.487e-58
Identity = 116/300 (38.67%), Postives = 176/300 (58.67%), Query Frame = 1
Query: 1855 EWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMN 2748
            EWE  RDK+K+  ++LG+G FGMVYEGL   I K    T+VA+K + +  +    ++F+ E  +MK    H +V++LLG+ +Q  P+ VI+EL   G+L+ ++RS      K+     +    +L   + +IA+GM YL ++  VHRDL+ARN +V E + +KI DFG+TR +    YYRK   G+LPV+WM+PE+L +  +TT SDVWS+G++LWEI T  + PY  +  E+V+  +  G     P      +  L++ CW  +   RP F EI++ L   L       E + YHSE N
Sbjct:   53 EWEVERDKVKMM-RELGQGTFGMVYEGLARGIVKGEDETRVAIKTVNETATMRERYEFLNEASVMKSFNCH-HVVRLLGVVSQAQPILVIMELMTRGDLKSYLRSLRPDAEKKPTRPPSSLPEMLQM-AGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPACPERLQELIRKCWQYNPRMRPTFLEILDGLAPDLHPSFH--EFSFYHSEEN 347          
BLAST of FGFR4 vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 91.6633 bits (226), Expect = 2.523e-19
Identity = 71/262 (27.10%), Postives = 121/262 (46.18%), Query Frame = 1
Query: 1897 KLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQN--PQPELANFEIYSLMQHCWNISTENRPHFFEIV 2676
            K+G+GA G VY     +I    T   VA+K M  +         + E+ +MK   +HPN++  +      G L VI+E    G+L D V                LT   +     +  +G+ +L S+ V+HRD+ + NIL+    ++K+ DFG    ++    K+T  +    WMAPE +  K+Y  K D+WS GI++ E+   G+ PY +  P + + +I         +PE  +  +   +  C  +  E+R    E++
Sbjct:  625 KIGQGASGGVYTAY--EIG---TNVSVAIKQMNLE-KQPKKELIINEILVMKG-SKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCI------------LTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIE-GEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELL 866          
BLAST of FGFR4 vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 91.2781 bits (225), Expect = 2.778e-19
Identity = 65/265 (24.53%), Postives = 127/265 (47.92%), Query Frame = 1
Query: 1900 LGEGAFGMVYE--GLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKK--YTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIK-KGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVE 2679
            LGEG F   ++    + +I    T  K ++K      S+      + E++I K +  HPN++Q +     +  + +++E+ P G+L + ++ +             LT   +  ++ QI   + Y+ SR V+HRDL   NI    +Y +KI DFGL  ++     +K        ++APE L+ K   ++ + D+WS G++L+ +  +G  P+ +     + + IK + F  P+ +  + E   L++   ++    RP   EI++
Sbjct:   88 LGEGGFARCFQIKDDSGEIFAAKTVAKASIK------SEKTRKKLLSEIQIHKSMS-HPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKV-----------LTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALL-IGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMD 333          
BLAST of FGFR4 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 90.5077 bits (223), Expect = 5.924e-19
Identity = 73/294 (24.83%), Postives = 138/294 (46.94%), Query Frame = 1
Query: 1900 LGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLK---LDSDY 2772
            +G G++G+VY+ +      K T   VA+K +  + +D  ++D + E+ ++K++  H N+++  G   ++  L +++E    G+LR  +   +            L+ +   TY  Q   G+ YL    V+HRD+ A NIL+     +K+ADFG++ IV+         +    WMAPE L  +  +T SD+WS G  + E+ T  + PY ++    +   ++     P P   +  +   +  C+  +   RP       T   +L+ +     +N+   ++N  K    D+DY
Sbjct:   31 IGRGSYGVVYKAI-----NKHTDQVVAIKEVVYE-NDEELNDIMAEISLLKNLN-HNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSST----------GLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGTL---NWMAPEILGNRGASTLSDIWSLGATVVEMLT-KNPPYHNLTDANIYYAVENDTYYP-PSSFSEPLKDFLSKCFVKNMYKRP-------TADQLLKHVWINSTENVKVDKLNKFKEDFTDADY 295          
BLAST of FGFR4 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 87.0409 bits (214), Expect = 8.862e-18
Identity = 73/270 (27.04%), Postives = 125/270 (46.30%), Query Frame = 1
Query: 1900 LGEGAFGMVYEGLTNDIAKKPTFTKVAVKM--MRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV-DYYYRKKTDGILPVKWMAPEALLEKK-YTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEI-------YSLMQHCWNISTENRPHFFEIV 2676
            +G+G+FG VY  L     +     +V V     +++   S V     E+  +K +  H N++Q LG   +N    + +E    G++   +R            I++LT  +L         G+ YL S+ ++HRD+ A N+L+ +    KI+DFG++R   D Y          V WMAPE +  K+ Y+ K D+WS G ++ E+F  G  P+S++  E V  + K G     P +    +        + +  C+ I+ E RP   E++
Sbjct: 1181 IGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD-HLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPL---IKHLTTQVL--------KGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNL--EVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435          
BLAST of FGFR4 vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 86.6557 bits (213), Expect = 9.298e-18
Identity = 76/264 (28.79%), Postives = 120/264 (45.45%), Query Frame = 1
Query: 1894 KKLGEGAFGMVY--------------EGLTNDIAKKPTFTKVAVKMM------RDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLL-GLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGL-TRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSL 2619
            +K G+GA G VY              E + NDI +     KVA+K M      R +         V E+ +MK   RH N++  L      +  L V++E    G+L D + +     +      E   A I+     +   G+ +L  + ++HRD+ + N+L+     +KI DFG   R+ D   ++ T    P  WMAPE + +++Y  K DVWS GI+  E+   G+ PY +  P K + +I     N  P+L + E  SL
Sbjct:  550 EKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKEL-------IVNEILVMKD-SRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVR----ETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPY-WMAPEVVKQREYDEKIDVWSLGIMTIEMLE-GEPPYLNEDPLKALYLIAT---NGTPKLKHPESLSL 796          
BLAST of FGFR4 vs. Ensembl Nematostella
Match: EDO49315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA0])

HSP 1 Score: 272.322 bits (695), Expect = 2.631e-83
Identity = 142/293 (48.46%), Postives = 189/293 (64.51%), Query Frame = 1
Query: 1849 DPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXX--XXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            D EWEF R  L I  + LGEGAFG V       +      T VAVKM+++D ++  + D V EME+MK IG+H N+I LLG CTQ+GPL V+VE A +GNLR F+R +     Y    +  E LT   L T+ +QIA GM YLASR  +HRDL+ARNILV +   +KIADFGL R V    YYRK TDG LPVKWMA EAL ++ YTT+SDVWS+GI++WEI T G  PY  +  EK+  ++  G++  +P   + E+Y +M++CWN + E RP F  +V+   D++  +SDE
Sbjct:   49 DEEWEFDRTYLVI-REVLGEGAFGKVMRAEAFGLHGNSACTTVAVKMLKEDATEQELFDLVSEMEVMKSIGKHINIINLLGTCTQHGPLFVLVEYARWGNLRQFLRDRRPVKDYDDVMEPAETLTLLNLMTFCYQIAKGMEYLASRKCIHRDLAARNILVADDNILKIADFGLARDVHNVDYYRKTTDGRLPVKWMAFEALFDRVYTTQSDVWSFGIVVWEIITFGGTPYPGVPIEKLCMLLNTGYRMERPVNCSKELYEIMRNCWNENPEARPTFTSLVQAFDDLVALLSDE 340          
BLAST of FGFR4 vs. Ensembl Nematostella
Match: EDO43236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ71])

HSP 1 Score: 270.011 bits (689), Expect = 3.715e-79
Identity = 135/299 (45.15%), Postives = 193/299 (64.55%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXX------XXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P D +WE  R ++ I  ++LGEGAFG+V +     +   P    VAVKM++ D +++ + D + EM+ MK+IG H N+I L+G CTQNGPL V+VE AP+GNLR F+R +       ++      +  +L      +++FQIA GM YL+ +  +HRDL+ARNILVGE Y MKIADFGL R V    YYRK TDG LP+KW+A EAL ++ YTT+SDVW++GILLWEIFTLG +PY  I  EK+ +++K G++   P+    ++Y +M  CWN +   RP F E+      +L  ++D+
Sbjct:  322 PIDEDWEIDRSQITI-KEQLGEGAFGLVMKAEALGLTDMPYRHTVAVKMLKADATENELADLLSEMDTMKNIGSHKNIINLIGACTQNGPLYVVVEFAPHGNLRQFLRERRPSDYHRSRSDSSTHSQPSLIVRDFISFAFQIARGMEYLSFKKCIHRDLAARNILVGEDYVMKIADFGLARNVRDMDYYRKATDGRLPIKWLAIEALFDRVYTTQSDVWTFGILLWEIFTLGGSPYPGIPVEKLFELLKSGYRMQMPQKCPDKMYDIMLSCWNENPNARPSFTELRAEFDKMLTSMTDK 619          
BLAST of FGFR4 vs. Ensembl Nematostella
Match: EDO49191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA4])

HSP 1 Score: 259.225 bits (661), Expect = 2.905e-75
Identity = 132/297 (44.44%), Postives = 187/297 (62.96%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIE----NLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P D EWE  R ++ +    LGEGAFG V +     +   P    VAVKM+++D ++  + D V EME+MK IG+H N+I L+G CTQ GPL V+VE A  GNLR F+R++           E     L    L ++S+Q+A GM YL S+  +HRDL+ARN+LV +++ +KIADFGL R +    YYRK TDG LPVKWMA EAL ++ YT +SDVW+YGIL+WEI T G +PY  I   K+ +++K+G++  QP     ++Y+LM  CW+ +   RP F EIV+ +   L  +S++
Sbjct:  311 PLDEEWELDRSQISLLGI-LGEGAFGRVVKADAIGLPNMPYRCNVAVKMLKEDATEHELADLVSEMEVMKTIGQHVNIINLIGACTQKGPLFVVVEYASQGNLRQFLRARRPIPEYANPLTEPPREKLKLVDLVSFSYQVARGMEYLESKKCIHRDLAARNVLVSDNHVIKIADFGLARDIHDIDYYRKTTDGRLPVKWMALEALFDRVYTAQSDVWAYGILMWEIVTFGGSPYPGIPLWKLFELLKEGYRMEQPVNCQDDVYALMLRCWHENPNQRPTFAEIVKEMDAKLTALSEQ 606          
BLAST of FGFR4 vs. Ensembl Nematostella
Match: EDO47097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN91])

HSP 1 Score: 247.669 bits (631), Expect = 8.571e-75
Identity = 132/300 (44.00%), Postives = 190/300 (63.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGP--LRVIVELAPYGNLRDFVRXXXXXXXXX-----XXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIV--DYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P + EWEFPRD++K+ +  +G GAFG V+      I+ K   T+VA K ++++ +DS   D + E++I+ HIG H N++ LLG CT+     L VI+E  P+GNL +F+R + + +        +K  E  T + L   SFQ++  M +LASR  VHRDL+ARN+LVGE+Y MKIADFGL R +  + +Y K T G+LPVKWMA EAL+++ YT  SDVWS+G+LLWEIFTLG +PY  +   +V   + +G +  QPE    E+Y LM  CW      RP F +++ET+  IL+  + E
Sbjct:    4 PWNAEWEFPRDRIKLLDI-VGTGAFGQVFLAEAVGISNK-QVTRVACKGLKENATDSEYRDLLSELKILMHIGEHKNIVNLLGACTKGRECDLLVIIEYCPHGNLLNFLRKRRDVFEATWSPPTEKPDETFTLTDLVITSFQVSRAMQFLASRRCVHRDLAARNVLVGENYVMKIADFGLARDIYKEEHYVKTTAGLLPVKWMAIEALVDQVYTHSSDVWSFGVLLWEIFTLGGSPYPGLPANEVYQYLMEGQRMAQPEDCPQEMYDLMLRCWQHDPAQRPTFTQLLETIDKILEGKTTE 301          
BLAST of FGFR4 vs. Ensembl Nematostella
Match: EDO43234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ69])

HSP 1 Score: 246.514 bits (628), Expect = 2.487e-74
Identity = 126/294 (42.86%), Postives = 185/294 (62.93%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRX-------XXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDIL 2697
            P D EWE  R+ + +  +K+GEGAFG+V +G+   +  KP+   VAVK +++D S    +DFV E+E MK IG H N+I ++G+C+ +GPL +IVE A +GNLRDF+R         +   +       +L    L   ++Q A GM YLAS+  +HRDL+ARN+L+ + Y +KIADFGL+R +    YYRK T G LPV W++ EAL ++KYT  SDVWS+G+LLWEI+TLG  PY  I  E++ +++K G++   P     EIY+LM  CW+ +  +RP    + + L  +L
Sbjct:    4 PFDEEWEIARENI-VLREKIGEGAFGLVVKGIVYGLPDKPSSCTVAVKTIKEDASIEEFNDFVSEIETMKSIGNHTNIINMVGVCSVDGPLLLIVEHAMHGNLRDFLRKHRGTHKDASQNNNLYMTPGNSLIIKNLLPMAYQAAKGMQYLASKKCIHRDLAARNVLLADDYVLKIADFGLSRNLRETDYYRKTTHGRLPVMWLSIEALFDQKYTLMSDVWSFGVLLWEIYTLGCMPYPGIPVERLFELLKTGYRMSAPTECPPEIYTLMLQCWSENPADRPTMELVAKELDRML 296          
BLAST of FGFR4 vs. Ensembl Medaka
Match: ENSORLT00000000391.2 (fibroblast growth factor receptor 1-A [Source:NCBI gene;Acc:101155126])

HSP 1 Score: 277.33 bits (708), Expect = 1.374e-80
Identity = 138/300 (46.00%), Postives = 197/300 (65.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXX-----XXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE PRD+L +  K LGEG FG V   E +  D +K    TKVAVKM++ D S+ ++ D + EME+MK IG+H N+I LLG CTQ GPL V+VE A  GNLR+++R++           ++  +  +    L + ++Q+A GM+YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L   L  +S++
Sbjct:  378 PYDPAWELPRDRLTL-GKPLGEGCFGQVVLAEAVGLDRSKPARLTKVAVKMLKADASEKDLSDLISEMEMMKMIGKHKNIINLLGACTQEGPLYVVVEYASKGNLREYLRARRPVGGEYWSGARQPLLGGVEIRELVSAAYQVARGMSYLASKKCIHRDLAARNVLVTEDDVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMEKPSACTQELYLMMRDCWHAVPSRRPTFQQLVEDLDRTLSLMSNQ 676          
BLAST of FGFR4 vs. Ensembl Medaka
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:100049424])

HSP 1 Score: 276.559 bits (706), Expect = 1.892e-80
Identity = 143/300 (47.67%), Postives = 193/300 (64.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPR +L +  K LGEG FG V   E +  D  K      VA KM++DD +D ++ D V EME+MK IG+H N+I LLG CTQ+GPL V+VE A  GNLR+++R++         +      E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV +   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWSYG+LLWEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   S +
Sbjct:  337 PSDPKWEFPRTRLTL-GKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAAKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEFASKGNLREYLRARRPPGMDYSFDTCKIPDEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTDDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDLDRILSMTSTD 635          
BLAST of FGFR4 vs. Ensembl Medaka
Match: ENSORLT00000040527.1 (fibroblast growth factor receptor 1-A [Source:NCBI gene;Acc:101155126])

HSP 1 Score: 277.715 bits (709), Expect = 2.023e-80
Identity = 141/320 (44.06%), Postives = 206/320 (64.38%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXX-----XXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE-----PEQNIYHSEMNYLKL 2760
            P DP WE PRD+L +  K LGEG FG V   E +  D +K    TKVAVKM++ D S+ ++ D + EME+MK IG+H N+I LLG CTQ GPL V+VE A  GNLR+++R++           ++  +  +    L + ++Q+A GM+YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L   L  +S++      EQ +   ++ ++K+
Sbjct:  378 PYDPAWELPRDRLTL-GKPLGEGCFGQVVLAEAVGLDRSKPARLTKVAVKMLKADASEKDLSDLISEMEMMKMIGKHKNIINLLGACTQEGPLYVVVEYASKGNLREYLRARRPVGGEYWSGARQPLLGGVEIRELVSAAYQVARGMSYLASKKCIHRDLAARNVLVTEDDVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMEKPSACTQELYLMMRDCWHAVPSRRPTFQQLVEDLDRTLSLMSNQVRSSHREQTVPDGKLLWMKV 696          
BLAST of FGFR4 vs. Ensembl Medaka
Match: fgfr1 (fibroblast growth factor receptor 1 [Source:NCBI gene;Acc:100125448])

HSP 1 Score: 278.87 bits (712), Expect = 4.664e-80
Identity = 140/300 (46.67%), Postives = 197/300 (65.67%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEG--LTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXX-----XXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP WE PRDKL +  K LGEG FG V  G  L  D  K    T VAVKM++ D ++ ++ D + EME+MK IG+H N+I LLG CTQ+GPL VIVE A  GNLR+++R++     +      + ++E ++   L + ++Q+A GM YLAS+  +HRDL+ARN+LV E   MKIADFGL R + +  YY+K T+G LPVKWMAPEAL ++ YT +SDVWS+G+LLWEIFTLG +PY  +  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L   L   S++
Sbjct:  477 PQDPRWEVPRDKL-VLGKPLGEGCFGQVMMGEVLGLDKEKPNRVTNVAVKMLKSDATEKDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYCYNPDQVSVETMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSTCTHELYMMMRDCWHAVPSQRPTFKQLVEDLDRCLAMTSNQ 775          
BLAST of FGFR4 vs. Ensembl Medaka
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:100049424])

HSP 1 Score: 277.33 bits (708), Expect = 1.391e-79
Identity = 143/300 (47.67%), Postives = 193/300 (64.33%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVY--EGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXI-----ENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDY--YYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDE 2715
            P DP+WEFPR +L +  K LGEG FG V   E +  D  K      VA KM++DD +D ++ D V EME+MK IG+H N+I LLG CTQ+GPL V+VE A  GNLR+++R++         +      E LT   L + ++Q+A GM YLAS+  +HRDL+ARN+LV +   MKIADFGL R V    YY+K T+G LPVKWMAPEAL ++ YT +SDVWSYG+LLWEIFTLG +PY  I  E++  ++K+G +  +P     E+Y +M+ CW+     RP F ++VE L  IL   S +
Sbjct:  468 PSDPKWEFPRTRLTL-GKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAAKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEFASKGNLREYLRARRPPGMDYSFDTCKIPDEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTDDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDLDRILSMTSTD 766          
BLAST of FGFR4 vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 1536.16 bits (3976), Expect = 0.000e+0
Identity = 825/855 (96.49%), Postives = 827/855 (96.73%), Query Frame = 1
Query:  181 MSGXXXXXXXXXXXXGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQMTWLAMEWLKDGTFLGKKVXXXXXXXXXXXXXXXNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNXXXXXXXXXXXXXRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGXXXXXXXXXXXXXXXPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM 2745
            MSGLFFLLCELLILFGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQ+TWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLN SDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMK GNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEES                          TFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFV+LNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM
Sbjct:    1 MSGLFFLLCELLILFGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQVTWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLNASDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKNGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESY-------------------------TFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVILNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM 830          
BLAST of FGFR4 vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 1531.54 bits (3964), Expect = 0.000e+0
Identity = 832/868 (95.85%), Postives = 835/868 (96.20%), Query Frame = 1
Query:  181 MSGXXXXXXXXXXXXGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQMTWLAMEWLKDGTFLGKKVXXXXXXXXXXXXXXXNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNXXXXXXXXXXXXXRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGXXXXXXXXXXXXXXXPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLKLDSDYLEPT 2784
            MSGLFFLLCELLILFGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQ+TWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLN SDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMK GNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIET+                               TETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFV+LNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLKLDSDYLEPT
Sbjct:    1 MSGLFFLLCELLILFGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQVTWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLNASDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKNGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETNTF-----------------------------TETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVILNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEMNYLKLDSDYLEPT 839          
BLAST of FGFR4 vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 1505.73 bits (3897), Expect = 0.000e+0
Identity = 819/855 (95.79%), Postives = 822/855 (96.14%), Query Frame = 1
Query:  181 MSGXXXXXXXXXXXXGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQMTWLAMEWLKDGTFLGKKVXXXXXXXXXXXXXXXNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNXXXXXXXXXXXXXRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGXXXXXXXXXXXXXXXPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM 2745
            MSGLFFLLCELLILFGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQ+TWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLN SDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMK GNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIET+                               TETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFV+LNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM
Sbjct:    1 MSGLFFLLCELLILFGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQVTWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLNASDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKNGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETNTF-----------------------------TETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVILNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM 826          
BLAST of FGFR4 vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 1500.72 bits (3884), Expect = 0.000e+0
Identity = 802/838 (95.70%), Postives = 805/838 (96.06%), Query Frame = 1
Query:  232 MNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQMTWLAMEWLKDGTFLGKKVXXXXXXXXXXXXXXXNVSDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNXXXXXXXXXXXXXRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGXXXXXXXXXXXXXXXPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXXIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM 2745
            MNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQ+TWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLN SDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMK GNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIET+                               TETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFV+LNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM
Sbjct:    1 MNAASKKKHKCQPSMDKMNNDLNLRTDGKLELMCMVKVDISCQVTWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLNASDAGNYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYYMHPEMKNGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGKVLSSDDELFIETNTF-----------------------------TETFFTCMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCSTNEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRFYSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSILIAIISTGSILISAFVILNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIYKSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGEQHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFSLYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNIYHSEM 809          
BLAST of FGFR4 vs. Planmine SMEST
Match: SMESG000010479.1 (SMESG000010479.1)

HSP 1 Score: 272.322 bits (695), Expect = 2.045e-77
Identity = 133/284 (46.83%), Postives = 186/284 (65.49%), Query Frame = 1
Query: 1843 PCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVAVKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVELAPYGNLRDFVRXXXXXXXXXXXX---IENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVETL 2685
            P +  W F RD L I   K+GEGAFG+VY  L     +     +VA+K +   F D +V + ++E+E+MK IGRH ++I L G C  NG   +++ELA YGNLRDF+R++  +          +  +T   L  +S +IA GM YL+SR ++HRDL+ARN+LV ++ EMKI+DFGLTR V++YYRK TDG LP+KWMAPE LL++ YT KSDVWS+GI+LWEIFT+G  PY +I  + +   ++ G +N +P LA+ E+Y LM   WN    +R  F E+VE L
Sbjct:  578 PSNIGWIFSRDSL-IIGSKIGEGAFGIVYSALVKSFTENSAPIEVAIKTLHTSFGDEDVINLIQELEMMKIIGRHRHIISLYGACVDNGYPYMVIELAKYGNLRDFLRTRRIQTRAVDITNIPVVPITVGDLLRFSIEIAEGMEYLSSRMIIHRDLAARNVLVDQYMEMKISDFGLTRAVEHYYRKTTDGRLPIKWMAPECLLDRIYTIKSDVWSFGIVLWEIFTMGQTPYPTIQSDGMHQALRNGVRNEKPPLASDEMYRLMLTIWNDDPLDRYSFTELVEKL 860          
The following BLAST results are available for this feature:
BLAST of FGFR4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGFR47.004e-8448.67fibroblast growth factor receptor 4 [Source:HGNC S... [more]
FGFR41.326e-8348.67fibroblast growth factor receptor 4 [Source:HGNC S... [more]
FGFR41.326e-8348.67fibroblast growth factor receptor 4 [Source:HGNC S... [more]
FGFR21.438e-8248.00fibroblast growth factor receptor 2 [Source:HGNC S... [more]
FGFR21.887e-8247.54fibroblast growth factor receptor 2 [Source:HGNC S... [more]
back to top
BLAST of FGFR4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-152.558e-6544.37Myoblast growth factor receptor egl-15 [Source:Un... [more]
egl-152.558e-6544.37Myoblast growth factor receptor egl-15 [Source:Un... [more]
egl-152.558e-6544.37Myoblast growth factor receptor egl-15 [Source:Un... [more]
egl-152.558e-6544.37Myoblast growth factor receptor egl-15 [Source:Un... [more]
egl-152.558e-6544.37Myoblast growth factor receptor egl-15 [Source:Un... [more]
back to top
BLAST of FGFR4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btl1.193e-7845.95gene:FBgn0285896 transcript:FBtr0100676[more]
btl1.193e-7845.95gene:FBgn0285896 transcript:FBtr0075778[more]
htl3.375e-7646.36gene:FBgn0010389 transcript:FBtr0083550[more]
htl3.375e-7646.36gene:FBgn0010389 transcript:FBtr0083549[more]
htl3.375e-7646.36gene:FBgn0010389 transcript:FBtr0083548[more]
back to top
BLAST of FGFR4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr31.495e-8247.99fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr1a1.368e-8146.33fibroblast growth factor receptor 1a [Source:NCBI ... [more]
fgfr1a1.368e-8146.33fibroblast growth factor receptor 1a [Source:NCBI ... [more]
fgfr25.398e-8149.00fibroblast growth factor receptor 2 [Source:NCBI g... [more]
fgfr1a9.906e-8146.33fibroblast growth factor receptor 1a [Source:NCBI ... [more]
back to top
BLAST of FGFR4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr47.780e-8046.67fibroblast growth factor receptor 4 [Source:NCBI g... [more]
tirap1.141e-7947.33toll-interleukin 1 receptor (TIR) domain containin... [more]
tirap1.476e-7947.33toll-interleukin 1 receptor (TIR) domain containin... [more]
tirap1.848e-7947.33toll-interleukin 1 receptor (TIR) domain containin... [more]
fgfr43.042e-7946.67fibroblast growth factor receptor 4 [Source:NCBI g... [more]
back to top
BLAST of FGFR4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fgfr28.519e-8348.00fibroblast growth factor receptor 2 [Source:MGI Sy... [more]
Fgfr29.019e-8348.00fibroblast growth factor receptor 2 [Source:MGI Sy... [more]
Fgfr41.338e-8248.33fibroblast growth factor receptor 4 [Source:MGI Sy... [more]
Fgfr28.256e-8248.00fibroblast growth factor receptor 2 [Source:MGI Sy... [more]
Fgfr28.400e-8248.00fibroblast growth factor receptor 2 [Source:MGI Sy... [more]
back to top
BLAST of FGFR4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MY86|FGFR1_DUGJA0.000e+061.28Fibroblast growth factor receptor 1 OS=Dugesia jap... [more]
sp|P22455|FGFR4_HUMAN6.367e-8348.67Fibroblast growth factor receptor 4 OS=Homo sapien... [more]
sp|Q498D6|FGFR4_RAT1.065e-8148.33Fibroblast growth factor receptor 4 OS=Rattus norv... [more]
sp|Q26614|FGFR_STRPU1.315e-8146.69Fibroblast growth factor receptor OS=Strongylocent... [more]
sp|Q03142|FGFR4_MOUSE1.569e-8048.00Fibroblast growth factor receptor 4 OS=Mus musculu... [more]
back to top
BLAST of FGFR4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXV60.000e+099.88FGFR4 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
T1G0696.256e-9252.33Protein kinase domain-containing protein OS=Helobd... [more]
V4ADF14.190e-9051.99Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A1B6FVV86.749e-8950.33Protein kinase domain-containing protein (Fragment... [more]
A0A0L8HUQ11.477e-8849.34Protein kinase domain-containing protein OS=Octopu... [more]
back to top
BLAST of FGFR4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr1a1.854e-8247.33fibroblast growth factor receptor 1a [Source:NCBI ... [more]
fgfr28.522e-8048.67fibroblast growth factor receptor 2 [Source:NCBI g... [more]
fgfr31.320e-7948.00fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr31.363e-7948.00fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr42.101e-7847.00fibroblast growth factor receptor 4 [Source:NCBI g... [more]
back to top
BLAST of FGFR4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr27.023e-8447.83fibroblast growth factor receptor 2 [Source:NCBI g... [more]
fgfr22.482e-7350.00fibroblast growth factor receptor 2 [Source:NCBI g... [more]
ENSPMAT00000008763.12.892e-6645.69pep scaffold:Pmarinus_7.0:GL480478:1796:23946:1 ge... [more]
ENSPMAT00000009485.15.846e-5937.14pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000009481.11.487e-5838.67pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
back to top
BLAST of FGFR4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE202.523e-1927.10Cdc42p-activated signal transducing kinase; involv... [more]
CDC52.778e-1924.53Polo-like kinase; controls targeting and activatio... [more]
CDC155.924e-1924.83Protein kinase of the Mitotic Exit Network; locali... [more]
BCK18.862e-1827.04MAPKKK acting in the protein kinase C signaling pa... [more]
CLA49.298e-1828.79Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of FGFR4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493152.631e-8348.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432363.715e-7945.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491912.905e-7544.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470978.571e-7544.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432342.487e-7442.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FGFR4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000391.21.374e-8046.00fibroblast growth factor receptor 1-A [Source:NCBI... [more]
fgfr31.892e-8047.67fibroblast growth factor receptor 3 [Source:NCBI g... [more]
ENSORLT00000040527.12.023e-8044.06fibroblast growth factor receptor 1-A [Source:NCBI... [more]
fgfr14.664e-8046.67fibroblast growth factor receptor 1 [Source:NCBI g... [more]
fgfr31.391e-7947.67fibroblast growth factor receptor 3 [Source:NCBI g... [more]
back to top
BLAST of FGFR4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054557.10.000e+096.49SMESG000054557.1[more]
SMESG000054557.10.000e+095.85SMESG000054557.1[more]
SMESG000054557.10.000e+095.79SMESG000054557.1[more]
SMESG000054557.10.000e+095.70SMESG000054557.1[more]
SMESG000010479.12.045e-7746.83SMESG000010479.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009204
GenBankAFD29627.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009204 ID=SMED30009204|Name=FGFR4|organism=Schmidtea mediterranea sexual|type=transcript|length=2923bp
ATCTCTTTGCACATCGAATTTCCTTAGTCAAGATATCGTTAAACATGTGA
CAACAATTTTTATCATGAACCAATGACGATTGCATATTTTGCCGTTTTTA
TGAATCCATAAATCTTTTTTTTTAAAAAAGAAGTCTCAAGAGAAAATTTC
TCACGAGTTTTTTTTATATTCAACTTGAAAATGTCAGGATTGTTTTTTCT
TCTCTGTGAGCTATTGATATTATTTGGGGAAATGAATGCTGCATCTAAAA
AGAAACACAAATGTCAACCAAGTATGGATAAGATGAACAACGACTTGAAT
TTAAGGACAGATGGAAAACTGGAATTGATGTGCATGGTGAAGGTTGATAT
ATCGTGCCAGATGACATGGTTAGCAATGGAATGGCTAAAGGATGGCACTT
TTTTGGGCAAAAAAGTTAAAATACTTCGGAAAATGAAATACATATATAAA
AAAAAGAAATTAAACGTTAGCGATGCCGGAAATTACACTTGTAAAGTTAA
TAATCAATTTGGAGAATCTAGTTTATCCTATTTAGTCAAGGTTACGGAGG
CATTGTCAGGATCAAAATTAATTGAAAATTTCCACGAAATTCCTTCTGAT
TTACTGGAAATATCTCAGTATAAATATTACATGCATCCAGAAATGAAGAA
AGGCAATGTGAAGCACGTTTTATCACTTTCTTCAATATTTTTGAATTGTC
AAGTGCTTTTTTCAAAAGAACTATATCCTAGGATTTCTTGGTATCAACAT
TCCAGTCATTTCGATTATGAAAATGGCAAAGTATTGTCTAGTGATGACGA
GCTGTTTATTGAGACAAGTGAGGAATCCTGTATACCTTATACGAATTTAA
ATATTTCTAATGATTTCATTTGCATATCTTCCAACTTTAATTATATCGTA
CCAGATACATTTACTGAAACATTTTTTACCTGCATGATAGAATCGAACAC
GAGTTTTGTTAATAAAGCTAAATACACATATGTCATATTGATAGATCAGA
GAATCTTTAGGAATAAATTAAAATTTCCCAAACAGTTGACAGTCTGTCAT
GGATCAAACTTCACTCTCAATTGCTCAACCAATGAACCTAGACCAGTTTT
GCTTTTATTTAAACTCCAACCGAAATCAAGACTTGATTTAAACAATGTAG
ATTTGAGGACAAGCCCCCTTTTGACCGAGCTTGTTTCGAATGACAGCACC
AGATCTTTGAAATCTATGATTTGGAGGTTTTACTCAGTATCATTCAATGA
TTCCGGTCGCTACTTCTGCACCATTTCACCACATGTTCCGGATGAAACTC
AGTATGAATTAATGAATTTGACGGTCGTCGATTGCTCGTTTAATTTATCC
TCGTCAATTTATAAAGATCTCAAATCCATACTAATAGCAATAATTTCGAC
TGGATCTATTTTAATTTCCGCTTTTGTGCTTTTAAACCTCCTCAGAAAAA
AATTTCTAACTAATCCCAACAAACGTTACCATTTCCCAATCAGGAAAACT
ATTATCATTGAATACGAATCTCCAATTTACAAAAGTTTTATCAATGGAAC
TAAAAATTTCAAAACTGATGTTCTGCATACCAATCATCTTTTACCAGACT
CGAATCCTTTGCTGCCACCAATAATCAAAATCAAGCCCATCAAAAGGTTA
TCTCAACTTAAAGATGTAGTTTATGGTGAACAGCACCCGTCAACATCGAC
GGACAGAACAAGATTAGAATCAACGAGGCAATCACAATTGGAAAATGATG
TGTTTGAATGTGCTACCGGAAGTAACTCCATCCATTGTAAATACGGTTTG
CGACGCTCATCGTCTTTGGAATTCTTTTCCTTGTATGAGTTTCCATGTGA
TCCAGAATGGGAATTTCCGAGAGACAAACTCAAGATTACCAACAAAAAGC
TAGGAGAAGGAGCATTCGGAATGGTTTATGAAGGTTTGACTAATGATATT
GCCAAAAAACCCACATTTACCAAAGTAGCAGTCAAAATGATGCGAGATGA
TTTCTCAGATTCTAATGTGCATGATTTCGTCAAAGAAATGGAAATAATGA
AACACATTGGACGTCATCCGAATGTCATTCAATTGTTAGGTTTATGTACT
CAAAATGGTCCCCTTCGAGTCATTGTTGAATTAGCACCATATGGAAATTT
GCGAGATTTTGTTAGATCAAAAAATAACAAATATTCGAAACAAAAAAAAA
ATATCGAAAATCTTACTGCTTCAATATTGTCTACATATTCCTTTCAAATT
GCAAACGGAATGACTTATTTGGCATCAAGATCAGTGGTACATAGAGATTT
GTCGGCAAGAAATATTCTCGTGGGAGAGCATTATGAAATGAAAATAGCAG
ATTTTGGTCTAACGAGAATCGTAGATTATTACTATCGAAAGAAAACAGAT
GGAATTCTTCCTGTGAAGTGGATGGCACCTGAAGCACTTTTGGAAAAGAA
ATATACGACAAAAAGCGACGTGTGGTCTTACGGAATTTTACTATGGGAAA
TATTCACTCTTGGAGATGCTCCTTATTCATCAATATTACCGGAAAAAGTC
GTTGATGTTATTAAAAAAGGATTCCAAAATCCCCAGCCGGAATTAGCAAA
TTTTGAAATTTATAGTCTCATGCAACATTGTTGGAATATATCCACTGAAA
ATCGGCCTCATTTCTTTGAAATTGTTGAGACGTTGCAAGACATTTTACAA
AGAATCAGTGATGAACCAGAACAAAATATTTATCATTCAGAAATGAATTA
TTTAAAACTGGACTCTGATTATTTGGAACCGACAAGCCTTGTACAATGAG
ATTCTTTATAATTATCTTTATATCAATTTTGTACCTTAAAAGTGCCATAA
TTTTATTTTATAAATATTGACTTCCTGTAATCATGATGACTCTGAGTTTT
TTTATATTTTATAATGACTTCGT
back to top

protein sequence of SMED30009204-orf-1

>SMED30009204-orf-1 ID=SMED30009204-orf-1|Name=SMED30009204-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=873bp
MSGLFFLLCELLILFGEMNAASKKKHKCQPSMDKMNNDLNLRTDGKLELM
CMVKVDISCQMTWLAMEWLKDGTFLGKKVKILRKMKYIYKKKKLNVSDAG
NYTCKVNNQFGESSLSYLVKVTEALSGSKLIENFHEIPSDLLEISQYKYY
MHPEMKKGNVKHVLSLSSIFLNCQVLFSKELYPRISWYQHSSHFDYENGK
VLSSDDELFIETSEESCIPYTNLNISNDFICISSNFNYIVPDTFTETFFT
CMIESNTSFVNKAKYTYVILIDQRIFRNKLKFPKQLTVCHGSNFTLNCST
NEPRPVLLLFKLQPKSRLDLNNVDLRTSPLLTELVSNDSTRSLKSMIWRF
YSVSFNDSGRYFCTISPHVPDETQYELMNLTVVDCSFNLSSSIYKDLKSI
LIAIISTGSILISAFVLLNLLRKKFLTNPNKRYHFPIRKTIIIEYESPIY
KSFINGTKNFKTDVLHTNHLLPDSNPLLPPIIKIKPIKRLSQLKDVVYGE
QHPSTSTDRTRLESTRQSQLENDVFECATGSNSIHCKYGLRRSSSLEFFS
LYEFPCDPEWEFPRDKLKITNKKLGEGAFGMVYEGLTNDIAKKPTFTKVA
VKMMRDDFSDSNVHDFVKEMEIMKHIGRHPNVIQLLGLCTQNGPLRVIVE
LAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASR
SVVHRDLSARNILVGEHYEMKIADFGLTRIVDYYYRKKTDGILPVKWMAP
EALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQN
PQPELANFEIYSLMQHCWNISTENRPHFFEIVETLQDILQRISDEPEQNI
YHSEMNYLKLDSDYLEPTSLVQ*
back to top
Aliases
The feature 'FGFR4' has the following synonyms
Synonym
FGFR4
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000009sigma neoblast
PLANA:0000014zeta neoblast
PLANA:0000039gamma neoblast
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR017441Protein_kinase_ATP_BS
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR007110Ig-like_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004713protein tyrosine kinase activity
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 661..681
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 228..415
e-value: 0.0015
score: 14.4
coord: 16..198
e-value: 0.0014
score: 14.5
coord: 551..681
e-value: 1.6E-30
score: 103.6
coord: 665..867
e-value: 4.7E-65
score: 217.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 531..651
e-value: 3.3E-37
score: 129.3
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 655..864
e-value: 2.6E-53
score: 182.3
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 524..847
NoneNo IPR availablePANTHERPTHR24416:SF550FIBROBLAST GROWTH FACTOR RECEPTOR HOMOLOG 1-RELATEDcoord: 524..847
NoneNo IPR availableCDDcd00192PTKccoord: 572..836
e-value: 2.62027E-122
score: 368.405
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.756
NoneNo IPR availableTMHMMTMhelixcoord: 399..421
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 649..662
score: 41.07
coord: 743..753
score: 69.23
coord: 806..828
score: 35.51
coord: 696..714
score: 62.05
coord: 762..784
score: 61.96
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 571..835
e-value: 1.3E-90
score: 303.2
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 36..122
e-value: 0.18
score: 20.9
coord: 283..383
e-value: 0.0033
score: 26.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 274..387
e-value: 7.1E-6
score: 27.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 20..121
e-value: 1.3E-8
score: 36.9
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 574..602
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 702..714
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 30..122
score: 9.627
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 568..839
score: 41.474
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 541..835
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 30..123
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 281..382