Kinase

Overview
NameKinase
Smed IDSMED30009189
Length (bp)2545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase (SMED30009189) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase (SMED30009189) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase (SMED30009189) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase (SMED30009189) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009189SMESG000064545.1 SMESG000047762.1 SMESG000046800.1 SMESG000012864.1 SMESG000003895.1 SMESG000070132.1 SMESG000068326.1 SMESG000067883.1 SMESG000062229.1 SMESG000061668.1 SMESG000058705.1 SMESG000030728.1 SMESG000022905.1 SMESG000020613.1 Contig65newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009189SMESG000064545.1 SMESG000047762.1 SMESG000046800.1 SMESG000012864.1 SMESG000003895.1 SMESG000070132.1 SMESG000067883.1 SMESG000061668.1 SMESG000058705.1 SMESG000020613.1 Contig337uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009189SMESG000064545.1 SMESG000047762.1 SMESG000046800.1 SMESG000012864.1 SMESG000003895.1 SMESG000070132.1 SMESG000067883.1 SMESG000061668.1 SMESG000058705.1 SMESG000020613.1 Contig337newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30009189SMESG000044206.1 Contig353GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30009189SMESG000044206.1 Contig353GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30009189SMESG000044206.1 Contig353GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30009189SMESG000035344.1 Contig337uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009189SMESG000035344.1 Contig337newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009189SMESG000001797.1 Contig65newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30009189SMESG000003375.1 Contig353GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30009189SMESG000003375.1 Contig353GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30009189SMESG000003375.1 Contig353GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30009189SMESG000003375.1 dd_Smed_v4_1630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009189SMESG000003375.1 dd_Smed_v4_1630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009189SMESG000003375.1 dd_Smed_v4_1630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009189SMESG000003375.1 dd_Smed_v4_1630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009189SMESG000003375.1 dd_Smed_v4_1630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009189SMESG000003375.1 Contig37142uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009189SMESG000003375.1 Contig37142newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30009189SMESG000003375.1 dd_Smed_v6_1630_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009189SMESG000003375.1 dd_Smed_v6_1630_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30009189SMESG000003375.1 dd_Smed_v6_1630_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 125.176 bits (313), Expect = 4.845e-29
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLK--SDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT        P   S   E   D+  +   + ++R +A+ELL H F
Sbjct:  356 INWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQP----TNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHF 617          
BLAST of Kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 125.176 bits (313), Expect = 5.378e-29
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLK--SDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT        P   S   E   D+  +   + ++R +A+ELL H F
Sbjct:  360 INWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQP----TNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHF 621          
BLAST of Kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 124.79 bits (312), Expect = 7.456e-29
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLK--SDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT        P   S   E   D+  +   + ++R +A+ELL H F
Sbjct:  387 INWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQP----TNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHF 648          
BLAST of Kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 124.79 bits (312), Expect = 7.882e-29
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLK--SDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT        P   S   E   D+  +   + ++R +A+ELL H F
Sbjct:  391 INWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQP----TNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHF 652          
BLAST of Kinase vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 124.79 bits (312), Expect = 7.882e-29
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLK--SDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT        P   S   E   D+  +   + ++R +A+ELL H F
Sbjct:  391 INWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQP----TNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHF 652          
BLAST of Kinase vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 111.309 bits (277), Expect = 2.452e-25
Identity = 67/205 (32.68%), Postives = 103/205 (50.24%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
             HP IV+       +   ++ +++M GGSLT  +      TEP I   ++Q+L  +DFLH + ++HRD+K   +LL  +  VKL  F    + ++      +     S  G+  W A EV+  E Y + ADIWSFG ++IE++ G  P+ N   FQA+ RI    +  F      S +L      C+  D  +R  AK+LL H F
Sbjct:  284 QHPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTATR-MTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQLSE------EVPRRRSLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLLRHPF 481          
BLAST of Kinase vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 111.309 bits (277), Expect = 2.524e-25
Identity = 67/205 (32.68%), Postives = 103/205 (50.24%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
             HP IV+       +   ++ +++M GGSLT  +      TEP I   ++Q+L  +DFLH + ++HRD+K   +LL  +  VKL  F    + ++      +     S  G+  W A EV+  E Y + ADIWSFG ++IE++ G  P+ N   FQA+ RI    +  F      S +L      C+  D  +R  AK+LL H F
Sbjct:  282 QHPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTATR-MTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQLSE------EVPRRRSLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLLRHPF 479          
BLAST of Kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 110.923 bits (276), Expect = 3.294e-25
Identity = 85/267 (31.84%), Postives = 136/267 (50.94%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCM-GYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIR-FAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSK---LESFTDWCLKSDPKERATAKELLAHEFL 1282
            + K D  GS   G VY    +  +  + +KQ    N K++  KEL+       +   H  IV  +  Y  C++  ++ ++Y+ GGSLT  + E   Q E  II    +++L+ ++FLH ++++HRD+K   +LL  +  VKL  F    +   +S +  K +   +  G+  W+APEV+  + YG   D+WS G + IE++ G  PY N    +AI+ IAT  K DF   PG  S     + F D  L+   + R +A +LL H FL
Sbjct:  246 YRKVDKIGSGASGSVYTAIEISTEAEVAIKQM---NLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDEL-WVVMEYLAGGSLTDVVTEC--QMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQ---LSPEQRKRT---TMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDF---PGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL 497          
BLAST of Kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 110.923 bits (276), Expect = 5.010e-25
Identity = 85/267 (31.84%), Postives = 136/267 (50.94%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCM-GYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIR-FAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSK---LESFTDWCLKSDPKERATAKELLAHEFL 1282
            + K D  GS   G VY    +  +  + +KQ    N K++  KEL+       +   H  IV  +  Y  C++  ++ ++Y+ GGSLT  + E   Q E  II    +++L+ ++FLH ++++HRD+K   +LL  +  VKL  F    +   +S +  K +   +  G+  W+APEV+  + YG   D+WS G + IE++ G  PY N    +AI+ IAT  K DF   PG  S     + F D  L+   + R +A +LL H FL
Sbjct:  295 YRKVDKIGSGASGSVYTAIEISTEAEVAIKQM---NLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDEL-WVVMEYLAGGSLTDVVTEC--QMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQ---LSPEQRKRT---TMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDF---PGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL 546          
BLAST of Kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 110.923 bits (276), Expect = 5.146e-25
Identity = 85/267 (31.84%), Postives = 136/267 (50.94%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCM-GYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIR-FAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSK---LESFTDWCLKSDPKERATAKELLAHEFL 1282
            + K D  GS   G VY    +  +  + +KQ    N K++  KEL+       +   H  IV  +  Y  C++  ++ ++Y+ GGSLT  + E   Q E  II    +++L+ ++FLH ++++HRD+K   +LL  +  VKL  F    +   +S +  K +   +  G+  W+APEV+  + YG   D+WS G + IE++ G  PY N    +AI+ IAT  K DF   PG  S     + F D  L+   + R +A +LL H FL
Sbjct:  292 YRKVDKIGSGASGSVYTAIEISTEAEVAIKQM---NLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDEL-WVVMEYLAGGSLTDVVTEC--QMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQ---LSPEQRKRT---TMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDF---PGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL 543          
BLAST of Kinase vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 115.931 bits (289), Expect = 2.196e-26
Identity = 72/209 (34.45%), Postives = 107/209 (51.20%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGF----RTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            HP IV+    F      ++ ++Y+ GG+LT  +  +    E  I    KQ L+ + +LH Q ++HRD+K   +LL  +  VKL  F    + S+E              +S  G+  W++PEV+    YG   DIWS G ++IE++ G  P+ N    QA+ RI  M+  +       S +L+SF D  L  DP +RATA ELLAH FL
Sbjct:  422 HPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTHSR-MDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQEL----------PKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFL 619          
BLAST of Kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 112.849 bits (281), Expect = 2.602e-25
Identity = 81/273 (29.67%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  464 IYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            I  V +PN   + K +  G    G VY          + +KQ    N  ++  KEL+       +   HP +V  +  +   +  ++ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   +LL  +  VKL  F    +   IS +  K +   +  G+  W+APEV+  + YG   D+WS G + IE++ G  PY N    +A++ IAT  K +       SS  + F D CL+ +   RA+A +LL H FL
Sbjct:  420 IVSVGDPN-RKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQM---NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC-MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQ---ISPEQSKRT---TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 112.849 bits (281), Expect = 2.602e-25
Identity = 81/273 (29.67%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  464 IYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            I  V +PN   + K +  G    G VY          + +KQ    N  ++  KEL+       +   HP +V  +  +   +  ++ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   +LL  +  VKL  F    +   IS +  K +   +  G+  W+APEV+  + YG   D+WS G + IE++ G  PY N    +A++ IAT  K +       SS  + F D CL+ +   RA+A +LL H FL
Sbjct:  420 IVSVGDPN-RKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQM---NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC-MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQ---ISPEQSKRT---TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 112.849 bits (281), Expect = 2.602e-25
Identity = 81/273 (29.67%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  464 IYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            I  V +PN   + K +  G    G VY          + +KQ    N  ++  KEL+       +   HP +V  +  +   +  ++ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   +LL  +  VKL  F    +   IS +  K +   +  G+  W+APEV+  + YG   D+WS G + IE++ G  PY N    +A++ IAT  K +       SS  + F D CL+ +   RA+A +LL H FL
Sbjct:  420 IVSVGDPN-RKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQM---NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC-MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQ---ISPEQSKRT---TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 112.849 bits (281), Expect = 2.602e-25
Identity = 81/273 (29.67%), Postives = 132/273 (48.35%), Query Frame = 2
Query:  464 IYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            I  V +PN   + K +  G    G VY          + +KQ    N  ++  KEL+       +   HP +V  +  +   +  ++ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   +LL  +  VKL  F    +   IS +  K +   +  G+  W+APEV+  + YG   D+WS G + IE++ G  PY N    +A++ IAT  K +       SS  + F D CL+ +   RA+A +LL H FL
Sbjct:  420 IVSVGDPN-RKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQM---NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC-MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQ---ISPEQSKRT---TMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          
BLAST of Kinase vs. Ensembl Zebrafish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 124.02 bits (310), Expect = 9.412e-31
Identity = 68/207 (32.85%), Postives = 113/207 (54.59%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDI-SSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            H  IV  +G    E    I ++Y+ GGS+++ LG+ GP  E   + +++QILEG+ +LH   ++HRDLKG+ ++L     VKL  F  +R  + + +S   K    +S HG+  W+APEV+    +G  +DIWS G  + E+ TG  P  ++    A++ I   + +        S+  + F   CL  D ++R +A+ELL H F++
Sbjct:   80 HTNIVGFLGTALSENIVSIFMEYIPGGSISNILGQFGPLPEKVFVLYSQQILEGVAYLHANRVIHRDLKGNNIMLMPTGVVKLIDFGCARRLSCLQTSTGSKGDLLKSVHGTPYWMAPEVINETGHGRKSDIWSIGCTVFEMATGKPPLAHMNKMAALYYIGARRGLMPSLSDDFSTDAKDFVQACLTRDQRQRPSAEELLRHPFIS 286          
BLAST of Kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 125.561 bits (314), Expect = 2.133e-29
Identity = 76/208 (36.54%), Postives = 110/208 (52.88%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  SR    I       +  +S  G+  W++PEV+ GE YG  ADIWS G  ++E++T   P+       AIF+IAT +  +   PP  S     F       + K+R  A++LL H F++
Sbjct:  421 HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTIC---LSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIAT-QPTNPTLPPHVSDHCRDFLKRIF-VETKQRPAAEDLLRHTFVH 623          
BLAST of Kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 125.561 bits (314), Expect = 2.425e-29
Identity = 76/208 (36.54%), Postives = 110/208 (52.88%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  SR    I       +  +S  G+  W++PEV+ GE YG  ADIWS G  ++E++T   P+       AIF+IAT +  +   PP  S     F       + K+R  A++LL H F++
Sbjct:  413 HERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTIC---LSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIAT-QPTNPTLPPHVSDHCRDFLKRIF-VETKQRPAAEDLLRHTFVH 615          
BLAST of Kinase vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 124.02 bits (310), Expect = 7.396e-29
Identity = 75/206 (36.41%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT +  +   P   S     F   C+  + K R +A+ELL H F
Sbjct:  403 HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIAT-QPTNPQLPSHISEHTRDFLR-CIFVEAKYRPSAEELLRHPF 603          
BLAST of Kinase vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 123.635 bits (309), Expect = 1.087e-28
Identity = 75/206 (36.41%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT +  +   P   S     F   C+  + K R +A+ELL H F
Sbjct:  421 HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIAT-QPTNPQLPSHISEHTRDFLR-CIFVEAKYRPSAEELLRHPF 621          
BLAST of Kinase vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 135.961 bits (341), Expect = 1.341e-32
Identity = 88/267 (32.96%), Postives = 133/267 (49.81%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    R+ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT +  +   PP +S +   F    L  + ++R TA+EL+ H F
Sbjct:  345 INWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT-QPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIRHPF 606          
BLAST of Kinase vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 135.961 bits (341), Expect = 1.420e-32
Identity = 88/267 (32.96%), Postives = 133/267 (49.81%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    R+ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT +  +   PP +S +   F    L  + ++R TA+EL+ H F
Sbjct:  363 INWRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT-QPTNPQLPPNTSEQCRDFVKRIL-VEARQRPTAEELIRHPF 624          
BLAST of Kinase vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 128.642 bits (322), Expect = 3.190e-30
Identity = 87/267 (32.58%), Postives = 132/267 (49.44%), Query Frame = 2
Query:  515 FGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWC---LKS---DPKERATAKELLAHEFLN 1285
             G    G+VY C  + K   L +KQ  F  D+ +  +    ++      K   H RIV+  G  R   E+   I ++YM GGS+   L   G  TE    R+ +QIL+G+ +LHG  I+HRD+KG+ +L D   +VKL  F  S+    I       +  +S  G+  W++PEV+ GE YG  AD+WS    ++E++T   P+       AIF+IAT         P      ++ +D C   +K    + K R TA+ELL H F++
Sbjct:  360 LGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTIC---MSGTGIKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQ--------PTKPRLPDTVSDACRDFMKQIFVEEKRRPTAEELLRHLFVS 615          
BLAST of Kinase vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 128.642 bits (322), Expect = 3.785e-30
Identity = 87/267 (32.58%), Postives = 132/267 (49.44%), Query Frame = 2
Query:  515 FGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWC---LKS---DPKERATAKELLAHEFLN 1285
             G    G+VY C  + K   L +KQ  F  D+ +  +    ++      K   H RIV+  G  R   E+   I ++YM GGS+   L   G  TE    R+ +QIL+G+ +LHG  I+HRD+KG+ +L D   +VKL  F  S+    I       +  +S  G+  W++PEV+ GE YG  AD+WS    ++E++T   P+       AIF+IAT         P      ++ +D C   +K    + K R TA+ELL H F++
Sbjct:  367 LGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVNALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTIC---MSGTGIKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQ--------PTKPRLPDTVSDACRDFMKQIFVEEKRRPTAEELLRHLFVS 622          
BLAST of Kinase vs. Ensembl Xenopus
Match: pex10 (peroxisomal biogenesis factor 10 [Source:Xenbase;Acc:XB-GENE-954175])

HSP 1 Score: 127.487 bits (319), Expect = 2.768e-29
Identity = 80/265 (30.19%), Postives = 132/265 (49.81%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXX---XXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + K +  G    G VY C    + + +  KQ   D++     ++    ++E     K  DH  IV  +G  R +    I ++++ GGS+ S L   GP  E   I++ KQIL+GI +LH   ++HRD+KG+ ++L  N  +KL  F  ++    ++    +     S HG+  W+APEV+    +G  +DIWS G  + E+ TG  P  ++    A+F I   + +    P   S     F + CL  D +ER +A++LLAH F+
Sbjct: 1112 WTKGEVLGKGAYGTVY-CGLTSQGELIAAKQVVLDSSDPVTAQKEYKKLQEEVDLLKALDHVNIVGYLGTCREDNMVTIFMEFVPGGSIASILRRFGPLQEMVFIKYTKQILQGIVYLHSNRVIHRDIKGNNLMLMPNGIIKLIDFGCAKRLTYLNKSGTQSEMLRSMHGTPYWMAPEVITESGHGKKSDIWSLGCTVFEMATGKPPLAHMNKMAAMFYIGAERGLMPTLPDHFSKNSRDFVNLCLTRDQEERPSAEQLLAHPFM 1375          
BLAST of Kinase vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 124.02 bits (310), Expect = 8.829e-29
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLK--SDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT        P   S   E   D+  +   + ++R +A+ELL H F
Sbjct:  360 INWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQP----TNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHF 621          
BLAST of Kinase vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 120.939 bits (302), Expect = 7.288e-28
Identity = 74/208 (35.58%), Postives = 109/208 (52.40%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   ++KL  F  S+    I       +  +S  G+  W++PEV+ GE YG  ADIWS    ++E++T   P+       AIF+IAT +  +   PP  S     F       + K R +A+ELL H F++
Sbjct:  415 HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTIC---LSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIAT-QPTNPKLPPHVSDYTRDFLKRIF-VEAKLRPSAEELLRHMFVH 617          
BLAST of Kinase vs. Ensembl Mouse
Match: Pak2 (p21 (RAC1) activated kinase 2 [Source:MGI Symbol;Acc:MGI:1339984])

HSP 1 Score: 118.242 bits (295), Expect = 2.573e-27
Identity = 81/262 (30.92%), Postives = 128/262 (48.85%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + +Y+  G    G V+  T +     + +KQ    N +++  KEL+       K   +P IV  +  +      F+ ++Y+ GGSLT  + E     E  I    ++ L+ ++FLH   ++HRD+K   VLL     VKL  F    +   I+ +  K S   +  G+  W+APEV+  + YG   DIWS G + IE++ G  PY N    +A++ IAT    +   P   S     F + CL+ D ++R +AKELL H FL
Sbjct:  249 YTRYEKIGQGASGTVFTATDVALGQEVAIKQI---NLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETC-MDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQ---ITPEQSKRS---TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFL 500          
BLAST of Kinase vs. Ensembl Mouse
Match: Stk24 (serine/threonine kinase 24 [Source:MGI Symbol;Acc:MGI:2385007])

HSP 1 Score: 116.701 bits (291), Expect = 3.635e-27
Identity = 77/212 (36.32%), Postives = 110/212 (51.89%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFND--ISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPP---GSSSK-LESFTDWCLKSDPKERATAKELLAHEFL 1282
            D P + K  G +  +   +I ++Y+ GGS    L E GP  E  I    ++IL+G+D+LH +  +HRD+K + VLL E+ +VKL  F  + +  D  I  + F         G+  W+APEV+    Y S ADIWS G   IEL  G  P+  L   + +F I          PP   G+ SK L+ F + CL  +P  R TAKELL H+F+
Sbjct:   78 DSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLL-EPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFV--------GTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNN------PPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFI 274          
BLAST of Kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 116.316 bits (290), Expect = 1.205e-26
Identity = 78/262 (29.77%), Postives = 130/262 (49.62%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + +++  G    G VY    +     + +KQ    N +++  KEL+       +   +P IV  +  +      ++ ++Y+ GGSLT  + E     E  I    ++ L+ ++FLH   ++HRD+K   +LL  +  VKL  F    +   I+ +  K S   +  G+  W+APEV+  + YG   DIWS G + IE+I G  PY N    +A++ IAT    +   P   S+    F + CL+ D ++R +AKELL H+FL
Sbjct:  269 YTRFEKIGQGASGTVYTAMDVATGQEVAIKQM---NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC-MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQ---ITPEQSKRS---TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFL 520          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|Q54R82|MKKA_DICDI (Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 5.199e-31
Identity = 79/206 (38.35%), Postives = 118/206 (57.28%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAI-FRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            H  IV+ +G    +    + L+Y+ GGS++S LG+ G  +E  I  + KQIL+G+ FLH   I+HRD+KG+ +L+D    VKL  F  S+ F+ I S  FK     S  G+  W+APEV+    +G S+DIWS G +++E+ T   P+ N+T   A+ + IA+   I  + P   S +   F + C K DPKER  A +LL H F+
Sbjct:  231 HDNIVRYLGTSLDQSFLSVFLEYIPGGSISSLLGKFGAFSENVIKVYTKQILQGLSFLHANSIIHRDIKGANILIDTKGIVKLSDFGCSKSFSGIVS-QFK-----SMQGTPYWMAPEVIKQTGHGRSSDIWSLGCVIVEMATAQPPWSNITELAAVMYHIASSNSIPNI-PSHMSQEAFDFLNLCFKRDPKERPDANQLLKHPFI 429          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|Q03497|STE20_YEAST (Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE20 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.700e-29
Identity = 88/265 (33.21%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  488 FMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + N +K    G    G VY    +G    + +KQ    N +++  KEL+       K   HP IV  +  +  +   ++ ++YM GGSLT  +  +   TE  I    ++ L G++FLH + ++HRD+K   +LL    D+KL  F    + N++   N K +      G+  W+APEV+  + YG   DIWS G ++IE+I G  PY N T  +A++ IAT        P   SS L+ F DWCL  +P++RA+A ELL  E++
Sbjct:  620 YANLVK---IGQGASGGVYTAYEIGTNVSVAIKQM---NLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVV-THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINEL---NLKRTTMV---GTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYI 871          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|O22040|ANP1_ARATH (Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 6.277e-29
Identity = 75/209 (35.89%), Postives = 118/209 (56.46%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPY-HNLTVFQAIFRIATMKKIDFMYPP---GSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            HP IV+ +G  R +    I L+++ GGS++S L + GP  E  +  + +Q+L G+++LH   IMHRD+KG+ +L+D    +KL  F  S++  ++++     + ++S  G+  W+APEV++   +  SADIWS G  +IE++TG  P+        AIF I T K     +PP     SS  + F   CL+  P  R TA ELL H F+
Sbjct:  131 HPNIVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQVAELAT----MTGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKEVAAIFFIGTTKS----HPPIPDTLSSDAKDFLLKCLQEVPNLRPTASELLKHPFV 331          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|Q9FZ36|M3K2_ARATH (Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 7.987e-29
Identity = 75/209 (35.89%), Postives = 117/209 (55.98%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPY-HNLTVFQAIFRIATMKKIDFMYPP---GSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            HP IV+ +G  R ++   I L+++ GGS++S L + G   E  +  +  Q+L G+++LH   IMHRD+KG+ +L+D    +KL  F  S++  ++++     S ++S  G+  W+APEV++   +  SADIWS G  +IE++TG  P+        AIF I T K     +PP     SS    F   CL+ +P  R TA ELL H F+
Sbjct:  130 HPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGCIKLADFGASKQVAELAT----ISGAKSMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKEIAAIFHIGTTKS----HPPIPDNISSDANDFLLKCLQQEPNLRPTASELLKHPFV 330          
BLAST of Kinase vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 2.583e-28
Identity = 86/269 (31.97%), Postives = 130/269 (48.33%), Query Frame = 2
Query:  491 MNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ--FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLK--SDPKERATAKELLAHEF 1279
            +N+ +    G    G+VY C  +     L  KQ  F  D+ +  +    ++      K   H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT        P   S   E   D+  +   + ++R +A+ELL H F
Sbjct:  360 INWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQP----TNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHF 621          
BLAST of Kinase vs. TrEMBL
Match: A8I1H8 (Predicted protein (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CHLREDRAFT_98709 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.514e-34
Identity = 75/206 (36.41%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLT-VFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            H  IV+ +G  R  +   I L+Y+ GG ++S L + GP  E  +  + KQIL G+++LH Q +MHRD+KG+ +L+D N  VKL  F  S++  D+++       S S  G+ NW+APEV+    +G +ADIWS G ++IE+ TG  P+ N +  +  ++ +A  K++  M P   S   + F   C    P+ER  A  LL H +L
Sbjct:   70 HENIVRYLGTERTSEHLNIFLEYVAGGPISSKLAQFGPLREETVRVYTKQILRGLEYLHKQKVMHRDIKGANILVDSNGVVKLADFGASKKIEDLATIG---GGSRSIRGTANWMAPEVIKQSGHGRAADIWSLGCVVIEMATGRAPWANFSDPYAVMYHVAATKELPAM-PDSLSHAAKDFITLCFNRVPRERPNATRLLQHPWL 271          
BLAST of Kinase vs. TrEMBL
Match: T1EDA5 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20194557 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.909e-34
Identity = 85/264 (32.20%), Postives = 135/264 (51.14%), Query Frame = 2
Query:  515 FGSEKIGKVYKCTYMGKKDFLILKQF----RNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASF---IHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
             GS   G+V+ C  M       +KQ     +N  +       L +E     +   HP IV+   YF C+       I ++YM GGS+   + + GP TE N I + KQ+L G+++LH + I+HRD+KG+ +L D   +VKL  F  S+    IS     +S  ++  G++ +++PE++ G  YG   DIWS G  ++E++TG+ P+H L  F AIF+I T  +  +  P   S +   F   C     + R T+ +LL H F+ 
Sbjct:   10 LGSGSFGQVFLCCDMETGKEYAMKQVHIFSKNSQHCSRVLSALREEINILKEGVKHPHIVQ---YFGCQDDGVVFSILMEYMPGGSVKDQIKQYGPLTERNTISYTKQVLLGLEYLHKKSIVHRDVKGANILRDNEGNVKLSDFGASKRLQTIS-----NSIMQTQTGTIYYMSPELLDGNGYGRKTDIWSLGCSVVEMLTGHPPWHQLENFAAIFKIVTSDEPGYSLPDSVSKQARDFVSECFTRSLERRPTSSQLLYHSFVT 265          
BLAST of Kinase vs. TrEMBL
Match: R7U714 (Protein kinase domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_222203 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.011e-34
Identity = 67/184 (36.41%), Postives = 109/184 (59.24%), Query Frame = 2
Query:  728 LKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            ++YM GGS+  ++ ++G  TE    ++  Q+L+G+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I +      A+ +  G+  W++PEV+ GE YG  AD+WS G   +E+++G+ P+H      AIF+IAT ++  +  PP  S   + F   C + DPKER +++ELL H F
Sbjct:    1 MEYMPGGSIKDHISKHGKLTETLTRKYTAQMLDGLCYLHALMIVHRDIKGANILRDHYGNVKLGDFGASKRLQTICT------AAHTVTGTPYWMSPEVVNGEGYGRKADVWSLGCTTVEMLSGHHPWHEFEPMAAIFKIATSQEPKYELPPSVSDVAKDFLKLCFQYDPKERKSSQELLTHRF 178          
BLAST of Kinase vs. TrEMBL
Match: C4R4N2 (Signal transducing MEK kinase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=PAS_chr3_0469 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.048e-34
Identity = 79/206 (38.35%), Postives = 124/206 (60.19%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            DH  +V+C+G    ++   + L+Y+ GGS++S L   GP  EP I  F KQ+L G+ +LH + I+HRD+KG+ VL+D    VK+  F  S+  +D+   + + S      GSV W+APEV+   +Y + ADIWS G ++IE+ TG  P+ + +  QAIF+I    + +   PP +S    SF + CL+SD  +R++A +L  HEF+
Sbjct:  506 DHENVVRCIGSSIDDEFLNVFLEYIPGGSVSSMLNNYGPFEEPLIRNFVKQVLSGLAYLHEKQIIHRDIKGANVLIDTKGTVKISDFGISKRMSDLKPSSKRASL----QGSVYWMAPEVVKQTVYTNKADIWSVGCLIIEMFTGKHPFPDFSQMQAIFKIGMQTRPEI--PPTASDLARSFLESCLESDYTKRSSATDLSHHEFV 705          
BLAST of Kinase vs. TrEMBL
Match: F2QWB5 (Signal transducing MEK kinase OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=STE11 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 4.048e-34
Identity = 79/206 (38.35%), Postives = 124/206 (60.19%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            DH  +V+C+G    ++   + L+Y+ GGS++S L   GP  EP I  F KQ+L G+ +LH + I+HRD+KG+ VL+D    VK+  F  S+  +D+   + + S      GSV W+APEV+   +Y + ADIWS G ++IE+ TG  P+ + +  QAIF+I    + +   PP +S    SF + CL+SD  +R++A +L  HEF+
Sbjct:  506 DHENVVRCIGSSIDDEFLNVFLEYIPGGSVSSMLNNYGPFEEPLIRNFVKQVLSGLAYLHEKQIIHRDIKGANVLIDTKGTVKISDFGISKRMSDLKPSSKRASL----QGSVYWMAPEVVKQTVYTNKADIWSVGCLIIEMFTGKHPFPDFSQMQAIFKIGMQTRPEI--PPTASDLARSFLESCLESDYTKRSSATDLSHHEFV 705          
BLAST of Kinase vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 124.02 bits (310), Expect = 4.535e-31
Identity = 68/207 (32.85%), Postives = 110/207 (53.14%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            +HP IV  +G    +    I ++Y+ GGS++S L   GP  E     + +Q+LEG+ +LH   ++HRDLKG+ ++L     VKL  F  +R  N ++         +S HG+  W+APEV+    +G  +D+WS G  + E+ TG  P  ++    A+F I   K +    P   S + +SF   CL +  K+R +A +LL H F++
Sbjct:   74 EHPNIVGFLGTALTDNVISIFMEYVPGGSISSVLNRFGPLPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGVVKLIDFGCARRLNRLTHSGGNSDLLKSVHGTPYWMAPEVINETGHGKKSDVWSIGCTVFEMATGKPPLAHMGKMAALFYIGARKGLMPPLPDDFSEEAKSFVKACLINQ-KQRPSAADLLRHPFIS 279          
BLAST of Kinase vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 122.094 bits (305), Expect = 2.367e-28
Identity = 73/206 (35.44%), Postives = 109/206 (52.91%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ G+ YG  AD+WS G  ++E++T   P+       AIF+IAT +  + + P  +S +   F       + K R +A+ELL H F
Sbjct:  415 HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT-QPTNPILPSHTSEQTRDFIRRIF-VEAKHRPSAEELLRHPF 615          
BLAST of Kinase vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 122.094 bits (305), Expect = 2.367e-28
Identity = 73/206 (35.44%), Postives = 109/206 (52.91%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ G+ YG  AD+WS G  ++E++T   P+       AIF+IAT +  + + P  +S +   F       + K R +A+ELL H F
Sbjct:  415 HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT-QPTNPILPSHTSEQTRDFIRRIF-VEAKHRPSAEELLRHPF 615          
BLAST of Kinase vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 122.094 bits (305), Expect = 2.367e-28
Identity = 73/206 (35.44%), Postives = 109/206 (52.91%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ G+ YG  AD+WS G  ++E++T   P+       AIF+IAT +  + + P  +S +   F       + K R +A+ELL H F
Sbjct:  415 HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT-QPTNPILPSHTSEQTRDFIRRIF-VEAKHRPSAEELLRHPF 615          
BLAST of Kinase vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 120.939 bits (302), Expect = 5.220e-28
Identity = 77/214 (35.98%), Postives = 112/214 (52.34%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWC---LKS---DPKERATAKELLAHEFLN 1285
            H RIV+  G  R   E+   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  SR    I       +  +S  G+  W++PEV+ GE YG  ADIWS G  ++E++T   P+       AIF+IAT         P + +     +D C   LK    + K+R  A+ELL H F++
Sbjct:  418 HERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTIC---LSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAIFKIATQ--------PTNPALPAHVSDHCRDFLKRIFVETKQRPAAEELLRHIFVH 620          
BLAST of Kinase vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 127.872 bits (320), Expect = 6.634e-31
Identity = 91/268 (33.96%), Postives = 131/268 (48.88%), Query Frame = 2
Query:  494 NFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYT--KFGDHPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            N+ +    G    G+VY C        L +KQ + D    E  KE+          K   H RIV+  G  R   +K   I ++YM GGS+   L   G  TE    ++ +QILEG+ FLHG  I+HRD+KG+ +L D   +VKL  F  S+    I S     +A  S  G+  W++PEV+ GE YG  ADIWS G  ++E++T   P+       AIF+IAT +  D   P  +S             + K R +A++LL H F++
Sbjct:  358 NWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQG---TAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIAT-QPTDPRLPLHASEHARDLLRRIF-VEAKLRPSAEDLLRHPFVH 620          
BLAST of Kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 107.457 bits (267), Expect = 7.119e-25
Identity = 76/215 (35.35%), Postives = 106/215 (49.30%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKG--SKVLLDENLDVKLCGFRTSREFND--ISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPP---GSSSK-LESFTDWCLKSDPKERATAKELLAHEFLN 1285
            D P +    G +      +I ++Y+ GGS    + + GP  E  I    ++IL+G+D+LH +  +HRD+KG  + VLL E  DVKL  F  + +  D  I  + F         G+  W+APEV+    Y   ADIWS G   IEL  G  P   L   + +F I          PP   G+ SK  + F D CL  DP+ R TAKELL H+F+ 
Sbjct:   80 DSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLI-KPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFV--------GTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNN------PPTLEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQ 279          
BLAST of Kinase vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 107.842 bits (268), Expect = 4.315e-24
Identity = 71/216 (32.87%), Postives = 106/216 (49.07%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGE-NGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKH-SASESNHGSVNWIAPEVMIGEI-----YGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN*V 1291
            DHP IV  +  F  E   +I +++  GG++ + + E      EP I    KQ+LE +++LH   I+HRDLK   +LL    DVKL  F        +S+ N +     +S  G+  W+APEV++ E      Y   ADIWS G  +IEL     P H L   + + +IA        +P   S++   F   CL  +P+ R  A +LL H F++ V
Sbjct:   86 DHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADF-------GVSAKNTRTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFISGV 294          
BLAST of Kinase vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 101.679 bits (252), Expect = 4.947e-24
Identity = 57/205 (27.80%), Postives = 100/205 (48.78%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            HP +V+ +G         I ++++ GG++   +   GP  E     +  Q+  G+ +LHG  +MH D+KGS  ++     VKL  F  ++    ++    ++    S HG+  W+APEV+ G  Y   AD+WS G  + E+  G  P+ ++    A+  I     I    P   S + + F + C   D  +R +++ELL+H F+
Sbjct:   80 HPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRV-ALALSCHENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELLSHPFI 283          
BLAST of Kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006402.1 (pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 gene:ENSPMAG00000005783.1 transcript:ENSPMAT00000006402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 1.230e-21
Identity = 65/217 (29.95%), Postives = 112/217 (51.61%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASF-IHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQY----IMHRDLKGSKVLLD---ENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYH---NLTVFQAIFRIATMKKIDFMYP---PGSSSKLESFTDWCLKSDPKERATAKELLAH 1273
            DHP I++ +G   CEK+++ + +++M GGS+ + L + GP  E  +I + +Q+L G+ +LH       ++HRD+KG+ +L+D   + L +   G           +  F+        G++ ++APEV+ G  YG S DIWS G ++IE+     P++   +      IF+IA+      + P   PG    L      CL+  P +R  A++LL H
Sbjct:   83 DHPNIIRMLGAT-CEKSNYNLFIEWMAGGSVANLLNKYGPFHERVVISYVEQLLRGLAYLHSNQHSNQLIHRDIKGANLLVDSMGQRLRIADFGAAARLASKGTGAGEFQGQLL----GTIAFMAPEVLRGLQYGRSCDIWSVGCVIIEMSCAKPPWNAEKHSNHLALIFKIASTTTAPTVPPTLCPG----LRDVALRCLELQPSDRPVARDLLKH 290          
BLAST of Kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 128.642 bits (322), Expect = 6.769e-31
Identity = 88/265 (33.21%), Postives = 137/265 (51.70%), Query Frame = 2
Query:  488 FMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + N +K    G    G VY    +G    + +KQ    N +++  KEL+       K   HP IV  +  +  +   ++ ++YM GGSLT  +  +   TE  I    ++ L G++FLH + ++HRD+K   +LL    D+KL  F    + N++   N K +      G+  W+APEV+  + YG   DIWS G ++IE+I G  PY N T  +A++ IAT        P   SS L+ F DWCL  +P++RA+A ELL  E++
Sbjct:  620 YANLVK---IGQGASGGVYTAYEIGTNVSVAIKQM---NLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVV-THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINEL---NLKRTTMV---GTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYI 871          
BLAST of Kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 123.635 bits (309), Expect = 3.365e-29
Identity = 84/274 (30.66%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQ-----FRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVM-IGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKL-------ESFTDWCLKSDPKERATAKELLAHEF 1279
            ++K +  G    G VY C  +   + + +KQ     + + N       E ++      K  DH  IV+ +G+        + L+Y+ GGS+ S +   G   EP I     Q+L+G+ +LH + I+HRD+K   +LLD++   K+  F  SR+  DI S+     +  +  G+V W+APE++   + Y +  DIWS G I++E+  G  P+ NL V  A+F+I   K      PP     L        +F D C + +P++R TA ELL+H F
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSN-----SDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSA----PPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439          
BLAST of Kinase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 118.242 bits (295), Expect = 7.320e-28
Identity = 71/192 (36.98%), Postives = 112/192 (58.33%), Query Frame = 2
Query:  722 IHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN*VII 1297
            I L+Y+ GGS++S L   GP  E  I  F +QIL G+ +LH + I+HRD+KG+ +L+D    VK+  F  S++ + +   N K +   S  GSV W++PEV+      + ADIWS G ++IE+ TG  P+ + +  QAIF+I T    +   P  ++S+ ++F     + D + R +A ELL H +L+  II
Sbjct:  531 IFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPL---NKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEI--PSWATSEGKNFLRKAFELDYQYRPSALELLQHPWLDAHII 717          
BLAST of Kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 114.775 bits (286), Expect = 1.153e-26
Identity = 69/206 (33.50%), Postives = 103/206 (50.00%), Query Frame = 2
Query:  692 GYFRCEKASFIHLKYMTGGSLTSYLGENGPQ--------TEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
             Y R +   ++ +++M GGSLT  + EN P         TEP I    ++  +G+ FLH ++I+HRD+K   VLLD    VK+  F       D      K S   +  G+  W+APEV+    Y    D+WS G + IE++ G  PY N    +A++ IAT       +P   S +++ F   CL  D + RA+ +ELL H F N
Sbjct:  628 AYLRTDDDLWVVMEFMEGGSLTDII-ENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTD------KRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFFN 826          
BLAST of Kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 115.161 bits (287), Expect = 1.197e-26
Identity = 71/215 (33.02%), Postives = 110/215 (51.16%), Query Frame = 2
Query:  665 DHPRIVKCMGYFRCEKASFIHLKYMTGGSL-------TSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGS-SSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            +H  IVK  G+ R     +I L+Y   GSL       ++ L EN  +T      +  Q L G+ +LHG+ ++HRD+K + +LL  +  VKL  F  S   N         S++ +  G++NW+APE++      + +DIWS G  ++E++T N PYHNLT     + +      D  YPP S S  L+ F   C   +  +R TA +LL H ++N
Sbjct:   78 NHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKT------YVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVN---------SSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEN----DTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWIN 273          
BLAST of Kinase vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 126.331 bits (316), Expect = 2.185e-32
Identity = 82/266 (30.83%), Postives = 135/266 (50.75%), Query Frame = 2
Query:  494 NFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRND--NNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            N+ K    G+   G+VY C  +     L +KQ      N+  +   + ++    + K   + RIV+  G    +   +I ++Y+ GGS+  ++ ++G   E    ++++QILEGI +LH   I+HRD+KG+ +L D   +VKL  F  S+    I S     +   S HG+  W+APEV+ GE YG  AD+WS G  ++E++T   P+ +     A+F+IAT +  +   P   S     F    L+ + K R +A ELL   F+ 
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSK----TGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIAT-QPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVT 263          
BLAST of Kinase vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 114.775 bits (286), Expect = 2.339e-28
Identity = 64/203 (31.53%), Postives = 105/203 (51.72%), Query Frame = 2
Query:  677 IVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            I  CM   +C    F  ++++ GGS+   L   G   EP   R+ +QIL+G+ +LH   ++HRD+KG  ++L  N  +KL  F  +++   + +   K +   S  G+  W+APEV+    +G  +DIWS G  + E+ TG  P+ N+    AIF I     +  +    S++ ++ F   C+  D   R +A ELL H+FL 
Sbjct:   71 IGTCMDDSQCTINIF--MEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIGNGSPVPRLDESFSAAAID-FVTSCMTRDQDTRPSADELLRHDFLQ 270          
BLAST of Kinase vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 117.087 bits (292), Expect = 6.755e-27
Identity = 71/214 (33.18%), Postives = 116/214 (54.21%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDEN-LDVKLCGF-RTSREFNDIS-SDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYH---NLTVFQAIFRIATMKKIDFMYPPGSSSKL----ESFTDWCLKSDPKERATAKELLAHEF 1279
            HP ++KC+G  R      I L++M GGS++  L + GP  E  +IR+ +QIL+G+ +LH   ++HRD+KG+ +L+D    D+++  F   +R    I+ +  F+        G++ ++APEV+ GE YG S D+WS G ++IE+ TG  P++   +      IF+IA       + PP     L          CL+S P++R  A +LL H  
Sbjct:  637 HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQGQLL----GTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACA-----IGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLLQHPL 841          
BLAST of Kinase vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 111.309 bits (277), Expect = 7.084e-27
Identity = 69/211 (32.70%), Postives = 107/211 (50.71%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGS------SSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            HP IV+  G        ++ ++++ GG+LT  +      +E  +    + +L+ + FLH Q ++HRD+K   +LL  N  VKL  F    +  +           +S  G+  W+APEV+  + YG+  DIWS G +++E++ G  PY N    QA      M+K+  + PP S      S +L+SF D  L  DP  RATA ELL H F+
Sbjct:   83 HPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTN-LSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTE------DMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQA------MRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFI 280          
BLAST of Kinase vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 110.538 bits (275), Expect = 7.156e-27
Identity = 60/172 (34.88%), Postives = 102/172 (59.30%), Query Frame = 2
Query:  668 HPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDEN-LDVKLCGF-RTSREFNDIS-SDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYH---NLTVFQAIFRIATMKKI 1165
            HP ++KC+G  R      I L++M GGS++  L + GP  E  +IR+ +QIL+G+ +LH   ++HRD+KG+ +L+D    D+++  F   +R    I+ +  F+        G++ ++APEV+ GE YG S D+WS G ++IE+ TG  P++   +      IF+++  KKI
Sbjct:   99 HPHLIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLATQITGAGEFQGQLL----GTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKVSIYKKI 266          
BLAST of Kinase vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 127.872 bits (320), Expect = 3.694e-30
Identity = 75/206 (36.41%), Postives = 111/206 (53.88%), Query Frame = 2
Query:  668 HPRIVKCMGYFR--CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEF 1279
            H RIV+  G  R   EK   I ++YM GGS+   L   G  TE    ++ +QILEG+ +LH   I+HRD+KG+ +L D   +VKL  F  S+    I       +   S  G+  W++PEV+ GE YG  AD+WS G  ++E++T   P+       AIF+IAT +  + + P  +S +   F   C+  + K R +A+ELL H F
Sbjct:  412 HERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC---MSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT-QPTNPLLPSHTSDQARDFIH-CIFVEAKHRPSAEELLRHPF 612          
BLAST of Kinase vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 120.553 bits (301), Expect = 2.314e-28
Identity = 82/262 (31.30%), Postives = 129/262 (49.24%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + +Y+  G    G VY    +     + +KQ    N +++  KEL+       K   +P IV  +  F      F+ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   VLL  +  VKL  F    +   I+ +  K S   +  G+  W+APEV+  + YG   DIWS G + IE++ G  PY N    +A++ IAT    +   P   S   +SF   CL+ D ++R + KELL H FL
Sbjct:  202 YTRYEKIGQGASGTVYTAIDVSTGQEVAIKQI---NLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETC-MDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRS---TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL 453          
BLAST of Kinase vs. Ensembl Medaka
Match: ENSORLT00000028689.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 120.168 bits (300), Expect = 4.419e-28
Identity = 82/262 (31.30%), Postives = 129/262 (49.24%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + +Y+  G    G VY    +     + +KQ    N +++  KEL+       K   +P IV  +  F      F+ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   VLL  +  VKL  F    +   I+ +  K S   +  G+  W+APEV+  + YG   DIWS G + IE++ G  PY N    +A++ IAT    +   P   S   +SF   CL+ D ++R + KELL H FL
Sbjct:  239 YTRYEKIGQGASGTVYTAIDVSTGQEVAIKQI---NLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETC-MDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRS---TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL 490          
BLAST of Kinase vs. Ensembl Medaka
Match: ENSORLT00000043480.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 120.168 bits (300), Expect = 4.419e-28
Identity = 82/262 (31.30%), Postives = 129/262 (49.24%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + +Y+  G    G VY    +     + +KQ    N +++  KEL+       K   +P IV  +  F      F+ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   VLL  +  VKL  F    +   I+ +  K S   +  G+  W+APEV+  + YG   DIWS G + IE++ G  PY N    +A++ IAT    +   P   S   +SF   CL+ D ++R + KELL H FL
Sbjct:  239 YTRYEKIGQGASGTVYTAIDVSTGQEVAIKQI---NLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETC-MDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRS---TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL 490          
BLAST of Kinase vs. Ensembl Medaka
Match: ENSORLT00000030173.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 120.168 bits (300), Expect = 4.419e-28
Identity = 82/262 (31.30%), Postives = 129/262 (49.24%), Query Frame = 2
Query:  497 FIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            + +Y+  G    G VY    +     + +KQ    N +++  KEL+       K   +P IV  +  F      F+ ++Y+ GGSLT  + E     E  I    +++L+ ++FLH   ++HRD+K   VLL  +  VKL  F    +   I+ +  K S   +  G+  W+APEV+  + YG   DIWS G + IE++ G  PY N    +A++ IAT    +   P   S   +SF   CL+ D ++R + KELL H FL
Sbjct:  239 YTRYEKIGQGASGTVYTAIDVSTGQEVAIKQI---NLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETC-MDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRS---TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFL 490          
BLAST of Kinase vs. Planmine SMEST
Match: SMESG000003375.1 (SMESG000003375.1)

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 371/375 (98.93%), Postives = 372/375 (99.20%), Query Frame = 2
Query:  161 YLMEEDPYYSKLIRDRHIMXXXXXXXXXXXPLKIYMTSLVEEYKSFELENIRLFKILTAQVIKILDVPSENILYYRDKEKENRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN 1285
            YL EEDPYYSKLIRDRHIMRKKRK VVRKKPLKIYMTSLVEEYKSFELENIRLFKILTAQVIKILDVPSENILYYRDKEKENRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNKEEEWKELMKEYEFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSA+ESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELL HEFLN
Sbjct:   20 YLKEEDPYYSKLIRDRHIMRKKRKEVVRKKPLKIYMTSLVEEYKSFELENIRLFKILTAQVIKILDVPSENILYYRDKEKENRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNKEEEWKELMKEYEFYTKFGDHPRIVKCMGYFRCEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSAAESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLTHEFLN 394          
BLAST of Kinase vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 198.364 bits (503), Expect = 3.910e-54
Identity = 118/333 (35.44%), Postives = 178/333 (53.45%), Query Frame = 2
Query:  305 ENIRLFKILTAQVIKILDVPSENILY-----YRDKEKENRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXF-YTKFGDHPRIVKCMGYFRCEKASF-IHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            E I +     A   ++  +P E IL       +D E  +  ++  D Y A+  G   I YF +     N +  D  G    GKVY+C  +     + +K+ +   NK+        +    ++K   H RI++   +F+ ++ +F I ++YM  GSL+SYL  NGP  E  I R + Q+LEG+ +LH   I+HRD+KG  +LLD+ L+ KL  F  S+   +ISS +F     +SN G+ NW APEV+  E YG  ADIWSFG  ++E++ G  PY +    Q  F++ T KKI+F  P   + +LE F  WCLK +P ER TA+ LL  +F+
Sbjct:  257 EKITVSDCKKAVADRVKRLPEEIILIKSNQCLKDDETISNYEYSPDSYFALRSG---ISYFRLS-KLENIVNQDPVGEGGFGKVYQCEDLATNKVMAVKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYADYESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFI 585          
BLAST of Kinase vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 198.364 bits (503), Expect = 6.862e-54
Identity = 118/333 (35.44%), Postives = 178/333 (53.45%), Query Frame = 2
Query:  305 ENIRLFKILTAQVIKILDVPSENILY-----YRDKEKENRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXF-YTKFGDHPRIVKCMGYFRCEKASF-IHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            E I +     A   ++  +P E IL       +D E  +  ++  D Y A+  G   I YF +     N +  D  G    GKVY+C  +     + +K+ +   NK+        +    ++K   H RI++   +F+ ++ +F I ++YM  GSL+SYL  NGP  E  I R + Q+LEG+ +LH   I+HRD+KG  +LLD+ L+ KL  F  S+   +ISS +F     +SN G+ NW APEV+  E YG  ADIWSFG  ++E++ G  PY +    Q  F++ T KKI+F  P   + +LE F  WCLK +P ER TA+ LL  +F+
Sbjct:  285 EKITVSDCKKAVADRVKRLPEEIILIKSNQCLKDDETISNYEYSPDSYFALRSG---ISYFRLS-KLENIVNQDPVGEGGFGKVYQCEDLATNKVMAVKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYADYESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFI 613          
BLAST of Kinase vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 198.749 bits (504), Expect = 9.281e-54
Identity = 118/333 (35.44%), Postives = 178/333 (53.45%), Query Frame = 2
Query:  305 ENIRLFKILTAQVIKILDVPSENILY-----YRDKEKENRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXF-YTKFGDHPRIVKCMGYFRCEKASF-IHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            E I +     A   ++  +P E IL       +D E  +  ++  D Y A+  G   I YF +     N +  D  G    GKVY+C  +     + +K+ +   NK+        +    ++K   H RI++   +F+ ++ +F I ++YM  GSL+SYL  NGP  E  I R + Q+LEG+ +LH   I+HRD+KG  +LLD+ L+ KL  F  S+   +ISS +F     +SN G+ NW APEV+  E YG  ADIWSFG  ++E++ G  PY +    Q  F++ T KKI+F  P   + +LE F  WCLK +P ER TA+ LL  +F+
Sbjct:  324 EKITVSDCKKAVADRVKRLPEEIILIKSNQCLKDDETISNYEYSPDSYFALRSG---ISYFRLS-KLENIVNQDPVGEGGFGKVYQCEDLATNKVMAVKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYADYESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFI 652          
BLAST of Kinase vs. Planmine SMEST
Match: SMESG000009500.1 (SMESG000009500.1)

HSP 1 Score: 198.364 bits (503), Expect = 1.571e-53
Identity = 118/333 (35.44%), Postives = 178/333 (53.45%), Query Frame = 2
Query:  305 ENIRLFKILTAQVIKILDVPSENILY-----YRDKEKENRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCTYMGKKDFLILKQFRNDNNXXXXXXXXXXXXXF-YTKFGDHPRIVKCMGYFRCEKASF-IHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQYIMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSVNWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIATMKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFL 1282
            E I +     A   ++  +P E IL       +D E  +  ++  D Y A+  G   I YF +     N +  D  G    GKVY+C  +     + +K+ +   NK+        +    ++K   H RI++   +F+ ++ +F I ++YM  GSL+SYL  NGP  E  I R + Q+LEG+ +LH   I+HRD+KG  +LLD+ L+ KL  F  S+   +ISS +F     +SN G+ NW APEV+  E YG  ADIWSFG  ++E++ G  PY +    Q  F++ T KKI+F  P   + +LE F  WCLK +P ER TA+ LL  +F+
Sbjct:  352 EKITVSDCKKAVADRVKRLPEEIILIKSNQCLKDDETISNYEYSPDSYFALRSG---ISYFRLS-KLENIVNQDPVGEGGFGKVYQCEDLATNKVMAVKEIKIPKNKKLSDVTSAIKEILTFSKLECHQRIIQYFDFFQKDEKTFCITMEYMANGSLSSYLEINGPLEEREIARISTQVLEGLLYLHNNQILHRDIKGGNILLDDKLNAKLADFGLSKCSEEISSWDFYTGILQSNVGTQNWTAPEVLNDEAYGLKADIWSFGATVVEMVVGERPYADYESVQLTFKLLTDKKIEFTPPKTMTRQLEEFIAWCLKPEPHERPTAQLLLNSDFI 680          
The following BLAST results are available for this feature:
BLAST of Kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K34.845e-2931.97mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K35.378e-2931.97mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K37.456e-2931.97mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K37.882e-2931.97mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K37.882e-2931.97mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak-22.452e-2532.68Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-22.524e-2532.68Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-13.294e-2531.84Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-15.010e-2531.84Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-15.146e-2531.84Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
back to top
BLAST of Kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbt2.196e-2634.45gene:FBgn0025743 transcript:FBtr0074285[more]
Pak2.602e-2529.67gene:FBgn0267698 transcript:FBtr0334539[more]
Pak2.602e-2529.67gene:FBgn0267698 transcript:FBtr0081714[more]
Pak2.602e-2529.67gene:FBgn0267698 transcript:FBtr0081716[more]
Pak2.602e-2529.67gene:FBgn0267698 transcript:FBtr0081715[more]
back to top
BLAST of Kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k199.412e-3132.85mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k22.133e-2936.54mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k22.425e-2936.54mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k37.396e-2936.41mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.087e-2836.41mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd81.341e-3232.96sterile alpha motif domain containing 8 [Source:Xe... [more]
samd81.420e-3232.96sterile alpha motif domain containing 8 [Source:Xe... [more]
dennd1a3.190e-3032.58DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
dennd1a3.785e-3032.58DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
pex102.768e-2930.19peroxisomal biogenesis factor 10 [Source:Xenbase;A... [more]
back to top
BLAST of Kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k38.829e-2931.97mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k27.288e-2835.58mitogen-activated protein kinase kinase kinase 2 [... [more]
Pak22.573e-2730.92p21 (RAC1) activated kinase 2 [Source:MGI Symbol;A... [more]
Stk243.635e-2736.32serine/threonine kinase 24 [Source:MGI Symbol;Acc:... [more]
Pak11.205e-2629.77p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54R82|MKKA_DICDI5.199e-3138.35Mitogen-activated protein kinase kinase kinase A O... [more]
sp|Q03497|STE20_YEAST4.700e-2933.21Serine/threonine-protein kinase STE20 OS=Saccharom... [more]
sp|O22040|ANP1_ARATH6.277e-2935.89Mitogen-activated protein kinase kinase kinase ANP... [more]
sp|Q9FZ36|M3K2_ARATH7.987e-2935.89Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q99759|M3K3_HUMAN2.583e-2831.97Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
BLAST of Kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A8I1H81.514e-3436.41Predicted protein (Fragment) OS=Chlamydomonas rein... [more]
T1EDA51.909e-3432.20Protein kinase domain-containing protein OS=Helobd... [more]
R7U7142.011e-3436.41Protein kinase domain-containing protein OS=Capite... [more]
C4R4N24.048e-3438.35Signal transducing MEK kinase OS=Komagataella phaf... [more]
F2QWB54.048e-3438.35Signal transducing MEK kinase OS=Komagataella phaf... [more]
back to top
BLAST of Kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k194.535e-3132.85mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k32.367e-2835.44mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.367e-2835.44mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.367e-2835.44mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k25.220e-2835.98mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k26.634e-3133.96mitogen-activated protein kinase kinase kinase 2 [... [more]
stk25a7.119e-2535.35serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
slka4.315e-2432.87STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
map3k194.947e-2427.80mitogen-activated protein kinase kinase kinase 19 ... [more]
ENSPMAT00000006402.11.230e-2129.95pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 ... [more]
back to top
BLAST of Kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE206.769e-3133.21Cdc42p-activated signal transducing kinase; involv... [more]
BCK13.365e-2930.66MAPKKK acting in the protein kinase C signaling pa... [more]
STE117.320e-2836.98Signal transducing MEK kinase; involved in pheromo... [more]
CLA41.153e-2633.50Cdc42p-activated signal transducing kinase; member... [more]
CDC151.197e-2633.02Protein kinase of the Mitotic Exit Network; locali... [more]
back to top
BLAST of Kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414102.185e-3230.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478212.339e-2831.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361506.755e-2733.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458467.084e-2732.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279767.156e-2734.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k33.694e-3036.41mitogen-activated protein kinase kinase kinase 3 [... [more]
ENSORLT00000015480.22.314e-2831.30serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000028689.14.419e-2831.30serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000043480.14.419e-2831.30serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000030173.14.419e-2831.30serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
back to top
BLAST of Kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003375.10.000e+098.93SMESG000003375.1[more]
SMESG000009500.13.910e-5435.44SMESG000009500.1[more]
SMESG000009500.16.862e-5435.44SMESG000009500.1[more]
SMESG000009500.19.281e-5435.44SMESG000009500.1[more]
SMESG000009500.11.571e-5335.44SMESG000009500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009189 ID=SMED30009189|Name=Kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2545bp
GTTTAAATTTGTTCAATTTATAAATAATATTAATATCCGAATTTACCGTT
TCCGATTATATAACTTGTAAAATTATAACTAAAAAACTTTTGCAAGTTTC
AAAATGGAATCTAGTGAGAGTGATACTGATAGCGAAGATTGTTATTCCAG
CAGCGACGACTATTTAATGGAGGAAGACCCATATTATTCGAAACTAATAA
GGGACAGGCATATTATGCGTAAAAAGAGAAAAGCAGTTGTCAGAAAGAAG
CCTCTGAAAATTTACATGACATCACTAGTTGAAGAATATAAGTCTTTTGA
ATTGGAAAATATTCGTCTTTTTAAAATACTTACTGCACAAGTGATAAAAA
TACTCGATGTTCCATCCGAAAACATTTTGTATTATCGAGACAAAGAAAAA
GAGAATCGGATACAATTTCCCAGTGATTATTATGATGCGGTTGATTACGG
AGATTCAGTCATTATTTATTTCGTTGTCGAACCTAATTTCATGAACTTTA
TTAAATACGATTATTTCGGATCGGAGAAAATCGGCAAAGTCTACAAGTGC
ACGTACATGGGAAAGAAAGATTTCCTGATTTTAAAACAATTCAGAAACGA
CAACAACAAAGAGGAAGAATGGAAAGAGCTCATGAAAGAATATGAATTTT
ACACTAAATTTGGAGATCACCCGAGAATTGTCAAATGTATGGGTTATTTT
AGATGTGAAAAGGCATCGTTTATTCATTTAAAATACATGACTGGGGGTTC
ACTGACAAGCTATTTGGGCGAGAACGGCCCACAAACAGAACCCAATATCA
TTCGATTTGCAAAACAGATTCTAGAAGGAATCGATTTTCTTCATGGACAA
TATATAATGCATCGAGATTTGAAAGGATCGAAAGTTTTACTGGATGAGAA
TTTGGATGTAAAATTGTGCGGTTTCAGAACTTCAAGGGAGTTTAACGATA
TTTCCAGTGACAATTTCAAACATTCCGCATCCGAATCCAATCACGGAAGT
GTCAATTGGATCGCACCTGAAGTGATGATCGGTGAAATTTACGGCAGCAG
TGCTGATATTTGGTCATTTGGAGGGATTATGATTGAATTGATTACTGGAA
ATATACCGTATCATAATTTGACCGTATTTCAAGCCATTTTTCGGATAGCT
ACGATGAAAAAAATCGATTTTATGTATCCTCCCGGTAGCTCGAGCAAGTT
GGAATCGTTTACTGATTGGTGTCTTAAATCCGACCCGAAAGAAAGAGCTA
CTGCGAAAGAATTGTTGGCTCATGAGTTTTTGAATTGAGTAATTATTTTA
TTCTAAAGACTTCATTAGATAAAAAATTATGATTGAAATTTTTATATGAA
ATCTTGTGTTGAGTTAAACGGGATTTATTTTGGTTGTTAGGATTTTGATT
ACCTGACAATCGTTATCAATTGGCTTCTGATTCTTTGCTTTGTTTTATAA
TAAATTTAGCAACGGTTTCCTGTCACTGGTTGTCGGGACTCCTTGTTATG
TAATATCGATTTCTATGATCCTACTTCTCTTTTTAAACTTTATTATTTTA
TAAAAAAATTGGACACACCGCTAGAAGAGAATAAAATCCATGTAGTAATA
ACAATATGTGTAGCTGGATGATTTACAACGGCTTTGTGACTTCGTGAGTC
CTCGAACATAAAATCTAATATTGAAATTTGGAGAAAATGGGCGAAGGTTT
CGTGGCCTACTGTCTGATTTCGTAAATGTGACTCGACGTTACTTATACGG
ATTAAAATTACTGAGTAATCGAGTCGGCACTCACTAAATTTACCATAAAT
ATGCTCAATCTTTAATGTCGATATATACAAAGGTCGAAAGTGGGGAAACT
ATCAAAGAACTGTTGCGATTGCTTCTCAGCATGTTACGCTGGCAAAGCGT
GGGATAGTTTAGTCCTCGGAAACCCTCCAATCATAGTAATCTGATCTAAA
TTATCGTTGAAATAGCCATATTTAAATCGAACCTCAAATTTAGTAAAAGT
TAAAGCACTATTACCGGATAGCAAAGTCATAAAATCATTATCGTGAAAAT
GTGGTCAAATCTTGCTTATTGATTTTTCAATTCCATACAACATACAGTAA
TTGTAATTTCTAATAAATTAATTAACTAGACCAGAGCTTCTTAAACTTTT
GTAATTCACGACCCCATTTATGATTGCGAGTTTCTTGACGACCCCATACA
AATATAAAAGAAAAATAAATTTATATTTTTTTAAAATTCCTATAACATCT
TCTAATTCATAGTAAATGTTATTCAAGTTATTACAATACTCTTAATAGAA
ATGCAGGTACAAACAATCTTTCCGAACTAGAAGATTTTATGATATATTTA
TCTACGATAATTGTTATTTTATCTTTATAACAATAATTTTACAAGTTAAA
AAACATTTTCTGTTAAATTGTATTTTTATCTCTCGCGACCCCAGAATTTT
GCTACGCGACCCCAAATGGGGTCGCGACCCATGGTTTAAGAAGCCCTGCT
CTAGGGTAAATTTCTATTTTATTAGAAATCCATTAGCAATGGCAC
back to top

protein sequence of SMED30009189-orf-1

>SMED30009189-orf-1 ID=SMED30009189-orf-1|Name=SMED30009189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
MESSESDTDSEDCYSSSDDYLMEEDPYYSKLIRDRHIMRKKRKAVVRKKP
LKIYMTSLVEEYKSFELENIRLFKILTAQVIKILDVPSENILYYRDKEKE
NRIQFPSDYYDAVDYGDSVIIYFVVEPNFMNFIKYDYFGSEKIGKVYKCT
YMGKKDFLILKQFRNDNNKEEEWKELMKEYEFYTKFGDHPRIVKCMGYFR
CEKASFIHLKYMTGGSLTSYLGENGPQTEPNIIRFAKQILEGIDFLHGQY
IMHRDLKGSKVLLDENLDVKLCGFRTSREFNDISSDNFKHSASESNHGSV
NWIAPEVMIGEIYGSSADIWSFGGIMIELITGNIPYHNLTVFQAIFRIAT
MKKIDFMYPPGSSSKLESFTDWCLKSDPKERATAKELLAHEFLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 125..394
e-value: 1.0E-61
score: 210.4
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 131..390
e-value: 5.9E-16
score: 55.4
NoneNo IPR availablePANTHERPTHR11584:SF369APOPTOTIC SIGNAL-REGULATING KINASE 1, ISOFORM Ccoord: 104..393
NoneNo IPR availablePANTHERPTHR11584SERINE/THREONINE PROTEIN KINASEcoord: 104..393
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 138..393
e-value: 6.8E-52
score: 176.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 132..393
score: 39.071
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 131..394