Histone-lysine N-methyltransferase SETMAR

Overview
NameHistone-lysine N-methyltransferase SETMAR
Smed IDSMED30009199
Length (bp)889
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase SETMAR (SMED30009199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30009199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30009199SMESG000031104.1 SMESG000031101.1 dd_Smed_v4_6221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009199SMESG000031104.1 SMESG000031101.1 dd_Smed_v4_6221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009199SMESG000031104.1 SMESG000031101.1 dd_Smed_v4_6221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 62.3882 bits (150), Expect = 2.394e-10
Identity = 35/119 (29.41%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  375 SLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNF-YL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADVVHDIQQ 728
            +++  +  +I    L P ETI+ + Y     ++N  + ++L+  + +     L H+NARPH+A  T +K  +    +  HPPYSPDL P+N+++F+ + + L GK + +  D  +  Q+
Sbjct:  395 TIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKL-QRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQE 512          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 62.3882 bits (150), Expect = 2.867e-10
Identity = 35/119 (29.41%), Postives = 65/119 (54.62%), Query Frame = 3
Query:  375 SLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNF-YL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADVVHDIQQ 728
            +++  +  +I    L P ETI+ + Y     ++N    ++L+  + +     L H+NARPH+A  T +K  +    +  HPPYSPDL P+N+++F+ + + L GK + +  D  +  Q+
Sbjct:  534 TIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMN-QKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQE 651          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 1.377e-9
Identity = 35/119 (29.41%), Postives = 65/119 (54.62%), Query Frame = 3
Query:  375 SLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNF-YL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADVVHDIQQ 728
            +++  +  +I    L P ETI+ + Y     ++N    ++L+  + +     L H+NARPH+A  T +K  +    +  HPPYSPDL P+N+++F+ + + L GK + +  D  +  Q+
Sbjct:  534 TIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMN-QKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQE 651          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A1B6F9Q7 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.37759 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.150e-19
Identity = 48/127 (37.80%), Postives = 70/127 (55.12%), Query Frame = 3
Query:  369 IPSLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNFYL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADVVHDIQQCSDLKPQ 749
            + ++F D K ++L+  L    T++  YYC L ++   A   K R+Q    +  L H+NARPH A +TQEK +Q      EHPPYSPDL P +F +F P+K AL G  + S  +V   +      +PQ
Sbjct:   42 LATIFFDCKGVLLIDFLHERRTVNAAYYCQLLEQAKAAFRNKRRKQPI-RDVILLHDNARPHTAALTQEKLRQIHWETLEHPPYSPDLSPCDFRLFGPLKEALGGNRFESDEEVQEFVCNWFKTRPQ 167          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A1B6HVW3 (Uncharacterized protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.15241 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.164e-19
Identity = 48/127 (37.80%), Postives = 70/127 (55.12%), Query Frame = 3
Query:  369 IPSLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNFYL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADVVHDIQQCSDLKPQ 749
            + ++F D K ++L+  L    T++  YYC L ++   A   K R Q    +  L H+NARPH A +TQEK +Q      EHPPYSPDL P +F++F P+K AL G  + S  +V   +      +PQ
Sbjct:   25 LATIFFDCKGVLLIDFLHERRTVNAAYYCQLLEQAKAAFRNKRRNQPI-RDVILLHDNARPHTAALTQEKLRQIHWETLEHPPYSPDLSPCDFHLFGPLKEALGGNRFESDEEVQEFVCNWFKTQPQ 150          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A1B6MQY6 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.46574 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.252e-19
Identity = 45/120 (37.50%), Postives = 71/120 (59.17%), Query Frame = 3
Query:  369 IPSLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNFYL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADVVHDIQQ 728
            + ++F D K ++L+  + P  TI+   YCD  ++L  A+  K RR +  S   L H+NARPH A +TQ   +Q    +F+HPPYSPDL PS+F++F  +K  L G+ Y +  ++   I +
Sbjct:   55 MATVFWDQKGVLLVEFMEPGTTINAAVYCDTLRRLRRAIQNK-RRGLLTSGIVLLHDNARPHSAGLTQNLLRQFHWDVFDHPPYSPDLAPSDFHLFPELKKWLGGRRYDTHEELESSINE 173          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A224XT40 (Putative transposase (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.145e-18
Identity = 44/126 (34.92%), Postives = 73/126 (57.94%), Query Frame = 3
Query:  369 IPSLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNFYL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADVVHDIQQCSDLKP 746
            + ++F D + ++    L    TI+  YYCD+  ++ +A + + RR +      L H+NARPH A +T+EK +Q      +HPPYSPDL P +F++F P+K AL G+ + S A+V   ++     +P
Sbjct:  192 LATIFFDQRGLLHFDFLHERRTINAAYYCDILSEVRLA-YRRKRRDLSIRQVVLLHDNARPHTAALTREKLEQLGWETLQHPPYSPDLSPCDFHVFGPLKEALGGQRFDSDAEVEAYVRNWLQTRP 316          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: X1XP03 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.010e-18
Identity = 46/114 (40.35%), Postives = 67/114 (58.77%), Query Frame = 3
Query:  369 IPSLFLDSKWIILMGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNFYL*HNNARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSSFADV 710
            + S+F D K IIL+  LP  ETI+   YC+  KKL  A+  K RR +  S   L H+NARPH A +T++        +  H PYSPDL PS++++F  +K  + GK +S+  +V
Sbjct:   34 MASVFWDHKGIILIEYLPQGETINAARYCETLKKLRRAIQNK-RRGLLTSGVCLLHDNARPHTANVTKQLLDSFGWDVLNHTPYSPDLAPSDYHLFTSLKKHMGGKKFSADEEV 146          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000049199.1 (SMESG000049199.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.937e-14
Identity = 37/100 (37.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query:  408 MGGLPPNETISVKYYCDLFKKLNIAVFEKLRRQIFDSNFYL*HN---NARPHMAIITQEKFKQPCLHIFEHPPYSPDLRPSNFYIFQPMKSALHGKDYSS 698
            M  LP   TI+   Y +   +L  A+  K RR++    F+  H    NARPH A  + +K       +  HPPYSPDL  S+FY+F P+KS++ G+D++ 
Sbjct:    1 MNILPQGTTITADVYYEQLSRLVTAIQHK-RRRLLGGGFHKIHYLQYNARPHTAAKSVQKLIDIGFTVLLHPPYSPDLATSDFYLFSPLKSSIRGRDFNG 99          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SETMAR2.394e-1029.41SET domain and mariner transposase fusion gene [So... [more]
SETMAR2.867e-1029.41SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q53H47|SETMR_HUMAN1.377e-929.41Histone-lysine N-methyltransferase SETMAR OS=Homo ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6F9Q72.150e-1937.80Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
A0A1B6HVW32.164e-1937.80Uncharacterized protein (Fragment) OS=Homalodisca ... [more]
A0A1B6MQY62.252e-1937.50Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A224XT401.145e-1834.92Putative transposase (Fragment) OS=Panstrongylus l... [more]
X1XP033.010e-1840.35Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049199.11.937e-1437.00SMESG000049199.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009199 ID=SMED30009199|Name=Histone-lysine N-methyltransferase SETMAR|organism=Schmidtea mediterranea sexual|type=transcript|length=889bp
GCGACTCCAATGCATCACGGCTAATATGCCTTAAGATCTCAAAATAAATT
TAAATTCAAAAATATATTCACTTATAATGTCAGATTTATACAAGAGAATT
CGCCAAATTATCTAGTGAGAAATGAGGATTATAAGCCAAAGTAAATATCA
CCTTATCTATATGATTACGAAATAATTAAACTGACTCCCACAAATGAGGA
ATGCGTAATTTTTAAACGATTTCGCCTTTACTTTAAACAGGTTTGGCTCA
AAAGTTTCTGCCGATGATTAAAGCTGTCCGGAATGAAATGTGAAAAAACG
TCGCAAGTCTTGGCTACGGGCTAGAGATCAACCTGTGACTGAATAAAAGC
CTTAACAACAACAAATCCATACCGAGTTTGTTCTTGGATTCTAAATGGAT
TATTTTGATGGGCGGTCTGCCACCAAATGAAACCATCTCTGTCAAATATT
ACTGTGACCTATTCAAAAAACTGAATATAGCTGTTTTTGAAAAACTGCGA
AGGCAAATATTTGATAGTAACTTCTATCTTTAGCACAACAATGCGAGGCC
CCATATGGCTATCATCACACAGGAGAAGTTTAAACAGCCTTGTCTGCACA
TTTTCGAACATCCACCATACTCGCCAGACTTGCGTCCCTCTAATTTTTAC
ATCTTCCAACCAATGAAATCTGCATTACACGGAAAAGATTACTCCAGTTT
TGCTGATGTGGTACACGACATCCAACAATGCTCAGATTTGAAGCCACAGG
ATTCTTCGAAGAAGACATCAAAAAGCTACCGGGAAGATAGTAACGATGCT
TTAATCCCAATTGGGAATATTTTGATAACTTTTTAGTGGTTGATATAATT
AGACAGCTTATTGTTATTCATTTGTTGTTGAAATTTCGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0016180snRNA processing
GO:0032259methylation
Vocabulary: cellular component
TermDefinition
GO:0032039integrator complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.420.470coord: 1..82
e-value: 1.7E-13
score: 52.5